Protocadherin 2 gamma c6 sCP1

Overview
NameProtocadherin 2 gamma c6 sCP1
Smed IDSMED30000445
Length (bp)3287
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin 2 gamma c6 sCP1 (SMED30000445) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin 2 gamma c6 sCP1 (SMED30000445) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin 2 gamma c6 sCP1 (SMED30000445) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin 2 gamma c6 sCP1 (SMED30000445) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000445

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30000445SMESG000053174.1 dd_Smed_v4_7871_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30000445SMESG000053174.1 SmedASXL_016465SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30000445SMESG000053174.1 dd_Smed_v4_7871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000445SMESG000053174.1 dd_Smed_v4_7871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30000445SMESG000053174.1 dd_Smed_v4_7871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000445SMESG000053174.1 dd_Smed_v4_7871_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000445SMESG000053174.1 dd_Smed_v6_7871_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30000445SMESG000053174.1 OX_Smed_1.0.12275ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Human
Match: PCDH17 (protocadherin 17 [Source:HGNC Symbol;Acc:HGNC:14267])

HSP 1 Score: 219.55 bits (558), Expect = 1.474e-58
Identity = 193/642 (30.06%), Postives = 294/642 (45.79%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILV----TDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESR-------FRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNA-----PQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L  +D+DS L  +KQ IDRE LC      + N  C         L  ++  N++E+    I+V + D NDN P F   Q     I EN   G R PL  A D D     + +Y L       +   F L  K   DG   P L+I   LDRE+ + +T  L A+DG E  R +   +I +K+ D NDN+P FE P Y+  + EN    P+  +++    TD DE  NG +     +   + + ++F++D            +R   NLDYE+     E  + A+D G N + +   + +++++ ND +P I FV   Q      ++ E      ++A V+V+D DS  N QLQC +L                   F+   N    +++ T + +DRE  + +       VT+   D     PLN+  S  I I D NDNPP+FT+ +Y  Q+ EN    E     ++ A D DL  NG V+Y I      + S   Y  ++  NG IY  +SF+FE+   + F V+A D G P  L S++T+ V + D NDNA     P          V  N  +G+L+  + A D D     +    IV  +  +    L  +DP +G+IRT +P   + T  +   V+
Sbjct:   74 LLDVDADSGLLYTKQRIDRESLC------RHNAKCQ--------LSLEVFANDKEI--CMIKVEIQDINDNAPSFSSDQI-EMDISENAAPGTRFPLTSAHDPDAGENGLRTYLL----TRDDHGLFGLDVKSRGDGTKFPELVIQKALDREQQNHHTLVLTALDGGEPPR-SATVQINVKVIDSNDNSPVFEAPSYLVELPENA---PLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSID-------PKTGLIRVKGNLDYEE-NGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQG-----ALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTVVTDRPLDRETQDEY------NVTIVARD-GGSPPLNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPGEYL--GSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDH----LFEIDPSSGEIRTLHPFWEDVTPVVELVVK 664          

HSP 2 Score: 91.6633 bits (226), Expect = 4.842e-18
Identity = 126/501 (25.15%), Postives = 204/501 (40.72%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENG-RIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQ---LQCSLLTPRNILMIEESRFRHPVNIYKQFSL-RTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI---------QDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRAS--KLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I ++I+DINDNAP F        I EN      F +    D D  ENG R  L   +      + +F LD+  +  G    ++     LD EQ  H     + A DGG    S+T  + +++++ ND SP        +  +    + E      ++  +  +DAD   N       S   P         R R   +I  +  L R   N+D E N    ID      VQ  D   N IP +   ++ +I  D NDN P     +V  G + E      V   A +   D+D   NG++   +                 ++ F+++      Y     +  D E +  Y+  +VA D G P  L+S+ +  ++I D+NDN P+F++  +   V EN   G  +G + A D D L ++  + + +        S    ++++P  G I      + E+T    F V +K+ S     L   A + +TV D+ND+ P   L
Sbjct:  118 IKVEIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDD-----HGLFGLDVKSRGDGTKFPELVIQKALDREQQNH-HTLVLTALDGGEPPRSATVQINVKVIDSNDNSPVF------EAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVP--------DRVRELFSIDPKTGLIRVKGNLDYEENGMLEID------VQARDLGPNPIPAHCKVTVKLI--DRNDNAPSIGFVSVRQGALSEAAPPGTVI--ALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTVVTDRPLDRETQDEYNVTIVARDGGSP-PLNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPGEYLGSVLAQDPD-LGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKD-SGAPAHLESNATVRVTVLDVNDNAPVIVL 585          

HSP 3 Score: 87.0409 bits (214), Expect = 1.141e-16
Identity = 80/314 (25.48%), Postives = 145/314 (46.18%), Query Frame = 3
Query: 1371 LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQ---------DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIP 2285
            L T Q IDRE+      ++K  ++++    D EI +     I + I D+NDN P F+ +     I EN      F   + H  D D   NG  TY +          D K+  +   F       ++   ++ D E+++ ++ ++ A D G P R S++  I V++ D NDN+P F    +   + EN  +G ++  +NATD D  P + ++ +   S   +R  +L ++DP TG IR +  +D E+   +   V++++     N +     + + + D ND+ P+            I   +++QG + E+ P
Sbjct:   84 LYTKQRIDRESL--CRHNAKCQLSLEVFANDKEICM-----IKVEIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAH--DPDAGENGLRTYLLTRDDHGLFGLDVKSRGDGTKFP------ELVIQKALDREQQNHHTLVLTALDGGEPPR-SATVQINVKVIDSNDNSPVFEAPSYLVELPENAPLGTVVIDLNATDADEGP-NGEVLYSFSSYVPDRVRELFSIDPKTGLIRVKGNLDYEENGMLEIDVQARDLGP--NPIPAHCKVTVKLIDRNDNAPS------------IGFVSVRQGALSEAAP 366          

HSP 4 Score: 77.411 bits (189), Expect = 1.112e-13
Identity = 124/506 (24.51%), Postives = 207/506 (40.91%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIE--ENKPLGYRIPLPKAQDLDNAT-----FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP------IFQILVTDEDEDENGRIDLKMHNSG-------------------QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP--LNTNASIFIIINDVNDNPPKFTQNVY---YGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVR 1838
            I V V D NDN+PVF   + P   +E  EN PLG  +    A D D        +S SSY  +   +L     F +    K G+  + +   LD E+  M    + A D +  N      ++T+K+ D NDNAP     I   ++++  + +       I  + VTD D  +NG++  ++   G                   +E  +  +T+ + D+ + +              +    +   IVA+DGG   L+ST +  I+IL+ ND  P  RF + G  +     + E  +  + L  V   D D   N      + P +I           V+IY   S+  T N    A   F  +       +    D+  P  L +NA++ + + DVNDN P            +++   N    ++ + + A D D   +G++TY I D    ++   F ID  +G+I     F  +   +   +V  TD G P  LS+ + +I+R
Sbjct:  229 INVKVIDSNDNSPVF---EAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVREL-----FSIDP--KTGL--IRVKGNLDYEENGMLEIDVQARD-LGPNPIPAHCKVTVKLIDRNDNAPS----IGFVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTV-VTDRPLDR--------------ETQDEYNVTIVARDGGSPPLNSTKSFAIKILDENDNPP--RFTK-GLYV---LQVHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHI---------GDVSIYTYVSVNPT-NGAIYALRSFNFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVD---GNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPT-LSAVAKLIIR 682          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Human
Match: PCDH17 (protocadherin 17 [Source:HGNC Symbol;Acc:HGNC:14267])

HSP 1 Score: 219.55 bits (558), Expect = 9.291e-58
Identity = 196/647 (30.29%), Postives = 296/647 (45.75%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILV----TDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRF--VRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESR-------FRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTY-----HIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNA-----PQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L  +D+DS L  +KQ IDRE LC      + N  C         L  ++  N++E+    I+V + D NDN P F   Q     I EN   G R PL  A D D     + +Y L       +   F L  K   DG   P L+I   LDRE+ + +T  L A+DG E  R +   +I +K+ D NDN+P FE P Y+  + EN    P+  +++    TD DE  NG +     +   + + ++F++D            +R   NLDYE+     E  + A+D G N + +   + +++++ ND +P I F  VR G       ++ E      ++A V+V+D DS  N QLQC +L                   F+   N    +++ T + +DRE  + +       VT+   D     PLN+  S  I I D NDNPP+FT+ +Y  Q+ EN    E     ++ A D DL  NG V+Y     HI D    S   Y  ++  NG IY  +SF+FE+   + F V+A D G P  L S++T+ V + D NDNA     P          V  N  +G+L+  + A D D     +    IV  +  +    L  +DP +G+IRT +P   + T  +   V+
Sbjct:   74 LLDVDADSGLLYTKQRIDRESLC------RHNAKCQ--------LSLEVFANDKEI--CMIKVEIQDINDNAPSFSSDQIEM-DISENAAPGTRFPLTSAHDPDAGENGLRTYLL----TRDDHGLFGLDVKSRGDGTKFPELVIQKALDREQQNHHTLVLTALDGGEPPR-SATVQINVKVIDSNDNSPVFEAPSYLVELPENA---PLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSID-------PKTGLIRVKGNLDYEE-NGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQG-------ALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTVVTDRPLDRETQDEY------NVTIVARD-GGSPPLNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPGEYL--GSVLAQDPDLGQNGTVSYSILPSHIGDV---SIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDH----LFEIDPSSGEIRTLHPFWEDVTPVVELVVK 664          

HSP 2 Score: 92.0485 bits (227), Expect = 4.107e-18
Identity = 126/501 (25.15%), Postives = 204/501 (40.72%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENG-RIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQ---LQCSLLTPRNILMIEESRFRHPVNIYKQFSL-RTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI---------QDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRAS--KLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I ++I+DINDNAP F        I EN      F +    D D  ENG R  L   +      + +F LD+  +  G    ++     LD EQ  H     + A DGG    S+T  + +++++ ND SP        +  +    + E      ++  +  +DAD   N       S   P         R R   +I  +  L R   N+D E N    ID      VQ  D   N IP +   ++ +I  D NDN P     +V  G + E      V   A +   D+D   NG++   +                 ++ F+++      Y     +  D E +  Y+  +VA D G P  L+S+ +  ++I D+NDN P+F++  +   V EN   G  +G + A D D L ++  + + +        S    ++++P  G I      + E+T    F V +K+ S     L   A + +TV D+ND+ P   L
Sbjct:  118 IKVEIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDD-----HGLFGLDVKSRGDGTKFPELVIQKALDREQQNH-HTLVLTALDGGEPPRSATVQINVKVIDSNDNSPVF------EAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVP--------DRVRELFSIDPKTGLIRVKGNLDYEENGMLEID------VQARDLGPNPIPAHCKVTVKLI--DRNDNAPSIGFVSVRQGALSEAAPPGTVI--ALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTVVTDRPLDRETQDEYNVTIVARDGGSPP-LNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPGEYLGSVLAQDPD-LGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKD-SGAPAHLESNATVRVTVLDVNDNAPVIVL 585          

HSP 3 Score: 87.4261 bits (215), Expect = 1.021e-16
Identity = 80/314 (25.48%), Postives = 145/314 (46.18%), Query Frame = 3
Query: 1371 LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQ---------DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIP 2285
            L T Q IDRE+      ++K  ++++    D EI +     I + I D+NDN P F+ +     I EN      F   + H  D D   NG  TY +          D K+  +   F       ++   ++ D E+++ ++ ++ A D G P R S++  I V++ D NDN+P F    +   + EN  +G ++  +NATD D  P + ++ +   S   +R  +L ++DP TG IR +  +D E+   +   V++++     N +     + + + D ND+ P+            I   +++QG + E+ P
Sbjct:   84 LYTKQRIDRESL--CRHNAKCQLSLEVFANDKEICM-----IKVEIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAH--DPDAGENGLRTYLLTRDDHGLFGLDVKSRGDGTKFP------ELVIQKALDREQQNHHTLVLTALDGGEPPR-SATVQINVKVIDSNDNSPVFEAPSYLVELPENAPLGTVVIDLNATDADEGP-NGEVLYSFSSYVPDRVRELFSIDPKTGLIRVKGNLDYEENGMLEIDVQARDLGP--NPIPAHCKVTVKLIDRNDNAPS------------IGFVSVRQGALSEAAP 366          

HSP 4 Score: 77.411 bits (189), Expect = 1.218e-13
Identity = 124/506 (24.51%), Postives = 207/506 (40.91%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIE--ENKPLGYRIPLPKAQDLDNAT-----FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP------IFQILVTDEDEDENGRIDLKMHNSG-------------------QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP--LNTNASIFIIINDVNDNPPKF---TQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVR 1838
            I V V D NDN+PVF   + P   +E  EN PLG  +    A D D        +S SSY  +   +L        +   K G+  + +   LD E+  M    + A D +  N      ++T+K+ D NDNAP     I   ++++  + +       I  + VTD D  +NG++  ++   G                   +E  +  +T+ + D+ + +              +    +   IVA+DGG   L+ST +  I+IL+ ND  P  RF + G  +     + E  +  + L  V   D D   N      + P +I           V+IY   S+  T N    A   F  +       +    D+  P  L +NA++ + + DVNDN P     T      +++   N    ++ + + A D D   +G++TY I D    ++   F ID  +G+I     F  +   +   +V  TD G P  LS+ + +I+R
Sbjct:  229 INVKVIDSNDNSPVF---EAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVREL-------FSIDPKTGL--IRVKGNLDYEENGMLEIDVQARD-LGPNPIPAHCKVTVKLIDRNDNAPS----IGFVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTV-VTDRPLDR--------------ETQDEYNVTIVARDGGSPPLNSTKSFAIKILDENDNPP--RFTK-GLYV---LQVHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHI---------GDVSIYTYVSVNPT-NGAIYALRSFNFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVD---GNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPT-LSAVAKLIIR 682          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Human
Match: PCDHGC4 (protocadherin gamma subfamily C, 4 [Source:HGNC Symbol;Acc:HGNC:8717])

HSP 1 Score: 213.001 bits (541), Expect = 2.202e-56
Identity = 183/585 (31.28%), Postives = 283/585 (48.38%), Query Frame = 3
Query:  243 INNGLFILDSDSN-LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIF-QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNS--SNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF------SQSHFAFFVDENVEIGHLIGQINATDRDS 1958
            +N   F +D DS  L +   IDRE LC            G   +C   L+F ++    EM    + +   D ND+ P FP  Q     I E  P G R PL KAQD D  + S+SSY+L       ++  F L  K   DG  VP L++   LDREK S Y   L A+DG    R +G  E+ + + D+NDNAP F++  Y  ++ E+     +  Q+  +D D   +G +         + +  +F+L     + GK+      +  LD+E   + +EF + A+DGG  ++    +LR+ +L+VND +P I             ++ E      ++A + V D DS  N    SL  P ++    +S FR+      QFSL T   +DREA   +     I+VT    D  N  PL+T+ +IF+ I+DVNDNPP F Q  +   + E  NN    +  ++ A+D D  LN  ++Y + + +N   S + +  ++ Q G ++ ++SFD+E+     F V A D+G+P  LSS+ T+ + + D NDNAP          S     +  +V  GHLI ++ A D DS
Sbjct:   70 VNQRHFRVDLDSGALLIKNPIDREALC------------GLSASCIVPLEF-VTEGPLEMYRAEVEIV--DVNDHAPRFPRQQLDL-EIGEAAPPGQRFPLEKAQDADVGSNSISSYRLS------SNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPR-SGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLH---PTTGKLTL----LGPLDFESENY-YEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPYITVTSELG------TLPESAEPGTVVALISVQDPDSGSNG-DVSLRIPDHLPFALKSAFRN------QFSLVTAGPLDREAKSSY----DIMVTAS--DAGNP-PLSTHRTIFLNISDVNDNPPSFFQRSHEVFVPE--NNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPP-LSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDS 600          

HSP 2 Score: 123.25 bits (308), Expect = 7.857e-28
Identity = 158/591 (26.73%), Postives = 246/591 (41.62%), Query Frame = 3
Query:  522 LGY-----RIPLPK-----------AQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFK----DGVPYLIITSTLDREK-TSMYTFTLIAIDGV-EGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQI-LVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQN-------IDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS-LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPT 2201
            LGY     R P+P+           AQD    T S+S+ +L++  ++         +HF+     G   L+I + +DRE    +    ++ ++ V EG     + E+  +I D+ND+AP+F R      I E       F +    D D   N     ++ +      N+ F LD+  +S G +  ++     LD E+    +   + A DGG    S TA LR+ +L+VND +P        QQ +   S+ E   +  +L  +  SD D          L P   +    S    P  +   FSL  T         +D E+   +  D      V+  D  +   +  + S+ + + DVNDN P  T     G + E+     V   A I   D D   NG V+  I D    +    FR       +  +   D E +S Y  +V A+D G+P  LS+  TI + I D NDN P F Q     FV EN   G L+  + A+D DS L        +   +    AS  I+L+P TG +      D E+T T+ F V++++  R    L     + + V DLND+ P 
Sbjct:   24 LGYVCGQIRYPVPEESQEGTFVGNVAQDFLLDTDSLSARRLQVAGEVNQ-------RHFRVDLDSGA--LLIKNPIDREALCGLSASCIVPLEFVTEGPLEMYRAEV--EIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSS------NEHFALDVKKRSDGSLVPELLLEKPLDREK-QSDYRLVLTAVDGGNPPRSGTAELRVSVLDVNDNAPAF------QQSSYRISVLESAPAGMVLIQLNASDPD----------LGPSGNVTFYFSG-HTPDRVRNLFSLHPTTGKLTLLGPLDFESENYYEFD------VRARDGGSPA-MEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVV--ALISVQDPDSGSNGDVSLRIPDHLPFALKSAFR---NQFSLVTAGPLDREAKSSYDIMVTASDAGNPP-LSTHRTIFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARD--RGNPPLSSTVTVRLFVLDLNDNAPA 564          

HSP 3 Score: 92.8189 bits (229), Expect = 2.170e-18
Identity = 100/372 (26.88%), Postives = 165/372 (44.35%), Query Frame = 3
Query: 1125 IQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS---------LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            ++I++VND +P  RF R  QQ+     I E     +     +  DAD   N +    L+      ++  + R   ++  +  L   + +DRE       D ++++T    D  N  P +  A + + + DVNDN P F Q+ Y   + E+     V +   ++A+D DL  +G VT++            F +    GK+      DFE E+ Y F V A D G P  +    ++ V + D NDNAP  + +     + E+ E G ++  I+  D DS         +P+H  + F +KS  +N+ S L+T  PL          DRE  S+    V   ++ NP      L     I + + D+ND+PP+F
Sbjct:  121 VEIVDVNDHAP--RFPR--QQLD--LEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFALDVKK-RSDGSLVPELLLE--KPLDREKQS----DYRLVLTAV--DGGNP-PRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQ--LNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLHPTTGKLTLLGPLDFESENYYEFDVRARDGGSPA-MEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDH--LPFALKSAFRNQFS-LVTAGPL----------DREAKSSYDIMVTASDAGNPP-----LSTHRTIFLNISDVNDNPPSF 455          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Human
Match: PCDHGC4 (protocadherin gamma subfamily C, 4 [Source:HGNC Symbol;Acc:HGNC:8717])

HSP 1 Score: 213.386 bits (542), Expect = 3.106e-56
Identity = 180/585 (30.77%), Postives = 279/585 (47.69%), Query Frame = 3
Query:  243 INNGLFILDSDSN-LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIF-QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNS--SNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF------SQSHFAFFVDENVEIGHLIGQINATDRDS 1958
            +N   F +D DS  L +   IDRE LC            G   +C   L+F ++    EM    + +   D ND+ P FP  Q     I E  P G R PL KAQD D  + S+SSY+L       ++  F L  K   DG  VP L++   LDREK S Y   L A+DG    R +G  E+ + + D+NDNAP F++  Y  ++ E+     +  Q+  +D D   +G +         + +  +F+L            ++  +  LD+E   + +EF + A+DGG  ++    +LR+ +L+VND +P I             ++ E      ++A + V D DS  N    SL  P ++    +S FR+      QFSL T   +DREA       S   + V   D  N  PL+T+ +IF+ I+DVNDNPP F Q  +   + E  NN    +  ++ A+D D  LN  ++Y + + +N   S + +  ++ Q G ++ ++SFD+E+     F V A D+G+P  LSS+ T+ + + D NDNAP          S     +  +V  GHLI ++ A D DS
Sbjct:   70 VNQRHFRVDLDSGALLIKNPIDREALC------------GLSASCIVPLEF-VTEGPLEMYRAEVEIV--DVNDHAPRFPRQQL-DLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLS------SNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPR-SGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLH-------PTTGKLTLLGPLDFESENY-YEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPYITVTSELG------TLPESAEPGTVVALISVQDPDSGSNG-DVSLRIPDHLPFALKSAFRN------QFSLVTAGPLDREAK------SSYDIMVTASDAGNP-PLSTHRTIFLNISDVNDNPPSFFQRSHEVFVPE--NNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPP-LSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDS 600          

HSP 2 Score: 122.865 bits (307), Expect = 1.234e-27
Identity = 159/601 (26.46%), Postives = 248/601 (41.26%), Query Frame = 3
Query:  522 LGY-----RIPLPK-----------AQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFK----DGVPYLIITSTLDREK-TSMYTFTLIAIDGV-EGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQI-LVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQN-------IDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSL-----------PEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPT 2201
            LGY     R P+P+           AQD    T S+S+ +L++  ++         +HF+     G   L+I + +DRE    +    ++ ++ V EG     + E+  +I D+ND+AP+F R      I E       F +    D D   N     ++ +      N+ F LD+  +S G +  ++     LD E+    +   + A DGG    S TA LR+ +L+VND +P        QQ +   S+ E   +  +L  +  SD D          L P   +    S    P  +   FSL  T         +D E+   +  D      V+  D  +   +  + S+ + + DVNDN P  T     G + E+     V   A I   D D   NG V+  I D    +    FR       +  +   D E +S Y  +V A+D G+P  LS+  TI + I D NDN P F Q     FV EN   G L+  + A+D DS            P ++D+           AS  I+L+P TG +      D E+T T+ F V++++  R    L     + + V DLND+ P 
Sbjct:   24 LGYVCGQIRYPVPEESQEGTFVGNVAQDFLLDTDSLSARRLQVAGEVNQ-------RHFRVDLDSGA--LLIKNPIDREALCGLSASCIVPLEFVTEGPLEMYRAEV--EIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSS------NEHFALDVKKRSDGSLVPELLLEKPLDREK-QSDYRLVLTAVDGGNPPRSGTAELRVSVLDVNDNAPAF------QQSSYRISVLESAPAGMVLIQLNASDPD----------LGPSGNVTFYFSG-HTPDRVRNLFSLHPTTGKLTLLGPLDFESENYYEFD------VRARDGGSPA-MEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVV--ALISVQDPDSGSNGDVSLRIPDHLPFALKSAFR---NQFSLVTAGPLDREAKSSYDIMVTASDAGNPP-LSTHRTIFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDV----------SASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARD--RGNPPLSSTVTVRLFVLDLNDNAPA 564          

HSP 3 Score: 93.2041 bits (230), Expect = 1.539e-18
Identity = 100/372 (26.88%), Postives = 165/372 (44.35%), Query Frame = 3
Query: 1125 IQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS---------LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            ++I++VND +P  RF R  QQ+     I E     +     +  DAD   N +    L+      ++  + R   ++  +  L   + +DRE       D ++++T    D  N  P +  A + + + DVNDN P F Q+ Y   + E+     V +   ++A+D DL  +G VT++            F +    GK+      DFE E+ Y F V A D G P  +    ++ V + D NDNAP  + +     + E+ E G ++  I+  D DS         +P+H  + F +KS  +N+ S L+T  PL          DRE  S+    V   ++ NP      L     I + + D+ND+PP+F
Sbjct:  121 VEIVDVNDHAP--RFPR--QQLD--LEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFALDVKK-RSDGSLVPELLLE--KPLDREKQS----DYRLVLTAV--DGGNP-PRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQ--LNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLHPTTGKLTLLGPLDFESENYYEFDVRARDGGSPA-MEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDH--LPFALKSAFRNQFS-LVTAGPL----------DREAKSSYDIMVTASDAGNPP-----LSTHRTIFLNISDVNDNPPSF 455          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Human
Match: PCDHGA5 (protocadherin gamma subfamily A, 5 [Source:HGNC Symbol;Acc:HGNC:8703])

HSP 1 Score: 197.208 bits (500), Expect = 1.731e-51
Identity = 190/624 (30.45%), Postives = 308/624 (49.36%), Query Frame = 3
Query:  255 LFILDSDSN-LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLE--LPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQD--FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF-------SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT-RYPIDRE 2081
            LF L+  S  L  + +IDREELC        + +C        +++F I   N+ M+   + V + D NDN P F   +     + EN   G R+ LP A+D D    S+ SY+L   L F L   S  +  K+     P L++   LDREK +++   L A+DG +    +G T I + + D NDNAP F    Y  ++ EN+ V   +  +  TD DE  NG++     N  +E I++ F    LD ++G    ++  + +LDYE+    +  ++VAQDGG  +L ++A + + + +VND +PE+        +T   SI E  L   ++A   V D DS  N ++ CS+  PRN+       F+   ++   + L TT+++DRE       D  I +TV   D+    PL+T + I + + DVNDNPP F Q  Y   + E  NN       ++ A D D   N +VTY + +  F+ +  + Y  I+S  G +Y  +SFD+E+       V A+D G+P  LSS+ ++ + + DQNDN P+          S        + E G+L+ ++ A D+DS  ++  + + +   S+     L  +   TG++RT R  +DR+
Sbjct:   74 LFALNPRSGSLVTAGRIDREELC------AQSPLC--------VVNFNILVENK-MKIYGVEVEIIDINDNFPRFRDEEL-KVKVNENAAAGTRLVLPFARDADVGVNSLRSYQLSSNLHFSLDVVSGTDGQKY-----PELVLEQPLDREKETVHDLLLTALDGGDPVL-SGTTHIRVTVLDANDNAPLFTPSEYSVSVPENIPVGTRLLMLTATDPDEGINGKLTYSFRNE-EEKISETFQ---LDSNLG----EISTLQSLDYEE-SRFYLMEVVAQDGG--ALVASAKVVVTVQDVNDNAPEVILT----SLTS--SISEDCLPGTVIALFSVHDGDSGENGEIACSI--PRNL------PFKLEKSVDNYYHLLTTRDLDREETS----DYNITLTVM--DHGTP-PLSTESHIPLKVADVNDNPPNFPQASYSTSVTE--NNPRGVSIFSVTAHDPDSGDNARVTYSLAEDTFQGAPLSSYVSINSDTGVLYALRSFDYEQLRDLQLWVTASDSGNPP-LSSNVSLSLFVLDQNDNTPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDS-GQNAWLSYRLLKASE---PGLFAVGLHTGEVRTARALLDRD 636          

HSP 2 Score: 83.5741 bits (205), Expect = 1.470e-15
Identity = 93/354 (26.27%), Postives = 162/354 (45.76%), Query Frame = 3
Query: 1296 LTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDRE---ANEPF-LIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNG-------KIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKS-------QLIISL------ETLQQGQICESIP 2285
            L  R + ++   R +      +  SL T   IDRE   A  P  +++  I+V  +   Y  E+           I D+NDN P+F       ++ EN       +     A D D+ +N   +Y +     SSN ++F +D  +G       ++   Q  D EKE+++  ++ A D G P  LS ++ I V + D NDNAP F+ S ++  V EN+ +G  +  + ATD D     K + +  +++ + + S+   LD   G+I T   +D E++      V +++       L+  A +V+TV+D+ND+ P   L   + S         +I+L      ++ + G+I  SIP
Sbjct:   59 LAERGVRIVSRGRTQLFALNPRSGSLVTAGRIDREELCAQSPLCVVNFNILVENKMKIYGVEVE----------IIDINDNFPRFRDEELKVKVNENAAAGTRLVLP--FARDADVGVNSLRSYQL-----SSN-LHFSLDVVSGTDGQKYPELVLEQPLDREKETVHDLLLTALDGGDP-VLSGTTHIRVTVLDANDNAPLFTPSEYSVSVPENIPVGTRLLMLTATDPDEGINGK-LTYSFRNE-EEKISETFQLDSNLGEISTLQSLDYEESRFYLMEVVAQDGGA----LVASAKVVVTVQDVNDNAPEVILTSLTSSISEDCLPGTVIALFSVHDGDSGENGEIACSIP 387          

HSP 3 Score: 80.4925 bits (197), Expect = 1.193e-14
Identity = 122/486 (25.10%), Postives = 209/486 (43.00%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE-QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFS-LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRA--SKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            + ++I DINDN P+F        + EN        +L    D D    + +    S Q   N  F+LD++  + G+   ++     LD E +  H  +  + A DGG   LS T  +R+ +L+ ND +P   F  +   ++   +I  GT     L  +  +D D  IN +L  S    RN    EE +      +      + T Q++D E +  +L++    V  Q     +   L  +A + + + DVNDN P+         I E+     V    ++H  D D   NG++   I   +N    + F+++      Y+   ++  D E+ S Y+  +   D G P  LS+ S I +++ D NDN P F Q+ ++  V EN   G  I  + A D DS  ++  + + +  D+   A  S  ++++  TG +      D E+   +  +V   +S NP      L     + + V D ND+ P
Sbjct:  119 VEVEIIDINDNFPRFRDEELKVKVNENAAAGTRL-VLPFARDAD----VGVNSLRSYQLSSNLHFSLDVVSGTDGQKYPELVLEQPLDREKETVH--DLLLTALDGGDPVLSGTTHIRVTVLDANDNAP--LFTPSEYSVSVPENIPVGTR----LLMLTATDPDEGINGKLTYSF---RN----EEEKISETFQLDSNLGEISTLQSLDYEESRFYLME----VVAQ-----DGGALVASAKVVVTVQDVNDNAPEVILTSLTSSISEDCLPGTVIALFSVH--DGDSGENGEIACSIP--RN----LPFKLEKSVDNYYHLLTTRDLDREETSDYNITLTVMDHGTPP-LSTESHIPLKVADVNDNPPNFPQASYSTSVTENNPRGVSIFSVTAHDPDS-GDNARVTYSLAEDTFQGAPLSSYVSINSDTGVLYALRSFDYEQLRDLQLWVTASDSGNPP-----LSSNVSLSLFVLDQNDNTP 560          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 140.969 bits (354), Expect = 2.318e-33
Identity = 165/594 (27.78%), Postives = 263/594 (44.28%), Query Frame = 3
Query:  444 VDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFT-LDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRH--PVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIR--TRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFR 2207
            V D ND+ P   I      T+EEN  +G  +    A D D+    +  Y +E       S DF +     +    +  T  LDRE T+ Y+  + A D    + NT  T I + ++DINDNAP F++  Y  TI E +     I  +   D DED+  +I  ++  + +E    +F+ LDI DQ  G + +    +   D     H    +I A D G   L     + + I +VN  +P      N    +    I E +     +  ++  D D   N         R +  I+ S+F    P        +  + ++DRE    F     +IVT    D+ +  PLNT+  I +I++D+NDN P+FT + Y   I E+I     F+   + A D D+  NG V Y + +  +S +   FR+D  +G +  S   D E+ ++    + A D+G P+ LS++S I + + D NDNAP F Q  +  ++ EN  +G  +G I A D D   ++ DI F +   +  +   +       G +R  TR   D E  +   FF E +  S     L     + I V D+ND+ P  +
Sbjct:  110 VIDINDHAPTL-IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME------GSEDFII----DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTT-IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADRE----VFSILDIGDQ--GAILSVSGELKRQD-----HKVRVEISATDQG--GLQGRCVVNVFIDDVNS-APYF----NDHPFS--VKIPEHSPIGYPVITLKAEDHDRGDNA--------RIVYSIDSSQFFRIDP----SSGDISVSSDLDREDRATF----SVIVTAS--DHASP-PLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQ--VSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPS-LSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADE-GDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKAN-KFFFELQASS---GQLSSTVPVRIHVSDVNDNKPALK 642          

HSP 2 Score: 121.709 bits (304), Expect = 1.778e-27
Identity = 153/594 (25.76%), Postives = 261/594 (43.94%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQV-SDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
             + + V D NDN PVF    +   TI EN  +   I   KA D D  T     Y +     +G      L   +  G   + +   +D  K S  T  + A DG +   ++    +TI + DIND+AP       + T++ENV I + + ++   DED   NG I   M  S            I+D+  G     ++    LD E     +  K+ A+D G  SL+++ T+ + + ++ND +P   F +    +T    +  G+   +I+    V +D D  I               IEE+       ++    +     I   + E    D K+ V +   D      L     + + I+DVN + P F  + +  +I E  ++   +    + A D D   N ++ Y I       ++ +FRID  +G I  S   D E  + +S IV A+D   P  L++S+ I V + D NDN+PQF+ S +A  + E++ +G    Q++A D D  P +  + + +   S + + +L  LD  +G +R    +DRE+ + I   + +++  R    L   + I +T+ D+ND+ PTF
Sbjct:    1 MVEITVVDVNDNAPVFA-SDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG-----LTIDYSTG--EVTLRERID-AKNSPITAVIRAKDGAQPALSS-TVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF---------IIDEDSG----LIKTTKLLDRETTAR-YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPT--FDKKEYNVTISEEMPRGS---QIITLKAVDNDEDQKIT------------YRIEEAD----REVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG---LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPE--HSPIGYPVITLKAEDHDRGDNARIVYSID------SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPP-LNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGP-NGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARD--RGTPSLSAASEITLTLSDVNDNAPTF 533          

HSP 3 Score: 92.4337 bits (228), Expect = 1.512e-18
Identity = 81/260 (31.15%), Postives = 124/260 (47.69%), Query Frame = 3
Query: 1500 IIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN---PSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQI 2270
            I + DVNDN P F  + Y   I ENI    V   A + A D+D   NGKV Y +    +SS      ID   G++   +  D  K S  + ++ A D   P  LSS+  + + + D ND+AP    +     ++ENV IG  +G++ A D DS P       I+K   +   S+   +D  +G I+T   +DRE T+  +  V +++   PS     L     I + ++D+ND+ PTF   D  +  + IS E  +  QI
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVI--ATVKATDEDFGTNGKVHYSM---ASSSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNG-----IIKYSME--GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPS-----LNTSTTIAVVLKDINDNAPTF---DKKEYNVTISEEMPRGSQI 241          

HSP 4 Score: 79.337 bits (194), Expect = 1.497e-14
Identity = 77/248 (31.05%), Postives = 116/248 (46.77%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYC-TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRN-TGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIR 1166
            I V +DD NDN+P F    + Y  TI E+ P+G       A D D     +  Y L       +   F L +    G   L ++S LDRE+ ++    + A D   G  + +  +EIT+ + D+NDNAP FE+  Y   I EN  V   +  I+  D DE +N  I  ++         K+F ++   +  G V+   RA    DYE   + F F++ A  G    LSST  +RI + +VND  P ++
Sbjct:  411 IEVILDDINDNSPQF--TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDR--TSGT--LRVSSKLDREQFAVIVLPIFARD--RGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADA---KLFDIEEDAEQNGVVRILTRA--EFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALK 642          

HSP 5 Score: 74.7146 bits (182), Expect = 3.472e-13
Identity = 144/585 (24.62%), Postives = 242/585 (41.37%), Query Frame = 3
Query:  258 FILDSDSNL-KVSKQIDREELCPPQMMLQLNKV-CGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPY-CTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAK--HFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF-ERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNIL--MIEESRFRHPVNIYK----QFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRID---SQNG--KIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVD--ENVEIGHLIGQINATDRD 1955
            FI+D DS L K +K +DRE      + +    +   S++T                 S  I V + D NDN P F   +  Y  TI E  P G +I   KA  +DN      +Y++E        +D E+       D    L ++  L R+   +     + I   +     G+  + + I D+N +AP F + P  ++  + + I  P+  +   D D  +N RI   + +S      + F    +D S G +       ++LD E    +F   + A D     L+++  + + + ++ND SP+  F  +    T    I  GT      +++QVS  D+ I         P  I+   + ES     + +++      +LR +  +DRE    F +   I++ +   D      L+  + I + ++DVNDN P F Q  Y   I EN           I A D D   N  +++ I      ++A  F I+    QNG  +I     FD+E ++   F  +    G   +LSS+  + + + D NDN P      F   ++  +NV++   IG I A D D
Sbjct:  165 FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNT-----------------STTIAVVLKDINDNAPTFD--KKEYNVTISEEMPRGSQIITLKA--VDNDEDQKITYRIE-------EADREVFSILDIGDQGAILSVSGELKRQDHKVR----VEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS------QFFR---IDPSSGDISVS----SDLDRED-RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQ--FTSSSYAATISEDIPVGT------SFLQVSAIDADIG--------PNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQ---FAV---IVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTV--GTIVARDADEGDNADISFRI---FGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALKD--FVILMNRFDNVQMARQIGFIPAFDPD 669          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 140.584 bits (353), Expect = 3.202e-33
Identity = 165/594 (27.78%), Postives = 263/594 (44.28%), Query Frame = 3
Query:  444 VDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFT-LDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRH--PVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIR--TRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFR 2207
            V D ND+ P   I      T+EEN  +G  +    A D D+    +  Y +E       S DF +     +    +  T  LDRE T+ Y+  + A D    + NT  T I + ++DINDNAP F++  Y  TI E +     I  +   D DED+  +I  ++  + +E    +F+ LDI DQ  G + +    +   D     H    +I A D G   L     + + I +VN  +P      N    +    I E +     +  ++  D D   N         R +  I+ S+F    P        +  + ++DRE    F     +IVT    D+ +  PLNT+  I +I++D+NDN P+FT + Y   I E+I     F+   + A D D+  NG V Y + +  +S +   FR+D  +G +  S   D E+ ++    + A D+G P+ LS++S I + + D NDNAP F Q  +  ++ EN  +G  +G I A D D   ++ DI F +   +  +   +       G +R  TR   D E  +   FF E +  S     L     + I V D+ND+ P  +
Sbjct:  469 VIDINDHAPTL-IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME------GSEDFII----DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTT-IAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADRE----VFSILDIGDQ--GAILSVSGELKRQD-----HKVRVEISATDQG--GLQGRCVVNVFIDDVNS-APYF----NDHPFS--VKIPEHSPIGYPVITLKAEDHDRGDNA--------RIVYSIDSSQFFRIDP----SSGDISVSSDLDREDRATF----SVIVTAS--DHASP-PLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQ--VSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPS-LSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADE-GDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKAN-KFFFELQASS---GQLSSTVPVRIHVSDVNDNKPALK 1001          

HSP 2 Score: 132.88 bits (333), Expect = 6.107e-31
Identity = 180/666 (27.03%), Postives = 299/666 (44.89%), Query Frame = 3
Query:  255 LFILDSDSN-LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAID-GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQ-ILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRN----------GQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFI-VVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV-ESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            LF LD+ S  ++++K +DRE L   + +L++        T    +D  IS       S  + V V D  DN+P+F    + +  I E+ P+G  +    A+DLD+      + ++E     GN  +  LA + K GV  +   + LDRE  S+    +IA D G     +T   EIT+   D+NDNAP F    Y  TI EN+ +  +   +  TDED   NG++   M +S     + I  L I D S G+V  + R    +D +         I A+DG + +LSST  L I ++++ND +P +   +           G+++   ++IDE +  N I+ Y      D +I+               E+S             ++TT+ +DRE    +     + VT +    D   P LNT+ +I +++ D+NDN P F +  Y   I E +      +   + A D D   + K+TY I++   +   ++  +D  +     S S + +++     + + ATDQG    L     + V I D N +AP F+   F+  + E+  IG+ +  + A D D      + R +   DS    S+   +DP +G I     +DRE  +T +  V  S + S   N   Q   I + + D+ND+ P F
Sbjct:  212 LFTLDTMSGEIRLAKSMDREVL--DKHILKV--------TAYERVDPTIS------ASTTVVVHVLDVQDNSPIFE-KDSYFGEIREDAPIGTTVLSVFARDLDSG----ENGEIEYSLGEGNGKNL-LAINAKSGV--IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVV--DVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASS-----SGIGGLTI-DYSTGEVTLRER----IDAKN--SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIID---------------EDSGL-----------IKTTKLLDRETTARY----SLKVTAR----DMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIIT--LKAVDNDE--DQKITYRIEE---ADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG---LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHD---RGDNARIVYSIDS----SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQ---IEVILDDINDNSPQF 784          

HSP 3 Score: 98.2117 bits (243), Expect = 3.024e-20
Identity = 123/443 (27.77%), Postives = 195/443 (44.02%), Query Frame = 3
Query:  963 IFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLL--TPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN---PSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQI 2270
            +FTLD +         ++R   ++D E L      K+ A +    ++S++ T+ + +L+V D SP         +I     I    LS      V   D DS  N +++ SL     +N+L I            K   ++T   +DRE     LI   +I +      D   P   + A + I + DVNDN P F  + Y   I ENI    V   A + A D+D   NGKV Y +    +SS      ID   G++   +  D  K S  + ++ A D   P  LSS+  + + + D ND+AP    +     ++ENV IG  +G++ A D DS P       I+K   +   S+   +D  +G I+T   +DRE T+  +  V +++   PS     L     I + ++D+ND+ PTF   D  +  + IS E  +  QI
Sbjct:  212 LFTLDTM-------SGEIRLAKSMDREVLDKHI-LKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLS------VFARDLDSGENGEIEYSLGEGNGKNLLAINA----------KSGVIQTAAPLDRETLS--LIRLDVIAS------DKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVI--ATVKATDEDFGTNGKVHYSM---ASSSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNG-----IIKYSME--GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPS-----LNTSTTIAVVLKDINDNAPTF---DKKEYNVTISEEMPRGSQI 600          

HSP 4 Score: 79.337 bits (194), Expect = 1.740e-14
Identity = 77/248 (31.05%), Postives = 116/248 (46.77%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYC-TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRN-TGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIR 1166
            I V +DD NDN+P F    + Y  TI E+ P+G       A D D     +  Y L       +   F L +    G   L ++S LDRE+ ++    + A D   G  + +  +EIT+ + D+NDNAP FE+  Y   I EN  V   +  I+  D DE +N  I  ++         K+F ++   +  G V+   RA    DYE   + F F++ A  G    LSST  +RI + +VND  P ++
Sbjct:  770 IEVILDDINDNSPQF--TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDR--TSGT--LRVSSKLDREQFAVIVLPIFARD--RGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADA---KLFDIEEDAEQNGVVRILTRA--EFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALK 1001          

HSP 5 Score: 75.0998 bits (183), Expect = 3.262e-13
Identity = 144/585 (24.62%), Postives = 242/585 (41.37%), Query Frame = 3
Query:  258 FILDSDSNL-KVSKQIDREELCPPQMMLQLNKV-CGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPY-CTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAK--HFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF-ERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNIL--MIEESRFRHPVNIYK----QFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRID---SQNG--KIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVD--ENVEIGHLIGQINATDRD 1955
            FI+D DS L K +K +DRE      + +    +   S++T                 S  I V + D NDN P F   +  Y  TI E  P G +I   KA  +DN      +Y++E        +D E+       D    L ++  L R+   +     + I   +     G+  + + I D+N +AP F + P  ++  + + I  P+  +   D D  +N RI   + +S      + F    +D S G +       ++LD E    +F   + A D     L+++  + + + ++ND SP+  F  +    T    I  GT      +++QVS  D+ I         P  I+   + ES     + +++      +LR +  +DRE    F +   I++ +   D      L+  + I + ++DVNDN P F Q  Y   I EN           I A D D   N  +++ I      ++A  F I+    QNG  +I     FD+E ++   F  +    G   +LSS+  + + + D NDN P      F   ++  +NV++   IG I A D D
Sbjct:  524 FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNT-----------------STTIAVVLKDINDNAPTFD--KKEYNVTISEEMPRGSQIITLKA--VDNDEDQKITYRIE-------EADREVFSILDIGDQGAILSVSGELKRQDHKVR----VEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS------QFFR---IDPSSGDISVS----SDLDRED-RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQ--FTSSSYAATISEDIPVGT------SFLQVSAIDADIG--------PNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQ---FAV---IVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTV--GTIVARDADEGDNADISFRI---FGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALKD--FVILMNRFDNVQMARQIGFIPAFDPD 1028          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 128.257 bits (321), Expect = 1.951e-29
Identity = 138/519 (26.59%), Postives = 227/519 (43.74%), Query Frame = 3
Query:  669 LIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRF----VRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTS--TITFFVESKN-PSRIFNDLIQEAMIVITVRDLNDSPPT 2201
            + I  T D EK   Y  T+IA +    N  T  + I+I+++D+NDN P F    Y  T++E    + P+  +  +D D    G +   + +    +            SI  V  +V A   L   +    F   + A+DGG  S  ++A + I +++ +  +P+       +R  + I  G +I      +K+   +   D D              N  + E++       IY       T+ +D + ++  L++  I  T+   +       +    + I I D NDNPP+F+ ++    I E++  HE F    + A+DKD   NG+V Y I    +S       ID   G++      D+E    Y   V ATD G P R SS+ T+ + + D NDNAP+F +S +   V EN     ++G++ A D+DSL E+  I + +        S+   +D   G + T+  IDRE  S   I+   E K  P R        A   I+V D+ND+PP+
Sbjct:  595 VCIQKTFDFEKQKSYQTTVIATNA---NSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSF------------SINPVTGEVFAQKPLARGR----FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQD-------------HNFSIDEDTG-----KIY------VTRYLDADVHDTVLLN--IQATLPSGE-------SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFY--VVQASDKDKKKNGEVRYSI---ISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPR-SSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSL-ENGQIVYRI-----TNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPR-----SSTASARISVLDVNDNPPS 1044          

HSP 2 Score: 110.153 bits (274), Expect = 5.798e-24
Identity = 166/675 (24.59%), Postives = 277/675 (41.04%), Query Frame = 3
Query:  333 MLQLNKVCGSIHTCCHILDFQ-------ISCNNEEMQSNF-IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDA--DSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDRE-ANE---PFLI--DSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKD----------PSKSQLIISLETLQQGQICE 2276
             L++++  G I T  H LD++       ++   EE      I V VDDENDN P F   Q     I E   LG    LP   D D   F V  + + L   + N       K  +     L++   LDRE    Y   + A DG +  +  G+   +I+I D NDNAP F R  Y  ++  N+ I   +  +  TD D  EN RI   +  +     N  F +           +Q   I          + +  +VA D G  SLSS+A + I +L     SP +  +   +  +    ++  TL + I+A V ++    D+ +  +  S L P+              +    + L     +DRE A+E    FL+  D +II+         E P        + I D+NDN P++    +  QI  ++N  +   +  + A D DL  NG + Y + D +         ID + G+I+   + D    S   F V A D G P  LS+   ++  + D     PQF ++ +   + E+  IG  + ++ A +       K IR+ +++  ++     +T+D ++G +  +   D EK  +    V + N     N     ++I I ++D+ND+ P F   +          P +  L++S   +  G   E
Sbjct:   68 FLKVDERSGEISTIAH-LDYEKRSKFDIVAVKVEESGETIDILVEVDDENDNAPSF-ADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVI-LQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAK-IGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAP-SNSNFAI-----------SQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHL-MENSTLGS-IVARVSIAQQYRDTKLRLIGSSALCPQQ------------TDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIII---------EHPQ------LLTIGDINDNAPQW----HSSQIHISLNRTQ-GGSRTLTAKDPDLGQNGWIRYSVLDTE------LVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSP-ALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANN-SQCGNSKRIRYSLQNQDEH-----LTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNA----NSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGE 675          

HSP 3 Score: 75.485 bits (184), Expect = 2.034e-13
Identity = 123/518 (23.75%), Postives = 216/518 (41.70%), Query Frame = 3
Query:  669 LIITSTLDREKTSMYTFT-LIAIDG---VEGNRNTGKTEITIKIRDINDNAPKFERP-IYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIR-TRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            L++   LDRE  S +    L+  DG   +E  +        + I DINDNAP++    I+I     N        +   D D  +NG            WI +   LD    SI K   ++   N +D   +    +F++ A+DGG  +LS+   +   +L+     P+  F +   Q+        GT   K++A           N  QC     + I    +++  H        ++   +  D E  + +        TV   + ++E    + + I I + DVNDN P F  N Y+  + E     E  +   + A+D D    G+V+YHI      S +  F I+   G+++  +     +   +  +V A D G  +   +S+ I + + D++   PQFS+S +     E++  G  IG + A  +        +++ + S  Q+      ++D  TG+I  TRY +D +   T+   +++  PS   N    +  +VI + D ND+PP F
Sbjct:  395 LLLCGILDRETASEHHLKFLLEKDGQIIIEHPQ-------LLTIGDINDNAPQWHSSQIHISL---NRTQGGSRTLTAKDPDLGQNG------------WI-RYSVLDTELVSIDKETGRIFVPNTIDC-NIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQ--FEKALWQVEIPEDTPIGTCLVKVVA-----------NNSQCG--NSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQ------TTVIATNANSE---TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLL--VVSASDMDSGTFGEVSYHIL-----SESSSFSINPVTGEVFAQKPLARGR---FHLVVSAKDGGGQSS-ENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSK--------VKYSIYSGDQDHN---FSIDEDTGKIYVTRY-LDADVHDTVLLNIQATLPSGESN----QTQVVIFIEDHNDNPPQF 837          

HSP 4 Score: 72.7886 bits (177), Expect = 1.394e-12
Identity = 99/375 (26.40%), Postives = 167/375 (44.53%), Query Frame = 3
Query:  723 LIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRI 1841
            L+ I     +  + +T++ I I D NDN P+F   +   +I+E++ + +P + +  +D+D+ +NG +   + +S     +   +++I DQ  G    Q+   + LDYE    +++ ++ A D G    SS  TL I +L+VND +PE       ++      + E +    I+  V   D DS+ N Q+   +        I+E       N+Y      T ++IDRE      + S + +++  +D     P ++ AS  I + DVNDNPP     +    I     +        I A D D  LNG V Y  Q       +  F + S NG +Y  +  +   E      V+ +DQG P R S    + VRI
Sbjct:  806 LLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISS-----HPGSSIEI-DQFTG----QLSTGSLLDYEAT-RNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF------EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLG----NVY------TKRSIDRE------VISHVDISIVAED-KGVPPRSSTASARISVLDVNDNPPSC---LSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQ-----LQSSLFVVKS-NGDVYLRRQLNASDERHQRLSVIVSDQGVP-RKSVVCHVPVRI 1136          

HSP 5 Score: 72.0182 bits (175), Expect = 2.907e-12
Identity = 75/263 (28.52%), Postives = 123/263 (46.77%), Query Frame = 3
Query:  381 ILDFQISCNNEEMQSNFIRVFVDDENDNNPVFP--IVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDF-ELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIF-QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSP 1157
            +L+ Q +  + E     + +F++D NDN P F   +V+    +I E+  L     + +A D D        Y + +    G+S +  +       G       S LD E T  Y   + A D     R++  T + I + D+NDNAP+FE+  Y   + EN     I  +++  D+D  ENG+I  ++ N G E+         +D+ +G V  +     ++D E + H  +  IVA+D G    SSTA+ RI +L+VND  P
Sbjct:  806 LLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVE---ISIREDLKLHEPFYVVQASDKDKKKNGEVRYSI-ISSHPGSSIEIDQFTGQLSTG-------SLLDYEATRNYKLRVKATDLGIPPRSSNMT-LFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN-GSEYFG-------IDEKLGNVYTK----RSIDREVISH-VDISIVAEDKGVPPRSSTASARISVLDVNDNPP 1043          

HSP 6 Score: 68.9366 bits (167), Expect = 2.131e-11
Identity = 141/615 (22.93%), Postives = 244/615 (39.67%), Query Frame = 3
Query:  378 HILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLD---NATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAP-KFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNI-YKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIE-ENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            H+L   ++       S  +RV V D+NDN P           I E+  +G  +   +A D+D   N  FS         F+L   S   L    + G   L   S+L   K  +     +   GV G       EI+ +       AP +F +  Y+ TI E +   P  Q +   + E       +   N     I+  F++D         +  +R    LD E L   +  K++    G+  + +   +R+   N+ND  P     +  +       + E       +A V   D D+         L P    ++ +S  + P +    QF    T  I   A   F +  +  +T++  D       +T  ++ I ++D+NDN P F++ +Y   +     +  + F     H    DL   G +TY +       ++  FR+  ++G ++  +      E  Y   V ATD G P+  +S    ++  + +  + P F ++ F F V EN +IG  IG ++        E ++  + ++      ASK+ ++D   G++    PIDRE+ +T  F VE  N   + +  +Q    VI V D ND+ P F
Sbjct: 1695 HLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFS---------FELLEDSSGSLDLVPETGDLVLRRLSSLQSWKIKLR----VVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGL---PRGQFIAKLQPELAGLTYSIVEGN-----IDSAFSVD--------SEGVIRTNLELDREIL-ERYSLKVIGTGSGQQ-IGTRVDVRVN--NLNDNVPSFPMSKPRR-------VPENLRVGSYVATVGAKDVDN---------LAPLRYFLVSDSSGQTPTHFNIDQF----TGTIHLTAPLDFEVLPEHTLTIKATDGS----FDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAH----DLDARGALTYSL----GQGSSSIFRVAPESGALF-MKVLPPAGER-YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGE------ESREFHYRIQDP---EASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEIDN-EMMTSQKVQCKCHVI-VLDENDNLPVF 2230          

HSP 7 Score: 51.6026 bits (122), Expect = 4.723e-6
Identity = 122/520 (23.46%), Postives = 213/520 (40.96%), Query Frame = 3
Query:  687 LDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF--ERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQL-YHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLS-NKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVN-DNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIV-VATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTR----YPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            LDRE    Y+  +I   G    +  G T + +++ ++NDN P F   +P   R + EN+ V   +  +   D D     R  L   +SGQ   +  F +D       +    +     LD+E L  H+   K  A DG   S  +   L I + ++ND +P   F +   Q T    +   T S  +  A ++  D D+    L  SL    +      S FR        F       +   A E +L      VTV   D  N +P  +T+  + +II +    + P F +  +  ++ EN        N +   + ++ H      Y IQD + S     F ID + G+++ +   D E+ + + F V +  +     ++     +IV   D+NDN P F+   +   + +++  G  IGQI A+D+DS    +    I+  +  N    ++TL+P TG I+        +D    +T    VE+++        + +  + + +   + S P F L
Sbjct: 1888 LDREILERYSLKVI---GTGSGQQIG-TRVDVRVNNLNDNVPSFPMSKP---RRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTH--FNID-------QFTGTIHLTAPLDFEVLPEHTLTIK--ATDG---SFDTFTNLTIFVSDINDNAPT--FSKPLYQTT----VSPATFSPGQPFAKIEAHDLDAR-GALTYSLGQGSS------SIFRVAPESGALF-----MKVLPPAGERYL------VTVTATD--NGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEES-REFH------YRIQDPEASK---IFSID-KFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVL--DENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLN----IVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVL 2343          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 126.716 bits (317), Expect = 4.978e-29
Identity = 153/609 (25.12%), Postives = 268/609 (44.01%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP--IFQILVTDEDEDE-NGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE--QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAY--VQVSDADSMINQ---LQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTN-ASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRID-----SQNGKIYNSQSFDFE----KESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            +++ ++D NDN P F   Q     ++E++  G+ +   KA DLD  +         L + L  +    +    +     + +   LD E +  Y   LIA DG    R+   T + I I D+NDNAP+FE+  Y  T+ E  +  P  +F +  TD D+DE + RI  ++   G + + +I          GK    +  +  LD +      S+ F + A D   N L   A +++ + ++ND SP        +++ G    +   + +  + +  VQ  D D    +   ++  ++  RN L+  ES FR   N  K F++R+   +DRE +     + + I+ V+ +D    +P     A++ I + D+NDN P F +  Y G +EE        M+ +   AD++   N   TY + +    S+  Y   D     S  G +   Q  D+E    ++  +  I V+       R  + + + V + D+ND+AP          V E+V  G  IG+  ATDRD+       RF +   S  +    I  D   G +R  + +DRE  +     +E+ + S    + I   M+ + ++D+ND+ P
Sbjct: 1321 VQIVINDVNDNAPSFE-EQKYIGRVKESEGEGHDVITIKAHDLDKHS--------NLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG----RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRI----------GKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFP-----ERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIV--RNKLINGESVFRIDQNTGKIFAMRS---LDREISS----EREFIIEVRAND--RGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN-VFTYQLSE---ESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD-----GRHDAEAAVHVALVDRNDHAPHI-HGATEHRVREDVPRGTSIGRYTATDRDA---GDTARFRINRQSDPKRQFTIDQD---GTLRVAHTLDREDIAVYNLIIEAYDNS----NNIGRQMVAVYLQDVNDNGP 1870          

HSP 2 Score: 115.931 bits (289), Expect = 1.040e-25
Identity = 160/623 (25.68%), Postives = 276/623 (44.30%), Query Frame = 3
Query:  438 VFVDDENDNNPVF--PIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLG----NSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIR---TIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSG---QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSN--------KILAYVQV--SDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEI------PLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENIN-NHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFV-DENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTI---TFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            V V D NDN+P F  P  +T     E    +G  +    A D D A  +  +Y LE+    G    N  DF    + + G   LI    +   KT  + F +IA D           ++T+ + D    APK++     +   T+ ENV ++  I +       +  N  +  K+  SG    +  +K    +  +   G    +V  +  LDYEQ+ +++   + A D   + ++ST T  +++ +VND+ P+          TG  +IDE    N        K +  V+   +D+D   N++   ++   N    E   FR      + F     +  DRE  + +      I+TV+  D           P   N  + I+INDVNDN P F +  Y G+++E+    H+V     I A D D H N  + YH+         + F + + +G I+  +  DFE    Y  +++A+D  H    ++++ + + I+D NDNAPQF Q  +A  V +E+V+I  ++  ++ATD D   + K  R + + + Q  A ++  +   +G I     +DR+  + +    F V++ +     N L+  A + + VRD+ND+ P F
Sbjct:  967 VEVVDINDNSPQFERPSYETSVSRFEA---VGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM---KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFEN--GNEWVEVVIMEGLDYEQV-NNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTV----DLFTG--TIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEAN--GEETKHFRIDELTGEIFP---NEKFDREKIDMY------ILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVI---TIKAHDLDKHSN--LRYHL--IGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH----NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQ--DEKSSRIVYRLEGQG-ADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDG--NGLVGYADVQVNVRDINDNSPIF 1546          

HSP 3 Score: 114.775 bits (286), Expect = 2.575e-25
Identity = 151/566 (26.68%), Postives = 239/566 (42.23%), Query Frame = 3
Query:  597 ELPFKLGNSSDFELAKHFK--DGVPYLIITSTLDREKTSMYTFTLIAID-------GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINN-------LDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN---INNHEV-FMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFI--VVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS----------LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            E+ +++   ++ E  KHF+  +    +      DREK  MY  T+ A D       G  G  N    ++ I I D+NDNAP FE   YI  +KE+   +     ++T +  D +   +L+ H              ++    G++   VR  +        LD+E     +   ++A DG  N+   T  + I I +VND +P+       QQ      I+E     K+L  V  +DAD      + S +  R      +  FR  +  Y   ++   + +DR+   P  + S   V    DD  N   L   A + + + D+NDN P F + ++ G IEEN   I++  V FM+      D     N  + Y I   K  +    FRID   GKI+  +S D E  S   FI  V A D+G P+R    + + +++ D NDNAP F ++ +   V+E   IG  +   +A D D           L E  D  F V +D  ++ S +       G +R + P+D E  +    F      S   +D   EA + + + D ND  P
Sbjct: 1254 EVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGP-NKDNVKVQIVINDVNDNAPSFEEQKYIGRVKES---EGEGHDVITIKAHDLDKHSNLRYH--------------LIGAGGGRIPFGVRTDSGTIFVKEPLDFEA-SDQYHLVLIASDGRHNA---TTNVYIHIEDVNDNAPQFE-----QQKYATTVIEEDVDIPKVLFNVHATDAD---QDEKSSRIVYRLEGQGADEVFR--IGKYSG-TIELVKALDRDP--PAGVPSWNFVVQAIDDDGNG--LVGYADVQVNVRDINDNSPIFPERLF-GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSR-EGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDY-FYVTTDKDSKQSSV-------GVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD--AEAAVHVALVDRNDHAP 1770          

HSP 4 Score: 97.0561 bits (240), Expect = 6.445e-20
Identity = 133/514 (25.88%), Postives = 218/514 (42.41%), Query Frame = 3
Query:  501 TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFK----DGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQL---YHSFEFKIVAQDGGRN-SLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLL-------TPRNILMIEES----RFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTN---ASIFIIINDVNDNPPKFTQNVYY---GQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQS--FDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS 1958
            T+ E+  + Y +   KAQ     +F     K  + + L   +  +  K F+     G+ +L  T  LD +  ++     + +   E NR +   ++TI+I D+NDN P F RP+Y   ++E++ ++  I ++   D+D  +N RI   + N         F+++    S G++ A+VR    LD +QL   +  + F + A+D G   SLSS+A + I+  N ND S    F+   Q     F  ++      ++  +Q  DAD   +++  S +          N+  I+E     + RH V+               EA  P      + V VQ D      P  T+   A++ I I DVN+N P+F     Y    +I E     +      + A D D   NG + Y +  +  S +   F ID Q G +  S    FD E        V ATD+G    L       V + D NDN+PQF +  +   V     +G  +  + A D D+
Sbjct:  538 TVSEDNLVDYSVVDVKAQSF--RSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHL--TRLLDFDDPALPKLHKLKVTAREDNRES-HVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-------FSIN----SNGEISAKVR----LDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDES--AVFLPTSQYTA--FVAEDAQGGTPVIQ-IQARDADR--DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADL----------AEAENPI----NLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY-YTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGD-RPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA 1008          

HSP 5 Score: 62.003 bits (149), Expect = 2.983e-9
Identity = 148/638 (23.20%), Postives = 254/638 (39.81%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCT--IEENKPLGYRIPLPKAQDLDNA-----TFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF-ERPIYIRTIKENVIVD-PIFQILVTDEDEDE--------NGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGG------RNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSN--KILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQN---IDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAI--HAADKDLHLNGKVTYHIQ-----DFKNSSNAMYFR-IDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQS---HFAFFVDENVEIGHLIGQINA-TDRDSLPEHKDIRFIVKSDSQNRA-SKLITLDPLTG-----QIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + + +DD NDN P F     P  T  + E+ PL   I    A D D       T+SV ++   +      +S+ E++   +     L        E+  +Y F + A D  E    +    I I+  + ND +  F     Y   + E+     P+ QI   D D DE        NGR   KM+         +F+   +D+  G V+ +   ++  D  +  +     ++ QD G        + +S ATL I I +VN+  PE         I     I EGT       +  V+ +D DS  N  +  SL          +S  R    I +Q  + T       DRE         +  VTV+  D  +  PL       + + D+NDN P+F +  Y    E +++  E    + I   A D D   N ++TY ++       ++ ++  +F  ++ ++G+I   +    + +  + F V+A D G P  L SS+ + + + D+   AP++  S        VDENVE+  +I +  A +  DS       +        N+A SK    +         ++     +D E+ +  T  + + +   + + +      V+ VRD+ND  P F
Sbjct:  628 LTIRIDDVNDNVPTF---TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSI------NSNGEISAKVRLDADQL-------NERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMN---------LFS---IDEHTGLVKLR-HGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIA---KIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY-------YTQSESRKAFVIDRQTGVLTPSPHVVFDRETR------PREDVTVKATDRGDR-PLIGFCQFSVEVVDINDNSPQFERPSY----ETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD---MTSRVASTKTFVVEVRDVNDVVPQF 1211          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 126.716 bits (317), Expect = 4.978e-29
Identity = 153/609 (25.12%), Postives = 268/609 (44.01%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP--IFQILVTDEDEDE-NGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE--QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAY--VQVSDADSMINQ---LQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTN-ASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRID-----SQNGKIYNSQSFDFE----KESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            +++ ++D NDN P F   Q     ++E++  G+ +   KA DLD  +         L + L  +    +    +     + +   LD E +  Y   LIA DG    R+   T + I I D+NDNAP+FE+  Y  T+ E  +  P  +F +  TD D+DE + RI  ++   G + + +I          GK    +  +  LD +      S+ F + A D   N L   A +++ + ++ND SP        +++ G    +   + +  + +  VQ  D D    +   ++  ++  RN L+  ES FR   N  K F++R+   +DRE +     + + I+ V+ +D    +P     A++ I + D+NDN P F +  Y G +EE        M+ +   AD++   N   TY + +    S+  Y   D     S  G +   Q  D+E    ++  +  I V+       R  + + + V + D+ND+AP          V E+V  G  IG+  ATDRD+       RF +   S  +    I  D   G +R  + +DRE  +     +E+ + S    + I   M+ + ++D+ND+ P
Sbjct: 1321 VQIVINDVNDNAPSFE-EQKYIGRVKESEGEGHDVITIKAHDLDKHS--------NLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG----RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRI----------GKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFP-----ERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIV--RNKLINGESVFRIDQNTGKIFAMRS---LDREISS----EREFIIEVRAND--RGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN-VFTYQLSE---ESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD-----GRHDAEAAVHVALVDRNDHAPHI-HGATEHRVREDVPRGTSIGRYTATDRDA---GDTARFRINRQSDPKRQFTIDQD---GTLRVAHTLDREDIAVYNLIIEAYDNS----NNIGRQMVAVYLQDVNDNGP 1870          

HSP 2 Score: 115.931 bits (289), Expect = 1.040e-25
Identity = 160/623 (25.68%), Postives = 276/623 (44.30%), Query Frame = 3
Query:  438 VFVDDENDNNPVF--PIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLG----NSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIR---TIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSG---QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSN--------KILAYVQV--SDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEI------PLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENIN-NHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFV-DENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTI---TFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            V V D NDN+P F  P  +T     E    +G  +    A D D A  +  +Y LE+    G    N  DF    + + G   LI    +   KT  + F +IA D           ++T+ + D    APK++     +   T+ ENV ++  I +       +  N  +  K+  SG    +  +K    +  +   G    +V  +  LDYEQ+ +++   + A D   + ++ST T  +++ +VND+ P+          TG  +IDE    N        K +  V+   +D+D   N++   ++   N    E   FR      + F     +  DRE  + +      I+TV+  D           P   N  + I+INDVNDN P F +  Y G+++E+    H+V     I A D D H N  + YH+         + F + + +G I+  +  DFE    Y  +++A+D  H    ++++ + + I+D NDNAPQF Q  +A  V +E+V+I  ++  ++ATD D   + K  R + + + Q  A ++  +   +G I     +DR+  + +    F V++ +     N L+  A + + VRD+ND+ P F
Sbjct:  967 VEVVDINDNSPQFERPSYETSVSRFEA---VGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM---KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFEN--GNEWVEVVIMEGLDYEQV-NNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTV----DLFTG--TIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEAN--GEETKHFRIDELTGEIFP---NEKFDREKIDMY------ILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVI---TIKAHDLDKHSN--LRYHL--IGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH----NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQ--DEKSSRIVYRLEGQG-ADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDG--NGLVGYADVQVNVRDINDNSPIF 1546          

HSP 3 Score: 114.775 bits (286), Expect = 2.575e-25
Identity = 151/566 (26.68%), Postives = 239/566 (42.23%), Query Frame = 3
Query:  597 ELPFKLGNSSDFELAKHFK--DGVPYLIITSTLDREKTSMYTFTLIAID-------GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINN-------LDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN---INNHEV-FMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFI--VVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS----------LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            E+ +++   ++ E  KHF+  +    +      DREK  MY  T+ A D       G  G  N    ++ I I D+NDNAP FE   YI  +KE+   +     ++T +  D +   +L+ H              ++    G++   VR  +        LD+E     +   ++A DG  N+   T  + I I +VND +P+       QQ      I+E     K+L  V  +DAD      + S +  R      +  FR  +  Y   ++   + +DR+   P  + S   V    DD  N   L   A + + + D+NDN P F + ++ G IEEN   I++  V FM+      D     N  + Y I   K  +    FRID   GKI+  +S D E  S   FI  V A D+G P+R    + + +++ D NDNAP F ++ +   V+E   IG  +   +A D D           L E  D  F V +D  ++ S +       G +R + P+D E  +    F      S   +D   EA + + + D ND  P
Sbjct: 1254 EVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGP-NKDNVKVQIVINDVNDNAPSFEEQKYIGRVKES---EGEGHDVITIKAHDLDKHSNLRYH--------------LIGAGGGRIPFGVRTDSGTIFVKEPLDFEA-SDQYHLVLIASDGRHNA---TTNVYIHIEDVNDNAPQFE-----QQKYATTVIEEDVDIPKVLFNVHATDAD---QDEKSSRIVYRLEGQGADEVFR--IGKYSG-TIELVKALDRDP--PAGVPSWNFVVQAIDDDGNG--LVGYADVQVNVRDINDNSPIFPERLF-GYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSR-EGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDY-FYVTTDKDSKQSSV-------GVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHD--AEAAVHVALVDRNDHAP 1770          

HSP 4 Score: 97.0561 bits (240), Expect = 6.445e-20
Identity = 133/514 (25.88%), Postives = 218/514 (42.41%), Query Frame = 3
Query:  501 TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFK----DGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQL---YHSFEFKIVAQDGGRN-SLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLL-------TPRNILMIEES----RFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTN---ASIFIIINDVNDNPPKFTQNVYY---GQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQS--FDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS 1958
            T+ E+  + Y +   KAQ     +F     K  + + L   +  +  K F+     G+ +L  T  LD +  ++     + +   E NR +   ++TI+I D+NDN P F RP+Y   ++E++ ++  I ++   D+D  +N RI   + N         F+++    S G++ A+VR    LD +QL   +  + F + A+D G   SLSS+A + I+  N ND S    F+   Q     F  ++      ++  +Q  DAD   +++  S +          N+  I+E     + RH V+               EA  P      + V VQ D      P  T+   A++ I I DVN+N P+F     Y    +I E     +      + A D D   NG + Y +  +  S +   F ID Q G +  S    FD E        V ATD+G    L       V + D NDN+PQF +  +   V     +G  +  + A D D+
Sbjct:  538 TVSEDNLVDYSVVDVKAQSF--RSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHL--TRLLDFDDPALPKLHKLKVTAREDNRES-HVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-------FSIN----SNGEISAKVR----LDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDES--AVFLPTSQYTA--FVAEDAQGGTPVIQ-IQARDADR--DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADL----------AEAENPI----NLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY-YTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGD-RPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA 1008          

HSP 5 Score: 62.003 bits (149), Expect = 2.983e-9
Identity = 148/638 (23.20%), Postives = 254/638 (39.81%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCT--IEENKPLGYRIPLPKAQDLDNA-----TFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF-ERPIYIRTIKENVIVD-PIFQILVTDEDEDE--------NGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGG------RNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSN--KILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQN---IDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAI--HAADKDLHLNGKVTYHIQ-----DFKNSSNAMYFR-IDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQS---HFAFFVDENVEIGHLIGQINA-TDRDSLPEHKDIRFIVKSDSQNRA-SKLITLDPLTG-----QIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + + +DD NDN P F     P  T  + E+ PL   I    A D D       T+SV ++   +      +S+ E++   +     L        E+  +Y F + A D  E    +    I I+  + ND +  F     Y   + E+     P+ QI   D D DE        NGR   KM+         +F+   +D+  G V+ +   ++  D  +  +     ++ QD G        + +S ATL I I +VN+  PE         I     I EGT       +  V+ +D DS  N  +  SL          +S  R    I +Q  + T       DRE         +  VTV+  D  +  PL       + + D+NDN P+F +  Y    E +++  E    + I   A D D   N ++TY ++       ++ ++  +F  ++ ++G+I   +    + +  + F V+A D G P  L SS+ + + + D+   AP++  S        VDENVE+  +I +  A +  DS       +        N+A SK    +         ++     +D E+ +  T  + + +   + + +      V+ VRD+ND  P F
Sbjct:  628 LTIRIDDVNDNVPTF---TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSI------NSNGEISAKVRLDADQL-------NERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMN---------LFS---IDEHTGLVKLR-HGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIA---KIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY-------YTQSESRKAFVIDRQTGVLTPSPHVVFDRETR------PREDVTVKATDRGDR-PLIGFCQFSVEVVDINDNSPQFERPSY----ETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD---MTSRVASTKTFVVEVRDVNDVVPQF 1211          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 186.037 bits (471), Expect = 4.054e-47
Identity = 181/600 (30.17%), Postives = 277/600 (46.17%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSD-FELAKHF-KDGVPYL--IITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE--QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLD--PLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + V V DENDN P FP     +    EN P   +  L  A+DLD   ++   Y +      GN +D F L+ H  +DGV YL   I+  LDRE T  Y+  + A+DG       G   + I I+D+NDN P F +  Y  T+ EN  V   + Q+  +D D DENG ++  + N  Q    ++F +D    +I   +A       LD+E  +L+   E  +VA+D G   L +TA + I++ +VND  P I  +      +    I E     + +A + V D DS       ++      L   +  F         + +     +DRE      I S   ++V   D     PL+ + SIF+ I DVNDNPP+F Q++Y+  + E  +     +    H  D+D  LN  +TY + +   + +A +F+ID Q G I      D E E +    VVA D G P  LSS++T++V I D NDN P F QS +   V EN  +G  I +++A+D D       +  +V          L   +    +G+I     +D E+ S+  F V + +       L   AMI + + D+ND+ P F
Sbjct:  160 VLVTVKDENDNAPTFPQTSM-HIEFPENTPREVKRTLLPARDLDLEPYNTQRYNI----VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLR-GFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI-NRRQSDKEQMFRIDPRTGAIYINKA-------LDFETKELH---ELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASP--KISESAQPGEFVARISVHDPDSKTEYANVNV-----TLNGGDGHFALTTRDNSIYLVIVHLPLDRE------IVSNYTLSVVATDKGTP-PLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAH--DRDEGLNSALTYSLAETPET-HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP-LSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDC-----GVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATD----RGGLSTTAMIKMQLTDVNDNRPVF 715          

HSP 2 Score: 141.739 bits (356), Expect = 1.685e-33
Identity = 167/673 (24.81%), Postives = 289/673 (42.94%), Query Frame = 3
Query:  249 NGLFILDSDS-NLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKV--QAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFR-HPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFT--QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATD------RDSLPEH-KDIR--FIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDP 2219
            +G F ++++S N++++K +D E     Q++L +    G      H                 + + V+D NDN P F        ++ E+  LG  +    A D D+ +    +Y L     +  S     A   + G  +LI++  LD E +  +T  + A DG   + +T  T I + ++D+NDN P FE+  Y   + E+  ++  I Q+  +D D   N RI  ++ ++G + +    +   + Q  G       +     LD E     ++  ++A D G  +  +   + +++L+ ND  P+       Q+    F I+E      ++  V  SD D   N      L P N      S F+ HPV       + T + +DRE  E  L D    + V+  D    +  +    + I ++DVNDN P+    Q       EE     EV     + A D+D   N  +TY I   ++S     F ID  +G I      D E+ SIY   V A+D G+P R  +   + V + D NDN P F+ S   F V E+  +GH++G I+  +      R+S+ E  +D+R  + +   +++       +D  +G +     +DRE  S     + + + +   N       + I V D+ND+ P +  +DP
Sbjct:  872 DGYFSIETNSGNIRIAKPLDHE--AKSQVLLNIQATLGEPPVYGHTQ---------------VNIEVEDVNDNAPEFEASMV-RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL-----VKESGKGLFAIDARSG--HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLT-ILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRET-RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKF------QKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN------SSFQVHPVT----GEISTREPLDRELRE--LYD----LVVEARDQGTPV-RSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVR---VRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPR-ETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWP-QDP 1489          

HSP 3 Score: 132.109 bits (331), Expect = 1.449e-30
Identity = 161/644 (25.00%), Postives = 276/644 (42.86%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRI----PLPKAQDLDNATFSVSSYKLELPFKLGN------SSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIR--DINDNAPKFER-PIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKM------HNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNS-----LSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNA---AIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSS----------------------TIIVRIKDQNDNAPQF-SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
             +RV V D NDN P F    +    + E+  LG+ +    P+ +  D+   +   S   L + + L         + F++ +H  +    L++   LDRE  S +   + A+D    N N   + IT+KI   D+NDNAP++ + PI ++  +   +   I     TD D   NG +  ++       N  QE    +F +D L  ++  +QA       LD+E +    E+ ++ Q   ++S     L ++ T+R++IL+ ND +P      +    T    I + T   +++A++   D DS  N      +T  N     E RFR    I  Q  +         A E      +  + +   D+    P  ++ ++ +I+   ++NPP+F Q VY   I EN+ +    +     ++H A+     N  ++Y I      +N + F +D Q G I     FD E ++ Y   V   D    + LSSS+                      TI + + D NDN+P+F   S +   V EN E G +I  + A+D D  P    I  I   +  N+     ++D  +G++  R P+DRE+ S  T  +++ +  +          I I V D ND+ P F+L
Sbjct: 1350 MLRVEVLDLNDNRPTF-TSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGN----LVVARLLDREVQSEFRLEIRALDTTASN-NPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGAL-SLQAP------LDFEAVQ---EYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN----GEGRFR----INSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAE-----NANLSYEIP--AGVANDL-FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNK----FSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQP-KSRQGHCNITIFVEDQNDNAPRFKL 1954          

HSP 4 Score: 116.701 bits (291), Expect = 7.570e-26
Identity = 161/626 (25.72%), Postives = 267/626 (42.65%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLP----KAQDLDNATFSVSSYKLELPFKLGNSSD-FELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQ-SIGKVQAQVRAINNLDYE---QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIR--FVRNGQQITGGFSIDEGTLSNKILAYVQVSDADS-MINQLQCSLL--TPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN--INNHEVFMNAAIHAADKDLHLNGKVTYHIQD---------FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSK 2225
             I++ + D NDN PVF   +      E  K        P     A D D   F   SY++      GN +  F + +    G  +++    L      M+   + A DG  GN R+     + + I D     P FE+  Y   +KE++    +   ++       +G +    H S   +   I++ D     SI      +R    LD+E   Q+  + +  +     G   +     + I++ +VND +PE     VR         S+ E       L      D DS    Q+  SL+  + + +  I+ +R  H         L  +Q++D E+++       +IVT      D  +P L+TN +I + + DVNDNPP F ++ Y   + E+  IN   + +NA+    D D   N ++TY I D           +S  + +F I   +G IY     D E    Y   V+ATD G P    + + +IVR+ D NDN P+F +S + F ++EN+  G ++G + A+D D L E+  IR+ +   + +       + P+TG+I TR P+DRE        VE+++             + I V D+ND+ P   + DP +
Sbjct:  700 MIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI----VAGNEAGIFRIDR--STGEIFVVRPDMLSVRTQPMHMLNISATDG--GNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIA-----ASGDV---AHRSPVRY--SIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL-----GEPPVYGHTQVNIEVEDVNDNAPEFEASMVR--------ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID-ARSGH---------LILSQHLDYESSQ----RHTLIVTAT----DGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNAS----DLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTP-AAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLD-LGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRS--ARVPVRIHVSDVNDNAP--EIADPQE 1261          

HSP 5 Score: 115.931 bits (289), Expect = 1.528e-25
Identity = 168/693 (24.24%), Postives = 291/693 (41.99%), Query Frame = 3
Query:  267 DSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQ---------ISCNNEEM---QSNFIRVFVDDENDNNPVFPIV-----QTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITS-TLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP---IFQILVTDEDEDENGRIDLKMHNSGQ---EWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANE-PFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNA---AIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIY--NSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVES--KNPSRIFNDLIQEAMIVITVRDLNDSPPTF-----RLKDPSKSQL 2234
            D+D N  V   I+R +    + M +++   G+I+     LDF+         ++ ++ E     + F+ + V D NDN P   ++      +P   I E+   G  +      D D+ T   ++  + L     N  D   A   +D   YL+I    LDRE  S YT +++A D      +  K+ I ++I D+NDN P+FE+ +Y   + E  + DP   + Q+L  D DE  N  +   +  + +   +W         +D   G +    R+  + + E +    +  +VA+DGG   LSSTAT+ + I +VND  P         Q     S+ E     + +  V  SD D  +N +        N  + E   F+H      +F +R+       A E  F   S     V   D      L+T A I + + DVNDN P F    Y   + E+        +    A+ A D D    G+V+Y I      + A  FRID   G+I+           + ++   + ATD G+  R ++ + + + I D     P F ++ + ++V E++  G ++G + A   D +     +R+ + S   +      +++  +G IR   P+D E  S +   +++    P      +     + I V D+ND+ P F     R+  P  ++L
Sbjct:  314 DADENGLVEYAINRRQ-SDKEQMFRIDPRTGAIY-INKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASP--KISESAQPGEFVARISVHDPDSKT-EYANVNVTL-----NGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKS-IFLRITDVNDNPPEFEQDLYHANVME--VADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQ-------IDPQTGLIT--TRSHIDCETEPVP---QLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF------DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMV-------NYTIGEG--FKH----LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG---LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI---VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGD-VAHRSPVRYSIYSGDPD---GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP-----VYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAEL 946          

HSP 6 Score: 108.997 bits (271), Expect = 1.807e-23
Identity = 173/696 (24.86%), Postives = 288/696 (41.38%), Query Frame = 3
Query:  306 REELCPPQMMLQLNKVCGSIHT-------CCHILDFQISCNNEEMQSNF----IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLD---NATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-----------IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQD--GGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP--LNTNASIFIIINDVNDNPPKF-TQNVYYGQ-----IEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSF-----DFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSR---IFNDLIQE------------------AMIVITVRDLNDSPPTFR 2207
            R  L P     Q++ V G I T          + D  +   ++          +R+ V D NDN P     Q    ++ E +P G  +   +A D D   NA+ + S  K       G  SD             +     LD E+ S+Y   + A DG    R T +  + +++ D+NDN P F     +  ++E+            I  P   +  + E+  E+ R+   ++   ++ I   F  DI   S   V A++     LD E +   F  +I A D     N  SS  T++I++ +VND +PE        Q      + E T    I+     +DAD+  N  LQ  L+  R    + ES+    +++++  SL  T  +  +A   F    + ++ VQ  D  + +   L T+ ++ + I D ND+ P F + N   G+     I +     EV   A I A D+D   NG++TY I      +    FRI+SQ G I   +S      D EK   ++ I+ A D G P    SS  + + ++  ++N P+F Q+ +   + ENV  G  + Q+ A       E+ ++ + + +   N    L  +D   G I TR   DRE  ++    V  ++ +R   + +  +++                  A I ITV D+ND+ P FR
Sbjct: 1189 RYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK-------GRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRM-LRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAF--DIDRHSGNLVVARL-----LDRE-VQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW------PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI--RYFPQLNESQ-EQAMSLFRMDSL--TGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVV--AHIVAVDEDSGDNGQLTYEI---TGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGA-ENANLSYEIPAGVAN---DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFR 1848          

HSP 7 Score: 98.9821 bits (245), Expect = 2.234e-20
Identity = 139/566 (24.56%), Postives = 245/566 (43.29%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKL--ELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF---ERPIY------IRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVND-MSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYY-GQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKES-IYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREK 2084
            IRV + D NDN P FP       T+ E   LG  I    A D+D  T+   +Y+L  E    + N S F L ++       L++   LD E    Y   +IA D      +  +T +T+++ D NDNAP F   + P Y      I  I E++ VD  +  +  TD D + N    + +    QE  +   +  ++  ++ ++Q  V +  +         +  +I+A+D G+ +L S+  LR+Q    ND  S   +F++N  Q     S +   L + +L   Q    D++   L         I   EES F     + +  ++   + +DRE N+ + +   ++         + +  ++  S+ I I D NDN P F ++  Y  +I E               AD++   N +V Y   D  + ++   F ID   G ++ +   D++  +  Y  I+ A D  H   L S     + + D+NDN P+F  + +  F+ EN  +G  + + +A+D D  P  +    I  + S   + K+  +D  +G + + +  D E+
Sbjct: 2414 IRVQIVDVNDNQPTFP--PNNLVTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGK----LVLKRRLDYELQQEYELDVIASDAA----HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD---------YFVRIIAKDAGKPALKSSTLLRVQ---ANDNGSGRSQFLQN--QYRAQIS-EAAPLGSVVLQLGQ----DALDQSLAI-------IAGNEESAFE----LLQSKAIVLVKPLDRERNDLYKL-RLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY---DITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQ 2933          

HSP 8 Score: 93.9745 bits (232), Expect = 6.904e-19
Identity = 82/251 (32.67%), Postives = 122/251 (48.61%), Query Frame = 3
Query: 1476 LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQ-NGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVR--DLNDSPPTFRLKDP 2219
            L + A + I + D NDN PKF+Q  +   + E  NN   F+ A +HA D D   N ++ YHI D  N  NA  F I+   +G +  +   D E   IY   ++ATD+G P +++ ++TI V+I D NDN P F  ++    V E  E+G +I  I+A D D+ P     R   +S        +  LD  +G++  +  +D E        V       I +D   EA  V+TVR  D ND+ P F  + P
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEG-NNKGTFV-AQVHAFDSDAGSNARLRYHIVD-GNHDNA--FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVP-QMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALT-YRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDV-------IASDAAHEARTVLTVRVNDENDNAPVFLAQQP 2537          

HSP 9 Score: 92.4337 bits (228), Expect = 2.088e-18
Identity = 149/572 (26.05%), Postives = 230/572 (40.21%), Query Frame = 3
Query:  606 FKLGNSSDFELAKHFKDGVPYLIITST--------------------LDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEW------INKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFR-----HPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPK----FTQNVYYGQIEENINNHEVFMNAAIHAAD-KDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIY---NSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            +++G   DF        G PY+I+                       LDRE  + Y+   I + G    RN     + + ++D NDNAP F +        EN   + + + L+   D      +DL+ +N+ Q +      +N  F L    +  G +   ++    LD E     +   I A DGG   L    T+ I I +VND  P     R    +      +  T+   +L  V  SD D+  N L    +  R     +E  FR       + I K     T     +E +E        +V V  D    E PL T A + I + DVNDN P     F  +    +I E+    E     ++H  D K  + N  VT +  D        +F + +++  IY        D E  S Y+  VVATD+G P  L +S +I +RI D NDN P+F Q  +   V E  + G  + Q+ A DRD    +  + + +    +  A +   +DP TG I TR  ID E        V +++       L   A +++T+ D+ND+ P F
Sbjct:   94 YQIGYIGDF---GGIDSGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSG----RNI---RVLVTVKDENDNAPTFPQTSMHIEFPENTPRE-VKRTLLPARD------LDLEPYNT-QRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETT-PGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVP-----ENATVGTSVLQ-VYASDTDADENGLVEYAINRRQ--SDKEQMFRIDPRTGAIYINKALDFET-----KELHE--------LVVVAKDH--GEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGD-------GHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPP-LHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDE-GLNSALTYSLAETPETHA-QWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGG--VPPLSSTATVLVTIHDVNDNEPIF 611          

HSP 10 Score: 92.0485 bits (227), Expect = 2.878e-18
Identity = 139/552 (25.18%), Postives = 241/552 (43.66%), Query Frame = 3
Query:  510 ENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGK----TEITIKIRDINDNAPKFERP--IYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGR-NSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTT-QNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIIN--DVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP--QFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYP--IDREKTSTITFFVESKN 2120
            EN  L Y IP   A DL +  +          F   + + + L  + +D      ++S+  R++ S  +          G+ + G+      I I + D+NDN+P+F RP   Y  ++ EN     I  ++ +D DE  N   DL    +G    NK      +D S G++ A+      LD EQ +  +  +I A D G+  S      + I + + ND +P  +      + TG  S+ E       +  +   DAD  +N +L  SL          E++++  ++   Q  L TT   +DRE     L  S   + +  D    E+    +A++ + IN  D+NDN P F +  Y GQ+   I   +  +   + A D DL  N ++ Y + + +NS+ +  FRI+   G +  SQS   E   +    VVA D+G+P + SS   I + I +     P  +F    +   + EN   G  + Q+ A   D     + ++F   + +++    +++LD L+G+IR   P  +D ++ ST +    S+ 
Sbjct: 1750 ENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSI---------GDTSNGQHFDVATIYITVGDVNDNSPEF-RPGSCYGLSVPENSEPGVIHTVVASDLDEGPNA--DLIYSITGGNLGNKFS----IDSSSGELSAR-----PLDREQ-HSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL----SKYTG--SVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN--------ETQWQFAID--GQSGLITTVGKLDRE-----LQASYNFMVLATDGGRYEV---RSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLK--VQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ-SSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDG--RRQKVQFSFGAGNED---GILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRG 2246          

HSP 11 Score: 88.9669 bits (219), Expect = 2.261e-17
Identity = 73/240 (30.42%), Postives = 121/240 (50.42%), Query Frame = 3
Query: 1488 ASIFIIINDVNDNPPKFTQNVYYG-QIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            A+I+I + DVNDN P+F     YG  + EN    E  +   + A+D D   N  + Y I    N  N   F IDS +G++ +++  D E+ S Y+  + A+D+G P        I + ++DQNDNAP+F  S +   V E+  +G  + QI+A D D L  +  + + + +++Q +      +D  +G I T   +DRE  ++  F V + +  R +        + I V D+ND+ P F
Sbjct: 1831 ATIYITVGDVNDNSPEFRPGSCYGLSVPEN---SEPGVIHTVVASDLDEGPNADLIYSITG-GNLGNK--FSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD-LGVNARLVYSLANETQWQ----FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGR-YEVRSATVPVQINVLDINDNRPIF 2057          

HSP 12 Score: 78.1814 bits (191), Expect = 5.161e-14
Identity = 74/260 (28.46%), Postives = 116/260 (44.62%), Query Frame = 3
Query:  399 SCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNAT-----FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSL-SSTATLRIQILNVNDMSP 1157
            + N +      I + V D NDN+P F        ++ EN   G  I    A DLD        +S++   L   F + +SS  EL+               LDRE+ S YT  + A D  +     G   ITI + D NDNAP+F+   Y  +++E+  +   + QI   D D   N R+   + N  Q W   I     L  ++GK+  +++A           S+ F ++A DGGR  + S+T  ++I +L++ND  P
Sbjct: 1822 TSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSI-DSSSGELSAR------------PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQ-WQFAIDGQSGLITTVGKLDRELQA-----------SYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP 2055          

HSP 13 Score: 74.3294 bits (181), Expect = 5.914e-13
Identity = 52/178 (29.21%), Postives = 93/178 (52.25%), Query Frame = 3
Query: 1449 CDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDF-KNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEI--GHLIGQINATDRDSLPEHK 1973
            CD + ++ PL +     + ++D NDN PKF    Y   + EN         A  HA+D D    G++ Y I     + S+   FR+DS++G + ++  FD+E+   Y   ++A+D G      +S  + V I+ +++  PQF++  + F +   V +  G+++GQ+ ATD DS P+ +
Sbjct: 2834 CDSH-HQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRA--HASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK---ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGR 3005          

HSP 14 Score: 73.1738 bits (178), Expect = 1.375e-12
Identity = 77/308 (25.00%), Postives = 129/308 (41.88%), Query Frame = 3
Query:  258 FILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIIT-STLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP---IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRF 1169
            F +DS S    ++ +DRE+     + +Q +          H       CN        I +FV+D+NDN P F + +    +++E+ PLG  +    A D D     V++    L + L N + ++ A    DG   LI T   LDRE  + Y F ++A DG      +    + I + DINDN P FER  YI  +    ++ P   + ++   D D   N  I   + N+    ++  F ++    ++   Q+       L           ++VA+D G    SS   + + I      +P +RF
Sbjct: 1895 FSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGH-------CN--------ITIFVEDQNDNAPRFKLSKY-TGSVQEDAPLGTSVVQISAVDAD---LGVNA---RLVYSLANETQWQFAI---DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVP--ALIQPGQTLLKVQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKL--------LHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF 2166          

HSP 15 Score: 60.8474 bits (146), Expect = 8.219e-9
Identity = 115/510 (22.55%), Postives = 202/510 (39.61%), Query Frame = 3
Query:  768 TEITIKIRDINDNAPKFERPIYIRTIKE-NVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLID---SKIIVTVQCD-DYDNEIPLNTNAS---------IFIIINDVNDNPPKFTQN---VYYG------QIEENINNHEVFMNAAIHAADKDLHL-NGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSF---DFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTS----TITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
             E+ I++ D NDN+PKF +  ++ T+ E N     + Q+   D D   N R+   + +   +     F ++     I      VR    LD E +   ++ KI+A D G   ++ TAT+R+QI++VND  P   F  N        ++ E T    ++  +  +D D+                        +P   Y+   L     +D E    F +D    K+++  + D +   E  L+  AS         + + +ND NDN P F       Y+       +I E+++    F    ++A D D    N KV Y I+  +       F +   NG +  + S           Y   ++A D G P  L SS+ + V+  D      QF Q+ +   + E   +G ++ Q+    +D+L    D    + + ++  A +L+     +  I    P+DRE+       +        P     +      ++IT+ D ND+ P F
Sbjct: 2306 AELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHD---NAFVIEPAFSGI------VRTNIVLDRE-IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPT--FPPNNL-----VTVSEATELGAVITSISANDVDT------------------------YPALTYR---LGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVD--FDLLTVNATDADSEGNNSKVIYIIEPAQEG-----FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP-ALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLG---QDAL----DQSLAIIAGNEESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF 2752          

HSP 16 Score: 58.9214 bits (141), Expect = 2.911e-8
Identity = 134/532 (25.19%), Postives = 212/532 (39.85%), Query Frame = 3
Query:  444 VDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSD-FELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEG-NRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDI--LDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFS-------IDEGTLSNKILAYVQVSDADSMIN-----------QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSF-IVVATDQGHP----NRLSSSSTIIVRIKDQNDNAPQFSQS-HFAFFVDENVEIGHLIGQINATDRD 1955
            ++DENDN+P F   Q    T+ E    G  +    A D D      S+ +L      GN  + F +   F   V   I+   LDRE   +Y   +IA D  EG  + TG   I ++I D+NDN P F  P  + T+ E   +  +    ++  D D    +  ++   G E    I  + I  LD+  GK+  + R    LDYE L   +E  ++A D    + +    L +++ + ND +P    V   QQ    F+       I E    +  L  V  +DADS  N           Q   S+     ++ +  SR +  V+    + +R    I ++A +P L  S  ++ VQ                    ND      +F QN Y  QI E      V +     A D+ L +       I   + S+  +      Q+  I   +  D E+  +Y   +V++   G P       SS  ++I+ I D NDN P F +S  +   + E   + + I Q+ A D D
Sbjct: 2312 LEDENDNSPKFSQKQF-VATVSEGNNKGTFVAQVHAFDSDAG----SNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIV---LDREIRDIYKLKIIATD--EGVPQMTGTATIRVQIVDVNDNQPTFP-PNNLVTVSEATELGAVI-TSISANDVDTYPALTYRL---GAESTVDIENMSIFALDRYSGKLVLKRR----LDYE-LQQEYELDVIASDAAHEART---VLTVRVNDENDNAP----VFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRI---IAKDAGKPAL-KSSTLLRVQA-------------------NDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAI-------IAGNEESAFELL-----QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD 2781          

HSP 17 Score: 52.373 bits (124), Expect = 3.407e-6
Identity = 40/158 (25.32%), Postives = 72/158 (45.57%), Query Frame = 3
Query: 1809 LSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESI 2282
            L+S + +++ ++D+NDN+P+FSQ  F   V E    G  + Q++A D D+    +    IV  +  N     +     +G +RT   +DRE        + + +       +   A I + + D+ND+ PTF       + L+   E  + G +  SI
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDN---AFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEG--VPQMTGTATIRVQIVDVNDNQPTF-----PPNNLVTVSEATELGAVITSI 2449          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 186.037 bits (471), Expect = 4.054e-47
Identity = 181/600 (30.17%), Postives = 277/600 (46.17%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSD-FELAKHF-KDGVPYL--IITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE--QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLD--PLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + V V DENDN P FP     +    EN P   +  L  A+DLD   ++   Y +      GN +D F L+ H  +DGV YL   I+  LDRE T  Y+  + A+DG       G   + I I+D+NDN P F +  Y  T+ EN  V   + Q+  +D D DENG ++  + N  Q    ++F +D    +I   +A       LD+E  +L+   E  +VA+D G   L +TA + I++ +VND  P I  +      +    I E     + +A + V D DS       ++      L   +  F         + +     +DRE      I S   ++V   D     PL+ + SIF+ I DVNDNPP+F Q++Y+  + E  +     +    H  D+D  LN  +TY + +   + +A +F+ID Q G I      D E E +    VVA D G P  LSS++T++V I D NDN P F QS +   V EN  +G  I +++A+D D       +  +V          L   +    +G+I     +D E+ S+  F V + +       L   AMI + + D+ND+ P F
Sbjct:  160 VLVTVKDENDNAPTFPQTSM-HIEFPENTPREVKRTLLPARDLDLEPYNTQRYNI----VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLR-GFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI-NRRQSDKEQMFRIDPRTGAIYINKA-------LDFETKELH---ELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASP--KISESAQPGEFVARISVHDPDSKTEYANVNV-----TLNGGDGHFALTTRDNSIYLVIVHLPLDRE------IVSNYTLSVVATDKGTP-PLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAH--DRDEGLNSALTYSLAETPET-HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPP-LSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDC-----GVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATD----RGGLSTTAMIKMQLTDVNDNRPVF 715          

HSP 2 Score: 141.739 bits (356), Expect = 1.685e-33
Identity = 167/673 (24.81%), Postives = 289/673 (42.94%), Query Frame = 3
Query:  249 NGLFILDSDS-NLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKV--QAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFR-HPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFT--QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATD------RDSLPEH-KDIR--FIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDP 2219
            +G F ++++S N++++K +D E     Q++L +    G      H                 + + V+D NDN P F        ++ E+  LG  +    A D D+ +    +Y L     +  S     A   + G  +LI++  LD E +  +T  + A DG   + +T  T I + ++D+NDN P FE+  Y   + E+  ++  I Q+  +D D   N RI  ++ ++G + +    +   + Q  G       +     LD E     ++  ++A D G  +  +   + +++L+ ND  P+       Q+    F I+E      ++  V  SD D   N      L P N      S F+ HPV       + T + +DRE  E  L D    + V+  D    +  +    + I ++DVNDN P+    Q       EE     EV     + A D+D   N  +TY I   ++S     F ID  +G I      D E+ SIY   V A+D G+P R  +   + V + D NDN P F+ S   F V E+  +GH++G I+  +      R+S+ E  +D+R  + +   +++       +D  +G +     +DRE  S     + + + +   N       + I V D+ND+ P +  +DP
Sbjct:  872 DGYFSIETNSGNIRIAKPLDHE--AKSQVLLNIQATLGEPPVYGHTQ---------------VNIEVEDVNDNAPEFEASMV-RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL-----VKESGKGLFAIDARSG--HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLT-ILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRET-RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKF------QKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN------SSFQVHPVT----GEISTREPLDRELRE--LYD----LVVEARDQGTPV-RSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVR---VRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPR-ETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWP-QDP 1489          

HSP 3 Score: 132.109 bits (331), Expect = 1.449e-30
Identity = 161/644 (25.00%), Postives = 276/644 (42.86%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRI----PLPKAQDLDNATFSVSSYKLELPFKLGN------SSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIR--DINDNAPKFER-PIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKM------HNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNS-----LSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNA---AIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSS----------------------TIIVRIKDQNDNAPQF-SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
             +RV V D NDN P F    +    + E+  LG+ +    P+ +  D+   +   S   L + + L         + F++ +H  +    L++   LDRE  S +   + A+D    N N   + IT+KI   D+NDNAP++ + PI ++  +   +   I     TD D   NG +  ++       N  QE    +F +D L  ++  +QA       LD+E +    E+ ++ Q   ++S     L ++ T+R++IL+ ND +P      +    T    I + T   +++A++   D DS  N      +T  N     E RFR    I  Q  +         A E      +  + +   D+    P  ++ ++ +I+   ++NPP+F Q VY   I EN+ +    +     ++H A+     N  ++Y I      +N + F +D Q G I     FD E ++ Y   V   D    + LSSS+                      TI + + D NDN+P+F   S +   V EN E G +I  + A+D D  P    I  I   +  N+     ++D  +G++  R P+DRE+ S  T  +++ +  +          I I V D ND+ P F+L
Sbjct: 1350 MLRVEVLDLNDNRPTF-TSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGN----LVVARLLDREVQSEFRLEIRALDTTASN-NPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGAL-SLQAP------LDFEAVQ---EYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN----GEGRFR----INSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAE-----NANLSYEIP--AGVANDL-FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNK----FSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQP-KSRQGHCNITIFVEDQNDNAPRFKL 1954          

HSP 4 Score: 116.701 bits (291), Expect = 7.570e-26
Identity = 161/626 (25.72%), Postives = 267/626 (42.65%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLP----KAQDLDNATFSVSSYKLELPFKLGNSSD-FELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQ-SIGKVQAQVRAINNLDYE---QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIR--FVRNGQQITGGFSIDEGTLSNKILAYVQVSDADS-MINQLQCSLL--TPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN--INNHEVFMNAAIHAADKDLHLNGKVTYHIQD---------FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSK 2225
             I++ + D NDN PVF   +      E  K        P     A D D   F   SY++      GN +  F + +    G  +++    L      M+   + A DG  GN R+     + + I D     P FE+  Y   +KE++    +   ++       +G +    H S   +   I++ D     SI      +R    LD+E   Q+  + +  +     G   +     + I++ +VND +PE     VR         S+ E       L      D DS    Q+  SL+  + + +  I+ +R  H         L  +Q++D E+++       +IVT      D  +P L+TN +I + + DVNDNPP F ++ Y   + E+  IN   + +NA+    D D   N ++TY I D           +S  + +F I   +G IY     D E    Y   V+ATD G P    + + +IVR+ D NDN P+F +S + F ++EN+  G ++G + A+D D L E+  IR+ +   + +       + P+TG+I TR P+DRE        VE+++             + I V D+ND+ P   + DP +
Sbjct:  700 MIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI----VAGNEAGIFRIDR--STGEIFVVRPDMLSVRTQPMHMLNISATDG--GNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIA-----ASGDV---AHRSPVRY--SIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATL-----GEPPVYGHTQVNIEVEDVNDNAPEFEASMVR--------ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID-ARSGH---------LILSQHLDYESSQ----RHTLIVTAT----DGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNAS----DLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTP-AAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLD-LGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRS--ARVPVRIHVSDVNDNAP--EIADPQE 1261          

HSP 5 Score: 115.931 bits (289), Expect = 1.528e-25
Identity = 168/693 (24.24%), Postives = 291/693 (41.99%), Query Frame = 3
Query:  267 DSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQ---------ISCNNEEM---QSNFIRVFVDDENDNNPVFPIV-----QTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITS-TLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP---IFQILVTDEDEDENGRIDLKMHNSGQ---EWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANE-PFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNA---AIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIY--NSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVES--KNPSRIFNDLIQEAMIVITVRDLNDSPPTF-----RLKDPSKSQL 2234
            D+D N  V   I+R +    + M +++   G+I+     LDF+         ++ ++ E     + F+ + V D NDN P   ++      +P   I E+   G  +      D D+ T   ++  + L     N  D   A   +D   YL+I    LDRE  S YT +++A D      +  K+ I ++I D+NDN P+FE+ +Y   + E  + DP   + Q+L  D DE  N  +   +  + +   +W         +D   G +    R+  + + E +    +  +VA+DGG   LSSTAT+ + I +VND  P         Q     S+ E     + +  V  SD D  +N +        N  + E   F+H      +F +R+       A E  F   S     V   D      L+T A I + + DVNDN P F    Y   + E+        +    A+ A D D    G+V+Y I      + A  FRID   G+I+           + ++   + ATD G+  R ++ + + + I D     P F ++ + ++V E++  G ++G + A   D +     +R+ + S   +      +++  +G IR   P+D E  S +   +++    P      +     + I V D+ND+ P F     R+  P  ++L
Sbjct:  314 DADENGLVEYAINRRQ-SDKEQMFRIDPRTGAIY-INKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASP--KISESAQPGEFVARISVHDPDSKT-EYANVNVTL-----NGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKS-IFLRITDVNDNPPEFEQDLYHANVME--VADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQ-------IDPQTGLIT--TRSHIDCETEPVP---QLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF------DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMV-------NYTIGEG--FKH----LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGG---LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI---VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGD-VAHRSPVRYSIYSGDPD---GYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP-----VYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAEL 946          

HSP 6 Score: 108.997 bits (271), Expect = 1.807e-23
Identity = 173/696 (24.86%), Postives = 288/696 (41.38%), Query Frame = 3
Query:  306 REELCPPQMMLQLNKVCGSIHT-------CCHILDFQISCNNEEMQSNF----IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLD---NATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-----------IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQD--GGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP--LNTNASIFIIINDVNDNPPKF-TQNVYYGQ-----IEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSF-----DFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSR---IFNDLIQE------------------AMIVITVRDLNDSPPTFR 2207
            R  L P     Q++ V G I T          + D  +   ++          +R+ V D NDN P     Q    ++ E +P G  +   +A D D   NA+ + S  K       G  SD             +     LD E+ S+Y   + A DG    R T +  + +++ D+NDN P F     +  ++E+            I  P   +  + E+  E+ R+   ++   ++ I   F  DI   S   V A++     LD E +   F  +I A D     N  SS  T++I++ +VND +PE        Q      + E T    I+     +DAD+  N  LQ  L+  R    + ES+    +++++  SL  T  +  +A   F    + ++ VQ  D  + +   L T+ ++ + I D ND+ P F + N   G+     I +     EV   A I A D+D   NG++TY I      +    FRI+SQ G I   +S      D EK   ++ I+ A D G P    SS  + + ++  ++N P+F Q+ +   + ENV  G  + Q+ A       E+ ++ + + +   N    L  +D   G I TR   DRE  ++    V  ++ +R   + +  +++                  A I ITV D+ND+ P FR
Sbjct: 1189 RYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK-------GRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRM-LRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAF--DIDRHSGNLVVARL-----LDRE-VQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEW------PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLI--RYFPQLNESQ-EQAMSLFRMDSL--TGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVV--AHIVAVDEDSGDNGQLTYEI---TGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGA-ENANLSYEIPAGVAN---DLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFR 1848          

HSP 7 Score: 98.9821 bits (245), Expect = 2.234e-20
Identity = 139/566 (24.56%), Postives = 245/566 (43.29%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKL--ELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF---ERPIY------IRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVND-MSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYY-GQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKES-IYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREK 2084
            IRV + D NDN P FP       T+ E   LG  I    A D+D  T+   +Y+L  E    + N S F L ++       L++   LD E    Y   +IA D      +  +T +T+++ D NDNAP F   + P Y      I  I E++ VD  +  +  TD D + N    + +    QE  +   +  ++  ++ ++Q  V +  +         +  +I+A+D G+ +L S+  LR+Q    ND  S   +F++N  Q     S +   L + +L   Q    D++   L         I   EES F     + +  ++   + +DRE N+ + +   ++         + +  ++  S+ I I D NDN P F ++  Y  +I E               AD++   N +V Y   D  + ++   F ID   G ++ +   D++  +  Y  I+ A D  H   L S     + + D+NDN P+F  + +  F+ EN  +G  + + +A+D D  P  +    I  + S   + K+  +D  +G + + +  D E+
Sbjct: 2414 IRVQIVDVNDNQPTFP--PNNLVTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGK----LVLKRRLDYELQQEYELDVIASDAA----HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD---------YFVRIIAKDAGKPALKSSTLLRVQ---ANDNGSGRSQFLQN--QYRAQIS-EAAPLGSVVLQLGQ----DALDQSLAI-------IAGNEESAFE----LLQSKAIVLVKPLDRERNDLYKL-RLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVY---DITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQ 2933          

HSP 8 Score: 93.9745 bits (232), Expect = 6.904e-19
Identity = 82/251 (32.67%), Postives = 122/251 (48.61%), Query Frame = 3
Query: 1476 LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQ-NGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVR--DLNDSPPTFRLKDP 2219
            L + A + I + D NDN PKF+Q  +   + E  NN   F+ A +HA D D   N ++ YHI D  N  NA  F I+   +G +  +   D E   IY   ++ATD+G P +++ ++TI V+I D NDN P F  ++    V E  E+G +I  I+A D D+ P     R   +S        +  LD  +G++  +  +D E        V       I +D   EA  V+TVR  D ND+ P F  + P
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEG-NNKGTFV-AQVHAFDSDAGSNARLRYHIVD-GNHDNA--FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVP-QMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALT-YRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDV-------IASDAAHEARTVLTVRVNDENDNAPVFLAQQP 2537          

HSP 9 Score: 92.4337 bits (228), Expect = 2.088e-18
Identity = 149/572 (26.05%), Postives = 230/572 (40.21%), Query Frame = 3
Query:  606 FKLGNSSDFELAKHFKDGVPYLIITST--------------------LDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEW------INKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFR-----HPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPK----FTQNVYYGQIEENINNHEVFMNAAIHAAD-KDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIY---NSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            +++G   DF        G PY+I+                       LDRE  + Y+   I + G    RN     + + ++D NDNAP F +        EN   + + + L+   D      +DL+ +N+ Q +      +N  F L    +  G +   ++    LD E     +   I A DGG   L    T+ I I +VND  P     R    +      +  T+   +L  V  SD D+  N L    +  R     +E  FR       + I K     T     +E +E        +V V  D    E PL T A + I + DVNDN P     F  +    +I E+    E     ++H  D K  + N  VT +  D        +F + +++  IY        D E  S Y+  VVATD+G P  L +S +I +RI D NDN P+F Q  +   V E  + G  + Q+ A DRD    +  + + +    +  A +   +DP TG I TR  ID E        V +++       L   A +++T+ D+ND+ P F
Sbjct:   94 YQIGYIGDF---GGIDSGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSG----RNI---RVLVTVKDENDNAPTFPQTSMHIEFPENTPRE-VKRTLLPARD------LDLEPYNT-QRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETT-PGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVP-----ENATVGTSVLQ-VYASDTDADENGLVEYAINRRQ--SDKEQMFRIDPRTGAIYINKALDFET-----KELHE--------LVVVAKDH--GEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGD-------GHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPP-LHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDE-GLNSALTYSLAETPETHA-QWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGG--VPPLSSTATVLVTIHDVNDNEPIF 611          

HSP 10 Score: 92.0485 bits (227), Expect = 2.878e-18
Identity = 139/552 (25.18%), Postives = 241/552 (43.66%), Query Frame = 3
Query:  510 ENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGK----TEITIKIRDINDNAPKFERP--IYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGR-NSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTT-QNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIIN--DVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP--QFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYP--IDREKTSTITFFVESKN 2120
            EN  L Y IP   A DL +  +          F   + + + L  + +D      ++S+  R++ S  +          G+ + G+      I I + D+NDN+P+F RP   Y  ++ EN     I  ++ +D DE  N   DL    +G    NK      +D S G++ A+      LD EQ +  +  +I A D G+  S      + I + + ND +P  +      + TG  S+ E       +  +   DAD  +N +L  SL          E++++  ++   Q  L TT   +DRE     L  S   + +  D    E+    +A++ + IN  D+NDN P F +  Y GQ+   I   +  +   + A D DL  N ++ Y + + +NS+ +  FRI+   G +  SQS   E   +    VVA D+G+P + SS   I + I +     P  +F    +   + EN   G  + Q+ A   D     + ++F   + +++    +++LD L+G+IR   P  +D ++ ST +    S+ 
Sbjct: 1750 ENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSI---------GDTSNGQHFDVATIYITVGDVNDNSPEF-RPGSCYGLSVPENSEPGVIHTVVASDLDEGPNA--DLIYSITGGNLGNKFS----IDSSSGELSAR-----PLDREQ-HSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL----SKYTG--SVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN--------ETQWQFAID--GQSGLITTVGKLDRE-----LQASYNFMVLATDGGRYEV---RSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLK--VQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQ-SSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDG--RRQKVQFSFGAGNED---GILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRG 2246          

HSP 11 Score: 88.9669 bits (219), Expect = 2.261e-17
Identity = 73/240 (30.42%), Postives = 121/240 (50.42%), Query Frame = 3
Query: 1488 ASIFIIINDVNDNPPKFTQNVYYG-QIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            A+I+I + DVNDN P+F     YG  + EN    E  +   + A+D D   N  + Y I    N  N   F IDS +G++ +++  D E+ S Y+  + A+D+G P        I + ++DQNDNAP+F  S +   V E+  +G  + QI+A D D L  +  + + + +++Q +      +D  +G I T   +DRE  ++  F V + +  R +        + I V D+ND+ P F
Sbjct: 1831 ATIYITVGDVNDNSPEFRPGSCYGLSVPEN---SEPGVIHTVVASDLDEGPNADLIYSITG-GNLGNK--FSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD-LGVNARLVYSLANETQWQ----FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGR-YEVRSATVPVQINVLDINDNRPIF 2057          

HSP 12 Score: 78.1814 bits (191), Expect = 5.161e-14
Identity = 74/260 (28.46%), Postives = 116/260 (44.62%), Query Frame = 3
Query:  399 SCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNAT-----FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSL-SSTATLRIQILNVNDMSP 1157
            + N +      I + V D NDN+P F        ++ EN   G  I    A DLD        +S++   L   F + +SS  EL+               LDRE+ S YT  + A D  +     G   ITI + D NDNAP+F+   Y  +++E+  +   + QI   D D   N R+   + N  Q W   I     L  ++GK+  +++A           S+ F ++A DGGR  + S+T  ++I +L++ND  P
Sbjct: 1822 TSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSI-DSSSGELSAR------------PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQ-WQFAIDGQSGLITTVGKLDRELQA-----------SYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP 2055          

HSP 13 Score: 74.3294 bits (181), Expect = 5.914e-13
Identity = 52/178 (29.21%), Postives = 93/178 (52.25%), Query Frame = 3
Query: 1449 CDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDF-KNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEI--GHLIGQINATDRDSLPEHK 1973
            CD + ++ PL +     + ++D NDN PKF    Y   + EN         A  HA+D D    G++ Y I     + S+   FR+DS++G + ++  FD+E+   Y   ++A+D G      +S  + V I+ +++  PQF++  + F +   V +  G+++GQ+ ATD DS P+ +
Sbjct: 2834 CDSH-HQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRA--HASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKK---ASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGR 3005          

HSP 14 Score: 73.1738 bits (178), Expect = 1.375e-12
Identity = 77/308 (25.00%), Postives = 129/308 (41.88%), Query Frame = 3
Query:  258 FILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIIT-STLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP---IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRF 1169
            F +DS S    ++ +DRE+     + +Q +          H       CN        I +FV+D+NDN P F + +    +++E+ PLG  +    A D D     V++    L + L N + ++ A    DG   LI T   LDRE  + Y F ++A DG      +    + I + DINDN P FER  YI  +    ++ P   + ++   D D   N  I   + N+    ++  F ++    ++   Q+       L           ++VA+D G    SS   + + I      +P +RF
Sbjct: 1895 FSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGH-------CN--------ITIFVEDQNDNAPRFKLSKY-TGSVQEDAPLGTSVVQISAVDAD---LGVNA---RLVYSLANETQWQFAI---DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVP--ALIQPGQTLLKVQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKL--------LHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRF 2166          

HSP 15 Score: 60.8474 bits (146), Expect = 8.219e-9
Identity = 115/510 (22.55%), Postives = 202/510 (39.61%), Query Frame = 3
Query:  768 TEITIKIRDINDNAPKFERPIYIRTIKE-NVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLID---SKIIVTVQCD-DYDNEIPLNTNAS---------IFIIINDVNDNPPKFTQN---VYYG------QIEENINNHEVFMNAAIHAADKDLHL-NGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSF---DFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTS----TITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
             E+ I++ D NDN+PKF +  ++ T+ E N     + Q+   D D   N R+   + +   +     F ++     I      VR    LD E +   ++ KI+A D G   ++ TAT+R+QI++VND  P   F  N        ++ E T    ++  +  +D D+                        +P   Y+   L     +D E    F +D    K+++  + D +   E  L+  AS         + + +ND NDN P F       Y+       +I E+++    F    ++A D D    N KV Y I+  +       F +   NG +  + S           Y   ++A D G P  L SS+ + V+  D      QF Q+ +   + E   +G ++ Q+    +D+L    D    + + ++  A +L+     +  I    P+DRE+       +        P     +      ++IT+ D ND+ P F
Sbjct: 2306 AELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHD---NAFVIEPAFSGI------VRTNIVLDRE-IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPT--FPPNNL-----VTVSEATELGAVITSISANDVDT------------------------YPALTYR---LGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVD--FDLLTVNATDADSEGNNSKVIYIIEPAQEG-----FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKP-ALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLG---QDAL----DQSLAIIAGNEESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF 2752          

HSP 16 Score: 58.9214 bits (141), Expect = 2.911e-8
Identity = 134/532 (25.19%), Postives = 212/532 (39.85%), Query Frame = 3
Query:  444 VDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSD-FELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEG-NRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDI--LDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFS-------IDEGTLSNKILAYVQVSDADSMIN-----------QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSF-IVVATDQGHP----NRLSSSSTIIVRIKDQNDNAPQFSQS-HFAFFVDENVEIGHLIGQINATDRD 1955
            ++DENDN+P F   Q    T+ E    G  +    A D D      S+ +L      GN  + F +   F   V   I+   LDRE   +Y   +IA D  EG  + TG   I ++I D+NDN P F  P  + T+ E   +  +    ++  D D    +  ++   G E    I  + I  LD+  GK+  + R    LDYE L   +E  ++A D    + +    L +++ + ND +P    V   QQ    F+       I E    +  L  V  +DADS  N           Q   S+     ++ +  SR +  V+    + +R    I ++A +P L  S  ++ VQ                    ND      +F QN Y  QI E      V +     A D+ L +       I   + S+  +      Q+  I   +  D E+  +Y   +V++   G P       SS  ++I+ I D NDN P F +S  +   + E   + + I Q+ A D D
Sbjct: 2312 LEDENDNSPKFSQKQF-VATVSEGNNKGTFVAQVHAFDSDAG----SNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIV---LDREIRDIYKLKIIATD--EGVPQMTGTATIRVQIVDVNDNQPTFP-PNNLVTVSEATELGAVI-TSISANDVDTYPALTYRL---GAESTVDIENMSIFALDRYSGKLVLKRR----LDYE-LQQEYELDVIASDAAHEART---VLTVRVNDENDNAP----VFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRI---IAKDAGKPAL-KSSTLLRVQA-------------------NDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAI-------IAGNEESAFELL-----QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD 2781          

HSP 17 Score: 52.373 bits (124), Expect = 3.407e-6
Identity = 40/158 (25.32%), Postives = 72/158 (45.57%), Query Frame = 3
Query: 1809 LSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESI 2282
            L+S + +++ ++D+NDN+P+FSQ  F   V E    G  + Q++A D D+    +    IV  +  N     +     +G +RT   +DRE        + + +       +   A I + + D+ND+ PTF       + L+   E  + G +  SI
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDN---AFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEG--VPQMTGTATIRVQIVDVNDNQPTF-----PPNNLVTVSEATELGAVITSI 2449          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 154.451 bits (389), Expect = 2.581e-37
Identity = 160/600 (26.67%), Postives = 273/600 (45.50%), Query Frame = 3
Query:  423 SNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKI--IVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQ-DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTST-ITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            +  +RV V D NDN+PVF + Q+ + T+ EN P G  +  P+A D D           +L F L          H       +   +TLDRE+TS+Y  TL+A D            +TI + D+NDN PKF+   Y   + E +     +F     D D+ EN  +   +    Q + +      ++   + +++ + ++ ++L Y          I A D G  SLSS A L + IL   ++ P   ++ N       F++ E     K++  V              S  +P+  L + + R+     I    SLR   N    +     +D ++  +  +  +  D + P L +   I + + D NDN P   Q +Y  ++ E  +  ++   A + A+D+D   NG V Y +Q DF  +     F I +++G+IY     D E+   Y+F+V A DQG P+ ++ ++++++ + D+NDN P+F++  F+  V EN EIG  + ++ ++D D L  + +  +   S S+N   K   ++P +G I     +DRE+    I   V S    R       E  I IT++D ND+ P F
Sbjct: 2474 TGIVRVEVQDINDNDPVFEL-QSYHATVRENLPSGTHVLTPRATDKDEG------LNAKLRFNLLGEHMHRF--HIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKL-ELKTKTKSHDDLTY-------TIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSH-----FAMSEDVRPGKMITKV--------------SATSPKKGL-VGKIRYAIAGGIMGD-SLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLI--AVVKASDRDSGDNGNVIYRLQNDFDGT-----FEI-TESGEIYTRMRLDREEIGDYAFVVEAVDQGVPH-MTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFVIRVTSSDLD-LGANANASY---SFSENPGEKF-RIEPQSGNITVAGHLDREQQDEYILKVVASDGAWR------AETPITITIQDQNDNAPEF 3013          

HSP 2 Score: 148.673 bits (374), Expect = 1.454e-35
Identity = 162/629 (25.76%), Postives = 283/629 (44.99%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYC-TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDD--------------------------------YDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNS----SNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            +RV V D+ND+ P F  + TP+   + E+  +G+ I   +A D D            + F L +  D +       G   LI+  TLDRE  S Y   +   DGV+      +   TI++ D NDN P FE  +Y   I EN      + QI+  D D  +N ++   + +   +W N +F+L+      G +    R    LDYE++ H +   + AQD G+ SLS+T T+   +L++ND +P    +    ++      +   ++ +++  V   D DS  N L    +T  ++    +S F     I    ++RT +N+DRE    + +    +    C D                                +  +  L++   + I+I DVND  P F  +     I EN+  + V +  A+ A D D   NG + Y +++ ++     S+ + F ++  +G++    + D E  S Y   + A D+G P + S+ S +++RI D+NDN+P F    ++  V EN  IG ++ Q++ATD D     + IR+ +    QN      ++   TG +R    ++ E+ S  +  V +++   + N     A + I + D+ND+ PTF
Sbjct: 1809 VRVTVLDKNDSPPQF--LDTPFVYNVSEDLQIGHTISTLRAHDPDTLG--------SVTFLLMDGHDGKFLLEPSTG--KLILNDTLDRETKSKYELRIRVSDGVQYT----EAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVS---DWANDVFSLN---PQTGMLTLTAR----LDYEEVQH-YILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEV-----FENVPIATEVVT-VSAKDIDSGNNGLIEYSITAGDV----DSEF----GIDSNGTIRTRRNLDREHRSTYTL---TVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFI-SANETAIMENVAINTVVI--AVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQ-STESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGR-IRYSIVLGDQNHD---FSISEDTGVVRVAKNLNYERLSRYSLTVRAED-CALENPAGDTAELTINILDINDNRPTF 2384          

HSP 3 Score: 141.739 bits (356), Expect = 2.145e-33
Identity = 178/683 (26.06%), Postives = 288/683 (42.17%), Query Frame = 3
Query:  315 LCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVD--DENDNNPVF-PIVQTPYCTIEENKPLGYRIPLPKAQDLDNAT-----FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVE-----------------------------------GNRNTGKTEITIKIRDINDNAPKFERPIYIR----TIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQ---FSLRTTQNIDREA-NEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDL-HLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            L P   ML L           +IL  Q   N +   S  I V+ +  D NDN P+F P+  +    + EN P+   +    A+D+D+       +S+++  ++  F + ++      ++             LDRE  S YT T+ A D  +                                     R +   ++TI I+D+ND     E P++I      I ENV ++  +  +   D DE  NG ID  M  +  E + +    D L  S+     Q+R ++ LD E L  S+   I A+D G    S+ + L I+IL+ ND SP    V + +Q +   S+ E      ++  V  +D D   N                  R R+ + +  Q   FS+     + R A N  +   S+  +TV+ +D   E P    A + I I D+NDN P F  + Y  ++ EN           ++A D D   LN +V Y    F    ++  FRI++ +G I   +  D E++S Y+  +VA D G P  L+ +  + V ++D NDN P F    +   V EN+  G  +    ATD+D     K +RF +  +  +R      +D  TG+I T   +DRE+TS     + +++ S I         + I+V D+ND+ P F
Sbjct: 1972 LNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYS--SEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRN-------------LDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVND-----EVPVFISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQS---DPLPFSLNPTDGQLRVVDALDRE-LRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSP----VFDPKQYSA--SVAENASIGAMVLQVSATDVDEGAN-----------------GRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRY----FLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPP-LTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAK-LRFNLLGEHMHR----FHIDSETGEISTATTLDREETSVYHLTLMAQD-SSITEPRASSVNLTISVSDVNDNIPKF 2596          

HSP 4 Score: 139.428 bits (350), Expect = 1.058e-32
Identity = 159/606 (26.24%), Postives = 255/606 (42.08%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIE--ENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITST--LDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRA----INNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEI--RFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNIL---MIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFII-INDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            +R+ V D NDN+P FP    P   I   E+   G R+ L  A D D     V+     +   + N        +      YL + +T  LDRE    Y   + A DG    R  G  ++ + I D+NDN P F+   Y  ++ E  +   P+  ++ +D D  +N +I   +  +  ++         ++   G +    R       N+       S  F + A+D G         + + +L+ ND  P I  RF  +G ++    ++DE  ++  ++A V V D+DS +N      +   N L    +EE+   H V        R    +DRE         K  +TV     D   P  T  +  II +NDVND+ P F ++ Y   + E +     F+ A+I A D+D  +N +V Y   D  + +   +F +D   G I  +   D E        + A D G PN   + + + V I D+ND APQFSQ      + E+     ++  + ATD D    +  + F +    +        LD LTGQ+ TR P+DREK S     V +++           A + + V D+ND+ P F
Sbjct:  142 VRIKVLDVNDNSPEFP---EPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPR-FGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFT--------VNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVA---TVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIV--------RVNGVLDREEI------GKYNLTVVA--MDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSE-LAPTGSFV-ASITATDEDTGVNAQVHY---DILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGG-PNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQ-GTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAP-TPQSATATVWLNVADVNDNDPQF 708          

HSP 5 Score: 133.265 bits (334), Expect = 8.412e-31
Identity = 164/601 (27.29%), Postives = 255/601 (42.43%), Query Frame = 3
Query:  444 VDDENDNNPVFPIVQTPYCT-IEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWI-----NKIFTLDILD-QSIGKVQAQVRAIN---NLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + D ND+ PVF    T Y T + E   +  R     A D+D       SY++      GN+    +   F DG  YL + + LDRE+   Y  T+   D  + +R++    + I + D NDNAP+F    +  +I EN   D  + ++   D D   N  +   + +  Q++        I TL   D +++ KV     A     +L      +    +    D G   L     +++ + +VND +PE  F+R    +T    I EG      + +V   DAD  +N      L   N    E  +F    +   Q SL   + +DRE+ E   I   I+V     D   + PL++NASI I++ D NDN P+FTQ+     + E        M     A+D D  +N +V + I           F IDS  G +Y  +  D+E  + Y+  + A+D G P+ LS++    V + D NDN P F  +     + E + +   I  + A D DS    K    I K + Q    +   ++  TG I T   IDRE   T    V   +   PS     L  E ++ + V D+ND+ P F
Sbjct: 1039 IADVNDHTPVFD--HTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEI----IEGNTE--RMFGVFPDG--YLFVRAPLDREERDYYALTVSCRDAGQPSRSS-VVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPE--FLRAPYHVT----ISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGN----EAGQFNLD-SATGQLSL--GRRLDRESQE---IHHLIVV---AKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMR--FRASDADQGVNSQVVFSISAGNRRDT---FHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPS-LSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSE--RQLSTEKLVTVIVEDINDNAPVF 1601          

HSP 6 Score: 128.642 bits (322), Expect = 1.824e-29
Identity = 156/613 (25.45%), Postives = 264/613 (43.07%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQT--PYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLE----LPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDAD---------SMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKI--IVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN---PSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + + + D NDN PVF + +   P  ++ EN  +G  I L + +D D    S  SY L       F++G  +          GV YL     +  E  S+    L+A D      ++ K  +++ I D+ND+ P F+   Y  ++ E   V+   F +  TD D  +NGRI  ++     E +  +F    L          VRA   LD E+  + +   +  +D G+ S SS   + I +++ ND +P+          T  FSI E   ++  +  +   D D         ++ +Q Q   +  RN  +     F       ++  ++ ++N +    +  L  S     + ++    DN IP L     + +I+ DVNDN P+F +  Y+  I E  +      +  +   D D  LNG V Y +      + A  F +DS  G++   +  D E + I+  IVVA D    + LSS+++I + + D+NDNAP+F+QS     V E    G  + +  A+D D     +    +V S S         +D +TG +    P+D E  ++ T  + + +   PS     L    +  + V D ND+PP F
Sbjct:  928 VNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVT----------GVLYL--QRPIRAEPGSLIHVELMATDAGSPPLSS-KLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYL---------FVRA--PLDREERDY-YALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQF------TNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFD------REALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITH--VFTQDADEGLNGDVYYSL---AKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQ----VVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPS-----LSTTVLYNVLVVDDNDNPPIF 1489          

HSP 7 Score: 115.931 bits (289), Expect = 1.553e-25
Identity = 160/603 (26.53%), Postives = 262/603 (43.45%), Query Frame = 3
Query:  420 QSNFIRVF--VDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNS-SDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLY-HSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTN-ASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHL-NGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFR 2207
            QS+  RV   V  EN + P F  V +    + EN+P+G  I    A D D     +  Y +      GN   DF + +        ++I   LD +    Y    I +  +  +  +    +TI + D+NDN P F    Y   I EN  V   +FQ    D+D  +N  I      SG +     F   I++QS G + + V    + DYE+   ++ + K    D   +S+ S A L + +L VN+  P+        Q    F + E +     +  VQ +D DS  +     LL   +     +  FR   N    +  R   ++DRE        +++++TV   +Y +    +T+ A + I I D ND PP+F ++ Y   I E            + A DKD+   N + +Y I    N +    F+ID Q G+I  +   D E+ S Y+ ++ A D G P + + S+T+ + ++D NDN P F+      ++ EN   G  I  + A+D D LP +    F  +       S L ++D  +G +R+    DRE T  +   +E ++  +       + ++ ITV D ND+P T R
Sbjct: 3209 QSDETRVVIVVTGENMDTPRFS-VNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSI----SGGNERQDFSVDERTGG----IVIQQQLDYDLIQEYHLN-ITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPD--RHFF---IMNQSNGTISSAV----SFDYEERRIYTLQIKAKNPD---SSMESYANLYVHVLGVNEFYPQFL------QPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSS----NDKGFRIDTNTGLIYVAR---HLDRETQ------NRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKV--TTVKAIDKDVRTQNNQFSYSI---INGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQ-TGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPD-LPRNGG-PFTYQLIGGKHKSWL-SVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQK--SQHLLTITVLDQNDNPSTTR 3758          

HSP 8 Score: 111.309 bits (277), Expect = 3.862e-24
Identity = 105/405 (25.93%), Postives = 182/405 (44.94%), Query Frame = 3
Query: 1026 NNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDRE--ANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQI---------RTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + LDYE L H +E  I A DG   SL S   + + + + ND +P +      +Q+     + E     +++A V+ SD DS  N          N++   ++ F     I +   + T   +DRE   +  F++++           D  +P +   AS+ + + D NDNPPKFT+ ++   + EN       +   + ++D DL  N   +Y   +         FRI+ Q+G I  +   D E++  Y   VVA+D        + + I + I+DQNDNAP+F  S ++F   E  +   L+GQI ATDRD    +  I +     S  + S + ++DP TG++          ++Y    E    +T          +++    E ++ I + D +++PP F
Sbjct: 2766 DGLDYE-LTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVM------EQLIYNAEVLEEESPPQLIAVVKASDRDSGDNG---------NVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEA----------VDQGVPHMTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFVIR--VTSSDLDLGANANASYSFSENPGEK----FRIEPQSGNITVAGHLDREQQDEYILKVVASD----GAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISY-----SLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYS----ECLVNINIVDAHNNPPKF 3124          

HSP 9 Score: 105.531 bits (262), Expect = 2.369e-22
Identity = 151/624 (24.20%), Postives = 265/624 (42.47%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSS-DFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFS-LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKES----IYSFIVVATDQGHPNRLSSSS--TIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT-RYPIDREKTSTITFFVESKN---PSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQ 2261
             IR+   DENDN+PVF   Q    ++ EN  +G  +    A D+D      ++ ++     LG+ + DF +++    GV  + +   L+ E+ S Y+ T+ A D    N      E+TI I DINDN P F    Y+  + EN +      +L  +  + +   ++ ++    +E  + +F        I      +  +  LD EQ    +   +VA D G   L+ T  +R+++ ++ND  P        Q      ++ E   S   +   + +D D  +N +L+ +LL              H  +I  +   + T   +DRE    + +      T+   D     P  ++ ++ I ++DVNDN PKF    Y   + E I+  E    A   A D D   N  V Y I    +  +  YF I+++ G +        + +S     Y+ ++ A DQG    LSS +  T+I+R  +        + SHFA  + E+V  G +I +++AT     P+   +  I  + +       + +DP +G +   +  +D E T     ++E+ +   PS     L    +I + V D ND+ P          QLI + E L++
Sbjct: 2265 LIRIL--DENDNSPVFDPKQYS-ASVAENASIGAMVLQVSATDVDEG----ANGRIRYSIVLGDQNHDFSISE--DTGV--VRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLF-------RINASSGDIALLKPLDREQ-QSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFEL----QSYHA--TVRENLPSGTHVLTPRATDKDEGLNAKLRFNLL----------GEHMHRFHIDSETGEISTATTLDREETSVYHL------TLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGA--RALDLDDGENAVVHYTI----SGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGE-QSLSSKAELTVILRPPELFPTFAYMANSHFA--MSEDVRPGKMITKVSATS----PKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPS-----LRSVTLITLNVTDANDNAPVME-------QLIYNAEVLEE 2822          

HSP 10 Score: 105.145 bits (261), Expect = 3.158e-22
Identity = 154/634 (24.29%), Postives = 265/634 (41.80%), Query Frame = 3
Query:  378 HILDFQISCNNEEMQS----NFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAID-GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKM---HNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMI--NQLQCSLLTPRNILMIEES----------RFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADK-DLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKD 2216
            H+ +  I   + +  S      I + V D NDN PV   +      +EE  P    I + KA D D+       Y+L+  F       FE+ +  +     +     LDRE+   Y F + A+D GV     TG   + + + D NDN PKF R ++   + EN  +   F I VT  D D     +       N G+++             I      +    +LD EQ    +  K+VA DG   +  +   + I I + ND +PE       +     FS  E   S  ++  +  +D D     + +  SL  P  +  I+ +          RF+H      Q+ +R+ +N+               +TV   D + + PL +   + I I D ++NPPKF Q  Y   + ++    +  +   +HA DK DL  N ++ Y +  F  SS    F +   +G I   +       + Y  +V ATD+G P + S  + +++ +  +N + P+FS + +   V EN  +G  I  + ATD D+ P    +R+ +   ++ +     ++D  TG I  +  +D +        +  ++    ++ L   AM+ I + D+ND+PP F  K+
Sbjct: 2774 HLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQL-IAVVKASDRDSGDNGNVIYRLQNDFD----GTFEITESGE-----IYTRMRLDREEIGDYAFVVEAVDQGVP--HMTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGS-FVIRVTSSDLDLGANANASYSFSENPGEKF------------RIEPQSGNITVAGHLDREQ-QDEYILKVVASDG---AWRAETPITITIQDQNDNAPEF------EHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKH-----SQY-VRSPENM-------------YALTVLATD-NGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVR--VHANDKQDLGTN-EMDYSLMTFNLSS---IFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQ-SDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGM-LRYSISGGNERQD---FSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLG--YHPLSSVAMLTIILTDVNDNPPVFNHKE 3338          

HSP 11 Score: 100.138 bits (248), Expect = 9.269e-21
Identity = 166/696 (23.85%), Postives = 288/696 (41.38%), Query Frame = 3
Query:  318 CPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTP----YCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKL----ELP-FKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSL-------RTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVY-YG--------QIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKI--YNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTII---VRIKDQNDNAPQFSQSHFAFFVDE----------NVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTS----TITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISL-ETLQQGQ 2267
            CP Q  +   K   S  +C   +  +   +  +    ++ V + D ND++P+      P      T++EN   G  +     +D D+     +S ++    EL  F+L  ++D  + +          +   LDRE+   Y  T++A+D     R T    + I + D+ND+ P FE+  Y   + E       +  I  TDED   N ++   +  SG E   K F++D L          +     LD E +  + E  I A+DGG N   +   L++ IL+ ND +P+  F +  Q +T G    E      I+A +  +D D   N      L P     +E     +P+    QF+L        T + +DRE        S+  ++V   D     P +  A++++ + DVNDN P+F    Y Y         ++++ +    + ++  + A+DKD   N  + Y ++    S     F++D+++G I            +  Y  +V A D G   R S    I+   ++ K +     Q     + F + E          N E+G  I Q+ +T+  +   H +   I    +QN       +D  +G+I T  P+DRE+ +    TI     S + +   +    + ++ I + DLND+ P F L    +S+  ISL E    GQ
Sbjct:  333 CPQQTNV---KSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVR----------VNGVLDREEIGKYNLTVVAMDQGTPARTT-TAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDIL-SGNEL--KWFSMDPL-------TGLIVTTGPLDRE-IRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQ--FSQREQNVTLG----EDAPPQTIVALMTATDHDQGTNGSVTFALAPS----VER---LYPL----QFALDALTGQLTTRRPLDREKM------SQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLH--VTASDKDDGDNALIEYRLE----SGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQ--RRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVG--IVQVKSTNGKA-NSHIEYDIIQGDRAQN-----FRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALD--RESEPTISLPENAAVGQ 962          

HSP 12 Score: 98.9821 bits (245), Expect = 2.157e-20
Identity = 159/669 (23.77%), Postives = 264/669 (39.46%), Query Frame = 3
Query:  258 FILDSDSN-LKVSKQIDREELCP----PQMMLQLNKVCGSIHTCCHILDFQISCNN-EEMQSNF-IRVFVDDENDNNPVFPIVQTPY-CTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF-ERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVND---MSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQ---NVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNA----PQFSQ-SHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            F +D+ +  +K  +  DRE L       +   +   + GS+     +L+  +S N    +Q    ++V V D NDN P F  ++ PY  TI E    G  I     QD D        Y L    K   +  F L          L +   LDRE   ++   ++A D    +  +    ITI + D NDNAP+F +    +  ++ +     + +   +D D+  N ++   +    +      F +D        +   +     LDYE +  S+   I A D G  SLS+T    + +++ ND   + P    VR          I EG      +  V   D DS +N      ++ +   + +   F   +N  +   + T + IDRE+ + F    ++ V        +E  L+T   + +I+ D+NDN P F      +   +   +  +    M   +HA D D   NG VTY I     S     F++    G I  +    F++E  Y   + +TD+   +   SS   I  I   +  +    PQF Q S  +  V EN  IG  I  + A    +  E+  +  +  + S+ +  +L  +D   G + T   +DRE      + VE    +           + +TV D NDSPP F
Sbjct: 1199 FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEF--LRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLA---KGNEAGQFNL----DSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRR---DTFHID-------SITGSLYLHKPLDYEDIT-SYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQ---------IKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFG--INT-ETGVIHTLREIDRESIDTF----RLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQ--VHAKDADSSSNGLVTYEIV----SGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYF-VTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPE-EYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQF 1823          

HSP 13 Score: 98.5969 bits (244), Expect = 2.664e-20
Identity = 130/515 (25.24%), Postives = 218/515 (42.33%), Query Frame = 3
Query:  771 EITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQI-LVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQ--NIDREANEPFLIDSK-IIVTVQCDDYDNEIPLNTNASIFIIIN--DVNDNPPK-----FTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAM-YFRIDSQNGK--IYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFR-------LKDPSKSQLIISLET 2252
            E+ IK+ D+NDN+P+F  P    +  E+        +   TD D  ENG  D     +G    NK   +   + S       +    NLD E    S++  I A+DGG         + + IL+VND  P   F  +   +    S++E  L    +  V  SD D   N         +    + E+  +  VN  +   + TT+  N  ++ N       K  + TV   D+ +      +   ++ +N  D ND+ P      F        ++EN  N  V   AA+   D D  LNG+ +  I     S N + +FR++       +  +   D E+   Y+  VVA DQG P R ++++ +I+ + D ND+ P F +S ++  + E    G  +  I ATD D+   +  + + + S ++    K  ++DPLTG I T  P+DRE   T+   + +++     N       + + + D ND  P F        L + +  Q I++L T
Sbjct:  141 EVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGN-VDNKFRLVTTANPSGDTSYLHLETTGNLDRES-RGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPP--IFDHSDYNV----SLNETALPGTPVVTVMASDNDLGDNS--------KITYYLAETEHQFTVNP-ETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSP---RQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVV--AAVAVKDSDSGLNGRTSVRIV----SGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPAR-TTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDT-GVNAQVHYDILSGNE---LKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGP--NPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMT 622          

HSP 14 Score: 97.8265 bits (242), Expect = 5.416e-20
Identity = 128/570 (22.46%), Postives = 233/570 (40.88%), Query Frame = 3
Query:  450 DENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKE-NVIVDPIFQILVTDED-EDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKV--QAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDA-DSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREAN-----EPFLIDSKIIVTVQCDDYDNEIPLNTNAS-IFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQG-HPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNP 2123
            D+NDN P F  + +    + EN  +G  +    + DLD    + +SY     F       F +     +    + +   LDRE+   Y   ++A DG        +T ITI I+D NDNAP+FE   Y  +  E    +  + QI+ TD D +  N  I   +        + +F++D    + G+V  +  VR  ++       + +   ++A D G+  L S   + I I++ ++  P+       +Q      + +  +  + +  V  +D  D   N++  SL+T                     F+L +  ++ R        +P  +       +     D  +P  ++ + + I++   N + P+F+ N Y   + EN       +   + A D D   NG + Y I       +   F +D + G I   Q  D++    Y   +   D G HP  LSS + + + + D NDN P F+   +  ++ EN  +G  + Q +A D+DS P++  I +       +R      ++   G I +    D E+    T  +++KNP
Sbjct: 2905 DKNDNPPKFTRLFS--LNVTENAEIGSFVIRVTSSDLDLGANANASYS----FSENPGEKFRIEPQSGN----ITVAGHLDREQQDEYILKVVASDGAW----RAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQP-----SPMFSID---PATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKF------EQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMT---------------------FNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILT--VGATDDDTGPNGMLRYSISGGNERQD---FSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHP--LSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDS-PKNAIIHYAFLPSGPDR--HFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNP 3415          

HSP 15 Score: 86.2705 bits (212), Expect = 1.619e-16
Identity = 158/680 (23.24%), Postives = 267/680 (39.26%), Query Frame = 3
Query:  252 GLFILDSDSN-LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEI-TIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWI-NKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNS---LSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLT--PRNILMIEES----------RFRHPVNIYKQFSLRTTQNI---DREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNA----MYFRIDSQNGKIYNSQSFDFEK-ESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQ--EAMIVITVRDLNDSPPTF 2204
            G F LDS +  L + +++DRE     Q +  L  V          L   +S N        I + V DENDN P F    +   ++ E  P G  +   +A D D    S    ++      GN  D     H       L +   LD E  + YT  + A D   G  +   T +  + + D NDN P F     +R IKE + +  PI  +   D D   NG++   +     +    + F        I      +  +  +D E +  +F   +VA D  + S   LS+   + + + ++ND +P +    N   +   FS  +G  S+  +  V   DADS  N L    +   P+ +  ++ +          +F+  V    Q +L++T      +R ++E ++     I+T      ++ +P     S             K + +VY     EN       +    H A      + ++ Y + +   + +       F ID++ G +  +   D E     Y   V A   G   R +S + + V + D+ND+ PQF  + F + V E+++IGH I  + A D D+L     + F++      +      L+P TG++     +DRE  S     +         +D +Q  EA   I V D ND+PP F
Sbjct: 1324 GQFNLDSATGQLSLGRRLDRES----QEIHHLIVVAKDA-----ALKHPLSSNAS------ITIVVLDENDNAPEF-TQSSSEVSVLETSPTGTELMRFRASDADQGVNS----QVVFSISAGNRRD---TFHIDSITGSLYLHKPLDYEDITSYTLNITASDC--GTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHF-------GINTETGVIHTLREIDRESI-DTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAP-VFVSMNAAILPPKFSTSKG--SSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRY--QLTLKSTDEAVQSERRSSEVYIT----IITPGSGGSESSVPQFEQRS-------------KLSGSVY-----ENEPIGTSILTVTAHLA------SAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPR-TSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTL---GSVTFLLMDGHDGK----FLLEPSTGKLILNDTLDRETKSKYELRIR-------VSDGVQYTEAYATIQVSDTNDNPPLF 1922          

HSP 16 Score: 73.9442 bits (180), Expect = 8.973e-13
Identity = 132/537 (24.58%), Postives = 214/537 (39.85%), Query Frame = 3
Query:  687 LDREKTSMYTFTLIAIDGVEGNRNT-----GKTEITIKIRDINDNAPKF----ERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEK---------------------ESIYSFI-VVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            LDRE+ + Y  T++A      +        G+  + I I D+NDNAP F    E    I   +   +   I+   V D D   N RI   + N+     N+ F +  +   +  +Q  +RA    +   L H    +++A D G   LSS  +L + I +VND +P           +   S+ E T  N     +  +D D   N         R    I E        ++    L     +DRE  + + +      TV C D   +   ++   + I + D NDN P+FT + +   I EN    + F+   + A D+D+  N ++++ +     SS    F ID++NG I   + FD E                         Y  +    +D G P RL     + V + D NDNAP+F ++ +   + E    G  I  +   D D    + D+ +   S ++   +    LD  TGQ+     +DRE        V +K+ + + + L   A I I V D ND+ P F
Sbjct:  894 LDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNN----PNQQFRIGPV-TGVLYLQRPIRA----EPGSLIH---VELMATDAGSPPLSSKLSLSVLIADVNDHTPVF------DHTSYETSLPETTKVNTRFFALAATDIDLGDNG--------RISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYAL------TVSCRDA-GQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENA-PADTFV-GKLTAVDRDIGRNAELSFTL-----SSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIP-RLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADE-GLNGDVYY---SLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKD-AALKHPLSSNASITIVVLDENDNAPEF 1384          

HSP 17 Score: 73.1738 bits (178), Expect = 1.689e-12
Identity = 123/499 (24.65%), Postives = 203/499 (40.68%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAID---GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGG--RNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDAD--SMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFS-LRTTQNIDREANEPF-LIDSKIIVTVQCDDYDNEIPLNTN-ASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGK-VTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFA 1889
             + + + D NDN PVF   +  +C I ENKP+G  +    A D D+   ++  Y   LP   G    F +       +   +   + D E+  +YT  + A +    +E   N     + + +  +N+  P+F +P++   + E   V   +  +  TD+D  E+GR+   +  S  +   K F +D            +    +LD E   +     ++A++ G  R + +  A + I I + ND  PE  F+++    T    I E       +  V+  D D  +  NQ   S++             +    I  Q   + T   +DRE    + L+   I         D  +P  T  A++ I + DVNDN P FT     G I EN       M   + A+D DL  NG   TY +   K+ S   +  +D  +G + ++ SFD E   I   I+   D G P +  S   + + + DQNDN       H A
Sbjct: 3319 MLTIILTDVNDNPPVFNHKEY-HCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAF-LPS--GPDRHFFIMNQSNGTISSAV---SFDYEERRIYTLQIKAKNPDSSMESYAN-----LYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSND---KGFRIDT-------NTGLIYVARHLDRET-QNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPE--FIKHYYTST----ISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIIN---------GNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAI---------DTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMT--LIASDPDLPRNGGPFTYQLIGGKHKS---WLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQ-KSQHLLTITVLDQNDNPSTTRSLHIA 3763          

HSP 18 Score: 72.7886 bits (177), Expect = 1.807e-12
Identity = 68/280 (24.29%), Postives = 125/280 (44.64%), Query Frame = 3
Query: 1371 LRTTQNIDREAN-EPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENIN-NHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            L T   +DREA  E + ++   I            P  +   + + + D ND+PP+F    +   + E++   H +   + + A D D    G VT+ + D  +      F ++   GK+  + + D E +S Y   +  +D        + +   +++ D NDN P F  + ++F + EN + G+ +GQI A D D L ++  + + V SD  N    + +L+P TG +     +D E+       V++++  +    L     +   V DLND+ P F
Sbjct: 1774 LSTAAELDREAGPEEYEVEVYAIAL-------GGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTI---STLRAHDPDTL--GSVTFLLMDGHDGK----FLLEPSTGKLILNDTLDRETKSKYELRIRVSD----GVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDAD-LGQNAQLSYGVVSDWAN---DVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQ--PSLSTTITVYCNVLDLNDNAPIF 2027          

HSP 19 Score: 67.3958 bits (163), Expect = 9.905e-11
Identity = 134/574 (23.34%), Postives = 221/574 (38.50%), Query Frame = 3
Query:  669 LIITSTLDREKT-SMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIR----------FVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQL--QCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENIN-NHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATD-----------------------------------QGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKS---DSQNRASKL-ITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKS 2228
            L   + LDRE     Y   + AI  + G   T +T++ + + D ND+ P+F    ++  + E++ +      L    D D  G +   + +             +L+ S GK+      +N+    +    +E +I   DG +    + A   IQ+ + ND  P               + G Q+    + D     N  L+Y  VSD  + +  L  Q  +LT                          T  +D E  + +++    IV  Q    DN  P L+T  +++  + D+NDN P F    Y  ++ EN+    EV     + A D D   NG + Y I      S    F IDS NG I   ++ D E  S Y+  V A D                                        RLSS+  + + IKD ND  P F  ++    + ENV I  ++  + A D D    +  I +++K    +   ++  L  +L+P  GQ+R    +DRE  S+    + +++  R       E+ ++I + D ND+ P F  K  S S
Sbjct: 1774 LSTAAELDREAGPEEYEVEVYAI-ALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRA-HDPDTLGSVTFLLMDGHDGKF-------LLEPSTGKL-----ILNDTLDRETKSKYELRIRVSDGVQ---YTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLT-------------------------LTARLDYEEVQHYIL----IVQAQ----DNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVV---TVSAKDIDSGNNGLIEYSITAGDVDSE---FGIDS-NGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIM-ENVAINTVVIAVKAVDNDE-GRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARD--RGEPPQSTESQLLIRILDENDNSPVFDPKQYSAS 2286          

HSP 20 Score: 50.8322 bits (120), Expect = 8.476e-6
Identity = 78/298 (26.17%), Postives = 122/298 (40.94%), Query Frame = 3
Query:  435 RVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNAT------FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAID-GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQE--WINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTL-SNKILAYVQVSDADSMINQLQCSL 1295
            +V +  ++ N+P   I      TI E  P+G ++   KA D D  T      +S+ +  L+  FK+    D +  +        +   S LDRE+TS Y   + AID G+     TG   + I++ D+NDN P F        I EN      I  ++ +D D   NG         G+   W+           S+ +    VR+  + D E +    E  I  +D G+    S   L I +L+ ND     R       +    S+  G L SN  LA V+ +D D ++   +C L
Sbjct: 3531 QVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKI----DVQTGE--------ISTASRLDREETSTYNLVIGAIDTGLP--PQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWL-----------SVDRNSGVVRSTTSFDRE-MTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTR------SLHIAVSLFNGDLPSNVKLADVRPNDID-IVGDYRCRL 3795          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 145.976 bits (367), Expect = 8.767e-35
Identity = 164/604 (27.15%), Postives = 263/604 (43.54%), Query Frame = 3
Query:  420 QSNFIRVFVD--DENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSD-FELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQD-GGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQF-SLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKT-STITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFR 2207
            +SN  ++ V+  D NDN P F   Q    ++ EN P+GY I   +A D D           E+ + +    D F LA   + G  ++     LDRE+   + F ++A DG    + +  + + I ++D+NDN P F    Y   + E+     P+  +  TD DED     ++   N+   +        I  Q+    +  +    +LDY+Q    F   + A D GGR   S TAT+ I I + N+ +P      N       F  ++  +   +L  V  +D+D  +N Q+  SL    N   I       P +I  Q  ++ T   +DRE    +L+      TV   D  N   L+    + I + DVNDN P F   +Y   I E+       +  A  A+D D+ LNG++ Y + D      +  F ID  +G I  ++  D E  +++    +A D+G P  LSS+  + +R++D ND+ P F+      +V EN  +G ++G+I+A D D          I+  D  N  S +        Q+ T   +D E T       V + +P      L  +A I I V D+ND+ P  R
Sbjct:  669 RSNTTQLLVNVIDANDNAPRFYTSQFQE-SVLENVPVGYNIIRVQAYDSDEGA------NAEITYSISERDDNFPLAVDPRTG--WVQTIKPLDREEQGRFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFA-------ITSQN---GRGLITIAQSLDYKQ-EKRFLLTVAATDSGGR---SDTATVHINITDANNFAP---IFENAPYSASVF--EDAPVGTTVLV-VSATDSDVGVNAQITYSL----NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLL------TVTAKDGGNP-SLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVA--ASDPDVGLNGRIKYLLSDRDIEDGS--FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP-LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP-----LRNDAHIEILVTDVNDNAPVLR 1221          

HSP 2 Score: 139.428 bits (350), Expect = 8.544e-33
Identity = 164/613 (26.75%), Postives = 262/613 (42.74%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLE-LPFKLGNSSDFELAKHFKDGVPYLIIT-STLDREKTSMYTFTLIAID--GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIV----DPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAY----VQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNI-YKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNT-NASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGK--IYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQN--RASKLITLDPLTGQIRTRYPIDREKTSTITFFVESK---NPSRIFNDLIQEAMIVITVRDLNDSPPTFR 2207
            ++V V D ND++P F   Q    +I E   +G  +   +A D D    +   Y +E +    G + D E+     D    +I T S+LDRE +  Y   + A D    +  R T    + +K+ D NDN P+F    Y   + E+       + +  I  TD D+  N  I   +     +     F++D        +   V  +  LDYE +  S+   I AQDGG  S S+T  L + +++ ND +P  RF  +  Q        E  L N  + Y    VQ  D+D   N              I E     P+ +  +   ++T + +DRE    F          Q    D  +P  + ++S+ I + DVNDN P F    Y   + E+               D+D  L+ ++T         +    F I SQNG+  I  +QS D+++E  +   V ATD G     S ++T+ + I D N+ AP F  + ++  V E+  +G  +  ++ATD D +  +  I + +  +S N   +    +++P TG I T  P+DRE TS     V +K   NPS     L     + I V D+ND+ P F+
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFE-ASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ---SQFSID-------SMSGDVSLVKPLDYESV-RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--RFYTSQFQ--------ESVLENVPVGYNIIRVQAYDSDEGANA--------EITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRF--------AFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-------TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG---RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD-VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS-----LSDTTDVEIGVTDVNDNAPAFK 1008          

HSP 3 Score: 125.561 bits (314), Expect = 1.775e-28
Identity = 130/492 (26.42%), Postives = 225/492 (45.73%), Query Frame = 3
Query:  768 TEITIKIR-DINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDED-ENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAIN---NLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNI-YKQFSLRTTQNIDREANEPF--LIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQI-EENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLK 2213
            T+I  ++R ++ + +P FE+ +Y+ ++ E     P    + T    D E+  +   M          +  LD   QS+ KV ++   +    +LD E L     F++VA D      S T TL++ +L+ ND SP        +Q     SI EG      +  ++ +D D   N +++  +    +   + + +      I  +   + T  ++DRE ++ +  L+ +  + + Q +           AS+ + + D NDN P+F++  Y  Q+ E+     E    A I A D D   N  + Y I      S    F IDS +G +   +  D+E    Y  ++ A D G P+R S+++ ++V + D NDNAP+F  S F   V ENV +G+ I ++ A D D     +    I  S S+   +  + +DP TG ++T  P+DRE+     F V +K+           + +VITV+D+ND+ P F  K
Sbjct:  342 TDIARRVRRELRNQSPYFEQALYVASVLEE---QPAGAAVTTVRARDPEDSPVVYSM----------VSLLDSRSQSLFKVDSRTGVVTTSASLDRE-LMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF----EAEQFEA--SIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERR------TATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR-SNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAE----ITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG--VPPKSASSSVVITVQDVNDNDPAFNPK 797          

HSP 4 Score: 99.3673 bits (246), Expect = 1.706e-20
Identity = 118/517 (22.82%), Postives = 225/517 (43.52%), Query Frame = 3
Query:  486 QTPY-------CTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMH------NSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQD---GGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPV---NIYKQFSLRTTQNIDREANEPFLIDS----KIIVTVQCDDYDNEIPLNTNASIFII-INDVNDNPPKFTQNVYYGQIEENI-NNHEVFMN-AAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRD 1955
            Q+PY        ++ E +P G  +   +A+D +++    S   L     L + S        + GV  +  +++LDRE   ++ F ++A D     R +G T + + + D ND++P FE   +  +I+E   V   +  +  TD+D  +N  I+  +          Q+    IF +D     I    +  R  ++        S+   + A D         ++TA++++++L+ ND  P+        Q+        G   +  +A+++ +DAD   N                 +  R+ +   N   QFS+ +    D    +P   +S    ++++  Q    D   P  +N +  ++ + D NDN P+F    Y  Q +E++  N  V  N   + A D D   N ++TY I +  ++       +D + G +   +  D E++  ++F VVA D G P + S+SS++++ ++D NDN P F+  ++   V E+   G  +  + ATD D
Sbjct:  355 QSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSL-----LDSRSQSLFKVDSRTGV--VTTSASLDRELMDVHYFRVVATDDSFPPR-SGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSD--------SYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVP---EDQWGGTEDNTVAHIRATDADQGNN-----------------AAIRYAIIGGNTQSQFSIDSMSG-DVSLVKPLDYESVRSYRLVIRAQ----DGGSPSRSNTTQLLVNVIDANDNAPRF----YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN---FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD 822          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 145.976 bits (367), Expect = 8.767e-35
Identity = 164/604 (27.15%), Postives = 263/604 (43.54%), Query Frame = 3
Query:  420 QSNFIRVFVD--DENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSD-FELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQD-GGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQF-SLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKT-STITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFR 2207
            +SN  ++ V+  D NDN P F   Q    ++ EN P+GY I   +A D D           E+ + +    D F LA   + G  ++     LDRE+   + F ++A DG    + +  + + I ++D+NDN P F    Y   + E+     P+  +  TD DED     ++   N+   +        I  Q+    +  +    +LDY+Q    F   + A D GGR   S TAT+ I I + N+ +P      N       F  ++  +   +L  V  +D+D  +N Q+  SL    N   I       P +I  Q  ++ T   +DRE    +L+      TV   D  N   L+    + I + DVNDN P F   +Y   I E+       +  A  A+D D+ LNG++ Y + D      +  F ID  +G I  ++  D E  +++    +A D+G P  LSS+  + +R++D ND+ P F+      +V EN  +G ++G+I+A D D          I+  D  N  S +        Q+ T   +D E T       V + +P      L  +A I I V D+ND+ P  R
Sbjct:  669 RSNTTQLLVNVIDANDNAPRFYTSQFQE-SVLENVPVGYNIIRVQAYDSDEGA------NAEITYSISERDDNFPLAVDPRTG--WVQTIKPLDREEQGRFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFA-------ITSQN---GRGLITIAQSLDYKQ-EKRFLLTVAATDSGGR---SDTATVHINITDANNFAP---IFENAPYSASVF--EDAPVGTTVLV-VSATDSDVGVNAQITYSL----NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLL------TVTAKDGGNP-SLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVA--ASDPDVGLNGRIKYLLSDRDIEDGS--FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP-LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP-----LRNDAHIEILVTDVNDNAPVLR 1221          

HSP 2 Score: 139.428 bits (350), Expect = 8.544e-33
Identity = 164/613 (26.75%), Postives = 262/613 (42.74%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLE-LPFKLGNSSDFELAKHFKDGVPYLIIT-STLDREKTSMYTFTLIAID--GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIV----DPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAY----VQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNI-YKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNT-NASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGK--IYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQN--RASKLITLDPLTGQIRTRYPIDREKTSTITFFVESK---NPSRIFNDLIQEAMIVITVRDLNDSPPTFR 2207
            ++V V D ND++P F   Q    +I E   +G  +   +A D D    +   Y +E +    G + D E+     D    +I T S+LDRE +  Y   + A D    +  R T    + +K+ D NDN P+F    Y   + E+       + +  I  TD D+  N  I   +     +     F++D        +   V  +  LDYE +  S+   I AQDGG  S S+T  L + +++ ND +P  RF  +  Q        E  L N  + Y    VQ  D+D   N              I E     P+ +  +   ++T + +DRE    F          Q    D  +P  + ++S+ I + DVNDN P F    Y   + E+               D+D  L+ ++T         +    F I SQNG+  I  +QS D+++E  +   V ATD G     S ++T+ + I D N+ AP F  + ++  V E+  +G  +  ++ATD D +  +  I + +  +S N   +    +++P TG I T  P+DRE TS     V +K   NPS     L     + I V D+ND+ P F+
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFE-ASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ---SQFSID-------SMSGDVSLVKPLDYESV-RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAP--RFYTSQFQ--------ESVLENVPVGYNIIRVQAYDSDEGANA--------EITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRF--------AFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT-------TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG---RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD-VGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS-----LSDTTDVEIGVTDVNDNAPAFK 1008          

HSP 3 Score: 125.561 bits (314), Expect = 1.775e-28
Identity = 130/492 (26.42%), Postives = 225/492 (45.73%), Query Frame = 3
Query:  768 TEITIKIR-DINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDED-ENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAIN---NLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNI-YKQFSLRTTQNIDREANEPF--LIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQI-EENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLK 2213
            T+I  ++R ++ + +P FE+ +Y+ ++ E     P    + T    D E+  +   M          +  LD   QS+ KV ++   +    +LD E L     F++VA D      S T TL++ +L+ ND SP        +Q     SI EG      +  ++ +D D   N +++  +    +   + + +      I  +   + T  ++DRE ++ +  L+ +  + + Q +           AS+ + + D NDN P+F++  Y  Q+ E+     E    A I A D D   N  + Y I      S    F IDS +G +   +  D+E    Y  ++ A D G P+R S+++ ++V + D NDNAP+F  S F   V ENV +G+ I ++ A D D     +    I  S S+   +  + +DP TG ++T  P+DRE+     F V +K+           + +VITV+D+ND+ P F  K
Sbjct:  342 TDIARRVRRELRNQSPYFEQALYVASVLEE---QPAGAAVTTVRARDPEDSPVVYSM----------VSLLDSRSQSLFKVDSRTGVVTTSASLDRE-LMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTF----EAEQFEA--SIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERR------TATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQ---FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR-SNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAE----ITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGG--VPPKSASSSVVITVQDVNDNDPAFNPK 797          

HSP 4 Score: 99.3673 bits (246), Expect = 1.706e-20
Identity = 118/517 (22.82%), Postives = 225/517 (43.52%), Query Frame = 3
Query:  486 QTPY-------CTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMH------NSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQD---GGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPV---NIYKQFSLRTTQNIDREANEPFLIDS----KIIVTVQCDDYDNEIPLNTNASIFII-INDVNDNPPKFTQNVYYGQIEENI-NNHEVFMN-AAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRD 1955
            Q+PY        ++ E +P G  +   +A+D +++    S   L     L + S        + GV  +  +++LDRE   ++ F ++A D     R +G T + + + D ND++P FE   +  +I+E   V   +  +  TD+D  +N  I+  +          Q+    IF +D     I    +  R  ++        S+   + A D         ++TA++++++L+ ND  P+        Q+        G   +  +A+++ +DAD   N                 +  R+ +   N   QFS+ +    D    +P   +S    ++++  Q    D   P  +N +  ++ + D NDN P+F    Y  Q +E++  N  V  N   + A D D   N ++TY I +  ++       +D + G +   +  D E++  ++F VVA D G P + S+SS++++ ++D NDN P F+  ++   V E+   G  +  + ATD D
Sbjct:  355 QSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSL-----LDSRSQSLFKVDSRTGV--VTTSASLDRELMDVHYFRVVATDDSFPPR-SGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSD--------SYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVP---EDQWGGTEDNTVAHIRATDADQGNN-----------------AAIRYAIIGGNTQSQFSIDSMSG-DVSLVKPLDYESVRSYRLVIRAQ----DGGSPSRSNTTQLLVNVIDANDNAPRF----YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN---FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPK-SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD 822          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Zebrafish
Match: pcdh1gc6 (protocadherin 1 gamma c 6 [Source:ZFIN;Acc:ZDB-GENE-041118-17])

HSP 1 Score: 224.942 bits (572), Expect = 1.332e-60
Identity = 199/633 (31.44%), Postives = 310/633 (48.97%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIE--ENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE--QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN-INNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSS--NAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF--------SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN 2120
            L V+ +IDRE LCP               +   ++  Q+   N  +Q + + + + D NDN P+F   QT    +E  E+  LG R PL  A+DLD    S+ SY L       N   F L  K   DG  VP L+I   LDREK S +   L A+DG +  + TG T I I + D NDNAPKF+ P+Y  +++E   V   +  I  TD DE +NG +   +     E + K+F L            ++  + N+DYE  +LY    F + A+D G   L   ++++I I++ ND  PEI    +   +    S+  GT    ++A + V D DS +N      ++P     ++ S   H       +SL T  ++DRE    + I   ++V       D+ +P L T  +I + + DVNDNPP F+Q  Y   ++EN +    +F   ++ A D D   N  +TY I D  ++    + YF I+S+NG IY+  SFD+EK  + S +V A DQG P+ LSS++T+ V I D+NDNAP          S SH    +  + + GHL+ ++ A D DS   H    F   +++ +  + L +++  TG++RT+  +     S+    +E K+
Sbjct:   90 LVVNSRIDRESLCP--------------QSASCVVPLQVIIENP-LQLHRVEIEIQDINDNAPIF---QTSEGVLEIAESITLGDRFPLESAEDLDVGKNSLKSYVLS------NDECFRLNVKTLADGRKVPELVIDKPLDREKKSAHKLILTAVDGGDPAK-TGTTVIQINVLDSNDNAPKFDLPMYKSSLREAAPVGSTVITIKATDLDEGDNGELQYFLGVHTPEPVRKMFALK-------PDTGEIIVLGNIDYESNKLYR---FDVSAKDKGNPELVGHSSVQIDIIDENDNPPEIILTSSPSPVPENASV--GT----VVALINVKDLDSGVNGRVSINISPGFPFTLKPSFENH-------YSLVTDSSLDREIYAEYNI---LLVAT-----DSGVPSLKTEKTINVKVLDVNDNPPSFSQTSYNVYVQENNLAGVSLF---SVSATDNDQDKNALLTYSILDLGSNQVPASSYFYINSENGTIYSMSSFDYEKMKLISIVVQAKDQGSPS-LSSNATVHVFILDRNDNAPAVIYPSTSMGSVSHQR--MPRSAKAGHLVTKVTAVDADS--GHNAWLFYRLAEATD--ASLFSVNLHTGEVRTKRAVSEHDDSSQRLVLEIKD 656          

HSP 2 Score: 73.1738 bits (178), Expect = 1.598e-12
Identity = 78/280 (27.86%), Postives = 117/280 (41.79%), Query Frame = 3
Query: 1389 IDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFII-INDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHK-------DIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            +DRE         K+I+T      D   P  T  ++  I + D NDN PKF   +Y   + E        +   I A D D   NG++ Y +           F +    G+I    + D+E   +Y F V A D+G+P  L   S++ + I D+NDN P+   +     V EN  +G ++  IN  D DS    +          F +K   +N  S L+T   L  +I   Y I       +    +S  PS     L  E  I + V D+ND+PP+F
Sbjct:  206 LDREKKSAH----KLILTA----VDGGDPAKTGTTVIQINVLDSNDNAPKFDLPMYKSSLREAAPVGSTVI--TIKATDLDEGDNGELQYFLGVHTPEPVRKMFALKPDTGEIIVLGNIDYESNKLYRFDVSAKDKGNP-ELVGHSSVQIDIIDENDNPPEIILTSSPSPVPENASVGTVVALINVKDLDSGVNGRVSINISPGFPFTLKPSFENHYS-LVTDSSLDREIYAEYNI-------LLVATDSGVPS-----LKTEKTINVKVLDVNDNPPSF 461          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Zebrafish
Match: pcdh1g26 (protocadherin 1 gamma 26 [Source:ZFIN;Acc:ZDB-GENE-050609-21])

HSP 1 Score: 224.172 bits (570), Expect = 5.147e-60
Identity = 199/633 (31.44%), Postives = 310/633 (48.97%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIE--ENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE--QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN-INNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSS--NAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF--------SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN 2120
            L V+ +IDRE LCP               +   ++  Q+   N  +Q + + + + D NDN P+F   QT    +E  E+  LG R PL  A+DLD    S+ SY L       N   F L  K   DG  VP L+I   LDREK S +   L A+DG +  + TG T I I + D NDNAPKF+ P+Y  +++E   V   +  I  TD DE +NG +   +     E + K+F L            ++  + N+DYE  +LY    F + A+D G   L   ++++I I++ ND  PEI    +   +    S+  GT    ++A + V D DS +N      ++P     ++ S   H       +SL T  ++DRE    + I   ++V       D+ +P L T  +I + + DVNDNPP F+Q  Y   ++EN +    +F   ++ A D D   N  +TY I D  ++    + YF I+S+NG IY+  SFD+EK  + S +V A DQG P+ LSS++T+ V I D+NDNAP          S SH    +  + + GHL+ ++ A D DS   H    F   +++ +  + L +++  TG++RT+  +     S+    +E K+
Sbjct:   90 LVVNSRIDRESLCP--------------QSASCVVPLQVIIENP-LQLHRVEIEIQDINDNAPIF---QTSEGVLEIAESITLGDRFPLESAEDLDVGKNSLKSYVLS------NDECFRLNVKTLADGRKVPELVIDKPLDREKKSAHKLILTAVDGGDPAK-TGTTVIQINVLDSNDNAPKFDLPMYKSSLREAAPVGSTVITIKATDLDEGDNGELQYFLGVHTPEPVRKMFALK-------PDTGEIIVLGNIDYESNKLYR---FDVSAKDKGNPELVGHSSVQIDIIDENDNPPEIILTSSPSPVPENASV--GT----VVALINVKDLDSGVNGRVSINISPGFPFTLKPSFENH-------YSLVTDSSLDREIYAEYNI---LLVAT-----DSGVPSLKTEKTINVKVLDVNDNPPSFSQTSYNVYVQENNLAGVSLF---SVSATDNDQDKNALLTYSILDLGSNQVPASSYFYINSENGTIYSMSSFDYEKMKLISIVVQAKDQGSPS-LSSNATVHVFILDRNDNAPAVIYPSTSMGSVSHQR--MPRSAKAGHLVTKVTAVDADS--GHNAWLFYRLAEATD--ASLFSVNLHTGEVRTKRAVSEHDDSSQRLVLEIKD 656          

HSP 2 Score: 72.7886 bits (177), Expect = 1.730e-12
Identity = 75/267 (28.09%), Postives = 113/267 (42.32%), Query Frame = 3
Query: 1428 KIIVTVQCDDYDNEIPLNTNASIFII-INDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHK-------DIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            K+I+T      D   P  T  ++  I + D NDN PKF   +Y   + E        +   I A D D   NG++ Y +           F +    G+I    + D+E   +Y F V A D+G+P  L   S++ + I D+NDN P+   +     V EN  +G ++  IN  D DS    +          F +K   +N  S L+T   L  +I   Y I       +    +S  PS     L  E  I + V D+ND+PP+F
Sbjct:  215 KLILTA----VDGGDPAKTGTTVIQINVLDSNDNAPKFDLPMYKSSLREAAPVGSTVI--TIKATDLDEGDNGELQYFLGVHTPEPVRKMFALKPDTGEIIVLGNIDYESNKLYRFDVSAKDKGNP-ELVGHSSVQIDIIDENDNPPEIILTSSPSPVPENASVGTVVALINVKDLDSGVNGRVSINISPGFPFTLKPSFENHYS-LVTDSSLDREIYAEYNI-------LLVATDSGVPS-----LKTEKTINVKVLDVNDNPPSF 461          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Zebrafish
Match: pcdh2ab9 (protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GENE-041118-8])

HSP 1 Score: 211.075 bits (536), Expect = 1.021e-55
Identity = 184/606 (30.36%), Postives = 296/606 (48.84%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFR-HPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQN-VYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAM--YFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP----QFSQSHFAFFVDE---NVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT 2060
            L+V ++IDREELC              I  C  +++ +I   N  ++ ++I V + D ND++P F   +     I EN  +G R  L  A+D D+   SV SYKL          D E+    +D +P+L++   LDRE  + +   L AIDG    R +G   IT+ + D+NDN P F   +Y  T+ ENV +   + +++ +D D   NG +         + I  IF+LD       ++  ++R    +D+E+  + ++  I A D G+  L++   + I+IL++ND  P I        ++      E +    +++ + V+D D+ IN ++ CSL         E   F   P      FSL T   +DRE    F I      T+   D   + PL++  ++ + ++DVNDNPP+F+ N V    IE N     +     + A DKDL+ N  ++Y I     S + +  +  ++S+ G +Y  +SFDFE    + F ++ATD G P+ LSS+ T+ V I DQNDN P      S +  A  V+E   NV  GHL+ ++ A D D +  +  + F ++  S++    L  LD  TGQIRT
Sbjct:   86 LRVQRKIDREELC------------DGIGAC--LINLKIVVENP-LEIHYIAVEITDVNDHSPTF-TEKEKRLEISENTLIGTRFQLQAARDPDSGVNSVRSYKL----SQNEHFDLEIRDRAEDKLPFLVLQKPLDRENKAEHYLILTAIDGGNPQR-SGTLNITVIVLDVNDNRPMFSHDVYSSTVHENVQLGTLVLKVMASDSDYGPNGEVSYSFGGDNSDNIFHIFSLD-------RITGEIRVTGEVDFEK-NNVYKLDIQAVDSGQPPLNTDCRVIIKILDLNDNKPTIEVTSLSNVVS------EDSKPGTLISLISVTDRDTGINGRVVCSLS--------EHVPFELKPSVQENMFSLVTKGKLDRETLSHFDI------TITATDL-GQPPLSSYKTLSVQVSDVNDNPPEFSLNPVELYMIENNAAGAPIL---TLSAFDKDLNENAIISYQIIKGNGSQSDLTSFLNVNSETGAVYALKSFDFETVKKFQFHILATDSGSPS-LSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDAD-IGYNGWLLFSLQEVSEH---SLFALDRYTGQIRT 633          

HSP 2 Score: 95.1301 bits (235), Expect = 2.326e-19
Identity = 107/376 (28.46%), Postives = 165/376 (43.88%), Query Frame = 3
Query: 1119 LRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDRE-ANEPFLIDSKIIVTVQCDDYDNEIPLNTNA-SIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMY-FRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRD---------SLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            + ++I +VND SP   F    +++     I E TL           D DS +N ++   L+      +E    R        F L   + +DRE   E +LI + I         D   P  +   +I +I+ DVNDN P F+ +VY   + EN+    + +   + A+D D   NG+V+Y      NS N  + F +D   G+I  +   DFEK ++Y   + A D G P  L++   +I++I D NDN P    +  +  V E+ + G LI  I+ TDRD         SL EH  + F +K   Q     L+T   L  +  + + I      TIT     + P   +  L       + V D+ND+PP F L
Sbjct:  121 IAVEITDVNDHSPT--FTEKEKRL----EISENTLIGTRFQLQAARDPDSGVNSVRSYKLSQNEHFDLE---IRDRAEDKLPF-LVLQKPLDRENKAEHYLILTAI---------DGGNPQRSGTLNITVIVLDVNDNRPMFSHDVYSSTVHENVQLGTLVLK--VMASDSDYGPNGEVSYSFGG-DNSDNIFHIFSLDRITGEIRVTGEVDFEKNNVYKLDIQAVDSGQP-PLNTDCRVIIKILDLNDNKPTIEVTSLSNVVSEDSKPGTLISLISVTDRDTGINGRVVCSLSEH--VPFELKPSVQENMFSLVTKGKLDRETLSHFDI------TITATDLGQPPLSSYKTL------SVQVSDVNDNPPEFSL 459          

HSP 3 Score: 85.1149 bits (209), Expect = 3.252e-16
Identity = 88/306 (28.76%), Postives = 142/306 (46.41%), Query Frame = 3
Query: 1371 LRTTQNIDRE----ANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITF---FVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFR-------LKDPSKSQLIISL 2246
            LR  + IDRE         LI+ KI+V         E PL  +  I + I DVND+ P FT+     +I EN      F   A  A D D  +N   +Y +   ++    +  R + +   +   +  D E ++ +  I+ A D G+P R S +  I V + D NDN P FS   ++  V ENV++G L+ ++ A+D D  P + ++ +    D+ +    + +LD +TG+IR    +D EK +        V+S  P      L  +  ++I + DLND+ PT         + + SK   +ISL
Sbjct:   86 LRVQRKIDREELCDGIGACLINLKIVV---------ENPLEIHY-IAVEITDVNDHSPTFTEKEKRLEISENTLIGTRFQLQA--ARDPDSGVNSVRSYKLSQNEHFDLEIRDRAEDKLPFLVLQKPLDRENKAEHYLILTAIDGGNPQR-SGTLNITVIVLDVNDNRPMFSHDVYSSTVHENVQLGTLVLKVMASDSDYGP-NGEVSYSFGGDNSDNIFHIFSLDRITGEIRVTGEVDFEKNNVYKLDIQAVDSGQPP-----LNTDCRVIIKILDLNDNKPTIEVTSLSNVVSEDSKPGTLISL 372          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Zebrafish
Match: pcdh17 (protocadherin 17 [Source:ZFIN;Acc:ZDB-GENE-090608-3])

HSP 1 Score: 211.846 bits (538), Expect = 1.521e-55
Identity = 196/634 (30.91%), Postives = 302/634 (47.63%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFV--RNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP----QFSQSHFA-FFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L  +D +S L  +KQ IDRE LC      + N  C         L  ++  N++E+    I+V + D NDN P FP  Q     I EN   G R PL  A D D     + +Y++       + S F L  K   DG   P L++  +LDRE+ S +T  + A DG E  + +G  +I +K+ D NDN+P FE+P Y+  I EN  +   I  +  TD DE  NG++         + I ++F++D     I K+Q ++      D+E+     E  + A+D G N +     + +++L+ ND  P I FV  R G       ++ E      ++A V+V+D DS  N QLQC +L   N+       F+   N    +++ T + +DRE  + + I      T+   D  N  PLN+  S  + I D NDN P+FT+ VY  Q+ EN    E     ++ A D DL  NG V+Y +   +    S   Y  I   +G IY  +SF++E+   + F V A D G+P+ L S++T+ V + D NDN P       Q+  A   V  NV +GH+I  + A D D   E   + + +   S      L  +D +TG++RT  P+  E T  +   ++
Sbjct:   64 LIDVDPESGLLYTKQRIDRETLC------RQNSKCQ--------LSMEVFANDKEI--CMIKVEIQDINDNAPSFPSEQIDI-DISENAAPGTRFPLAAAYDPDTKENGLKTYQI----TRDDYSIFSLDVKSRGDGTKFPELVVQRSLDREERSHHTLIITATDGGEYPK-SGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCYVPDRIKELFSIDPRTGVI-KIQGKI------DFEE-NPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQG-------AVSEAATPGTVIALVRVTDKDSGRNGQLQCRILG--NV------PFKLEENYDNFYTVVTDRPLDREVKDEYNI------TIVAKDNGNP-PLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYL--GSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPH-LESNTTVRVSVLDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGHIITTVRAVDND-FGESGRLTYEI---SDGNEEHLFEIDSVTGEVRTAQPLWEEVTPVVELIIK 638          

HSP 2 Score: 92.8189 bits (229), Expect = 1.514e-18
Identity = 129/490 (26.33%), Postives = 205/490 (41.84%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN---QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQD---FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRF--IVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I ++I+DINDNAP F        I EN      F +    D D  ENG   LK +   ++  + IF+LD+  +  G    ++    +LD E+  H     I A DGG    S T  + +++ + ND SP        +Q +    I E      ++  +  +D+D  IN       S   P  I  +     R  V       ++    ID E N    ID      VQ  D   N IP +   ++ ++  D NDN P      V  G + E      V   A +   DKD   NG++   I     FK   N   F        +   +  D E +  Y+  +VA D G+P  L+S+ +  V+I D+NDNAP+F++  +   V EN   G  +G + A D D L ++  + +  +  + S+   +  + + P  G I      + E+T    F V++K+       L     + ++V D+ND+ P   L
Sbjct:  108 IKVEIQDINDNAPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTKENG---LKTYQITRDDYS-IFSLDVKSRGDGTKFPELVVQRSLDREERSH-HTLIITATDGGEYPKSGTMQINVKVTDSNDNSPVF------EQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCYVPDRIKELFSIDPRTGV-------IKIQGKIDFEENPIIEID------VQAKDQGPNPIPGHCKVTVKVL--DRNDNWPSIGFVAVRQGAVSEAATPGTVI--ALVRVTDKDSGRNGQLQCRILGNVPFKLEENYDNFYT------VVTDRPLDREVKDEYNITIVAKDNGNP-PLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYLGSVLAHDPD-LGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPH--LESNTTVRVSVLDVNDNIPVIVL 559          

HSP 3 Score: 84.7297 bits (208), Expect = 4.908e-16
Identity = 88/312 (28.21%), Postives = 137/312 (43.91%), Query Frame = 3
Query: 1371 LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQ---------DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICES 2279
            L T Q IDRE       +SK  ++++    D EI +     I + I D+NDN P F        I EN      F  AA  A D D   NG  TY I          D K+  +   F       ++   +S D E+ S ++ I+ ATD G   + S +  I V++ D NDN+P F Q  +   + EN  +G +I  +NATD D    +  + +       +R  +L ++DP TG I+ +  ID E+   I   V++K+     N +     + + V D ND+ P+            I    ++QG + E+
Sbjct:   74 LYTKQRIDRETL--CRQNSKCQLSMEVFANDKEICM-----IKVEIQDINDNAPSFPSEQIDIDISENAAPGTRFPLAA--AYDPDTKENGLKTYQITRDDYSIFSLDVKSRGDGTKFP------ELVVQRSLDREERSHHTLIITATDGGEYPK-SGTMQINVKVTDSNDNSPVFEQPSYVVEIPENAPLGTVIIDLNATDSDEG-INGQVTYSFSCYVPDRIKELFSIDPRTGVIKIQGKIDFEENPIIEIDVQAKDQGP--NPIPGHCKVTVKVLDRNDNWPS------------IGFVAVRQGAVSEA 354          

HSP 4 Score: 78.9518 bits (193), Expect = 2.971e-14
Identity = 129/493 (26.17%), Postives = 211/493 (42.80%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIE--ENKPLGYRIPLPKAQDLDNA-----TFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEG-NRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP---IFQILVTDEDEDENGRIDLKMHNSG----QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQ----FSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEE-----NINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVR 1838
            I V V D NDN+PVF   + P   +E  EN PLG  I    A D D       T+S S Y   +P ++      +     + GV  + I   +D E+  +    + A D  +G N   G  ++T+K+ D NDN P     + +R    +    P   I  + VTD+D   NG++  ++  +     +E  +  +T+ + D+ + +              ++   +   IVA+D G   L+ST +  ++IL+ ND +P  RF +    +     + E  +  + L  V   D D   N      L P N+   EES   + VNI       ++LR+    + E  + F  D K    VQ  D  N   L +N ++ + + DVNDN P     +      E     N+    +     + A D D   +G++TY I D    +    F IDS  G++  +Q    E   +   I+  TD G P+ LS+ + +IV+
Sbjct:  219 INVKVTDSNDNSPVF---EQPSYVVEIPENAPLGTVIIDLNATDSDEGINGQVTYSFSCY---VPDRIKELFSIDP----RTGV--IKIQGKIDFEENPIIEIDVQAKD--QGPNPIPGHCKVTVKVLDRNDNWPSIGF-VAVRQGAVSEAATPGTVIALVRVTDKDSGRNGQLQCRILGNVPFKLEENYDNFYTV-VTDRPLDR--------------EVKDEYNITIVAKDNGNPPLNSTKSFTVKILDENDNAP--RFTK----MVYLLQVPENNIPGEYLGSVLAHDPDLGQNGTVSYSLLPSNVS--EESITTY-VNIKPTDGAIYALRS---FNYEQTKYF--DFK----VQAKDSGNPH-LESNTTVRVSVLDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGHII--TTVRAVDNDFGESGRLTYEISD---GNEEHLFEIDSVTGEVRTAQPLWEEVTPVVELIIKVTDHGKPS-LSAMAKLIVK 656          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Zebrafish
Match: CR774179.7 (protocadherin gamma-C5-like [Source:NCBI gene;Acc:103911742])

HSP 1 Score: 208.764 bits (530), Expect = 2.756e-55
Identity = 183/628 (29.14%), Postives = 307/628 (48.89%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVD--DENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL--AKHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQIL-VTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQD--FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQ--FSQSHFAFFVDE----NVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN 2120
            L V++ IDRE            K+CG    C  +L  Q+     E    F RV VD  D NDN+P F +  T +  + E    G R  L  AQD D  + S+ +Y L       N +D+ +   K+ KDG  VP +++   LDREK S+    L+ IDG +   ++G T+IT+++ D+NDNAP FE+ +Y   + EN     I QI+   D D+  N  I+  + +   E +  +F       SI     +++   +LDYE +  +++  I A+D G   +     +++ +L+VND +PEI    + + +       E   +  ++A + V D DS IN           +L++ ++ F+        ++L T   +DRE    + I+ K              PL ++  I + I DVNDNPP F++ VY   I+EN     +   A++ A+D D   N K+ Y + D   ++   + Y  I+++NG I++  SFD+EK  ++  IV+A DQG    LSS++T+ V I DQNDNAP   +  +      ++    + + GHL+ ++ A D DS   H    F   +++ +  + L +++  TG++RT+  +     S+    +E K+
Sbjct:   84 LLVNELIDRE------------KLCGQSARC--VLPLQVII---EDPLQFYRVDVDIQDINDNSPSF-LSDTKFIDVSETTLTGARFRLEPAQDADVGSNSLRTYAL-------NKNDYFILQVKNDKDGTKVPEIVLQKALDREKQSIEHLILMGIDGGDP-ASSGTTQITVRVLDVNDNAPVFEQDLYEIKVMENAAPGTIIQIVKAIDLDDGLNSEIEYSLGSDTPETLKNLF-------SINSNTGELKISKSLDYE-MSTTYKIDIRARDKGGPVMEGHCRVQVNVLDVNDNAPEIIITSSPKPVR------EDAPAGTMVALINVKDLDSGING-------NVTLLILSDTPFKLKPTFANHYALVTDSKLDREKFPKYDIELKA-------SDSGSPPLVSSKLITVNILDVNDNPPVFSERVYSVYIKENSAPGSIL--ASVTASDLDTGENAKIVYSVIDTNTRDVPVSSYVYINAENGSIFSMHSFDYEKIKVFHVIVLAKDQGS-QSLSSNATVHVFILDQNDNAPAVIYPSTSMGSVSNQRMPRSAKAGHLVTKVTAVDADS--GHNAWLFYRLAEATD--ASLFSVNLHTGEVRTKRAVSEHDDSSQRLVIEIKD 650          

HSP 2 Score: 76.6406 bits (187), Expect = 1.222e-13
Identity = 89/364 (24.45%), Postives = 160/364 (43.96%), Query Frame = 3
Query: 1125 IQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNAS-IFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTG---QIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + I ++ND SP   F+ + + I     + E TL+          DAD   N L+   L   +  +++    ++  +  K   +   + +DRE      I+  I++ +   D     P ++  + I + + DVNDN P F Q++Y  ++ EN     +     + A D D  LN ++ Y +      +    F I+S  G++  S+S D+E  + Y   + A D+G P  +     + V + D NDNAP+   +     V E+   G ++  IN  D DS   + ++  ++ SD+  +      L P       + T   +DREK     + +E K        L+   +I + + D+ND+PP F
Sbjct:  121 VDIQDINDNSPS--FLSDTKFI----DVSETTLTGARFRLEPAQDADVGSNSLRTYALNKNDYFILQ---VKNDKDGTKVPEIVLQKALDREKQS---IEHLILMGIDGGD-----PASSGTTQITVRVLDVNDNAPVFEQDLYEIKVMENAAPGTIIQ--IVKAIDLDDGLNSEIEYSLGSDTPETLKNLFSINSNTGELKISKSLDYEMSTTYKIDIRARDKGGP-VMEGHCRVQVNVLDVNDNAPEIIITSSPKPVREDAPAGTMVALINVKDLDS-GINGNVTLLILSDTPFK------LKPTFANHYALVTDSKLDREKFPK--YDIELKASDSGSPPLVSSKLITVNILDVNDNPPVF 455          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Xenopus
Match: pcdh10 (protocadherin 10 [Source:NCBI gene;Acc:779938])

HSP 1 Score: 209.534 bits (532), Expect = 7.057e-55
Identity = 202/656 (30.79%), Postives = 306/656 (46.65%), Query Frame = 3
Query:  282 LKVSKQIDREELCP--PQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVD--DENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGVPY--LIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRI--DLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQ--DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNA-----PQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSP 2195
            L V+++IDRE++C   P  ML L                       E    F RV ++  D NDN PVFP        I E+   G R PL  A DLD    S+ +Y++        +S F L  +   DG  +  L++   LDRE+ +++ + L AIDG    R TG   +TIK+ D NDN P FE+ IY  ++ EN      + Q+  TD+DE +NG +      HNS +  +  IF +D           ++  I  LDYE    S++  + A+D G N++     + +++L++ND  PEI F       T   S+ E      ++A   V+D DS  N Q+ C +L         +  FR  ++    +++ T   +DREA   +       VTV   D     PL++  SI + + DVNDN P+FTQ +Y   + EN N    ++ +A+ A DKD   N  ++Y+I   D +  S   Y  I+S+NG +Y  ++FD+E+   +SF+V A D G P  LSS++T+ + I DQNDNA     PQ        F+    E G+L  ++ A D D   E ++ R        N  S L  +D  TG++RT   I              ++P R F        +V+ VRD    P
Sbjct:   71 LYVNEKIDREQICKQNPSCMLHLEVFL-------------------ENPLEFFRVEIEVLDINDNPPVFPQSDI-QVEISESATPGTRFPLESAYDLDVGNNSLRTYEIT------TNSYFNLDVQTQGDGNKFAELVLKKQLDREQQALHRYVLTAIDGGTPQR-TGTALLTIKVLDSNDNVPVFEQQIYTVSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPK--VRDIFGID-------PRTGRIEIIGELDYED-SGSYQVYVQAKDLGPNAVPVHCKVLVKVLDLNDNPPEISFS------TVKESVSESASPGTVVALFSVTDRDSEENGQIHCEILG--------DVPFRLKLSYKNYYTIVTEGTLDREAMATY------TVTVLARDRGTP-PLSSTKSIQVQVADVNDNSPRFTQAIYNVYVIEN-NVPGAYI-SAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTFDYEQLKDFSFMVEARDGGTPP-LSSNATVNIIIVDQNDNAPAIVSPQGRNGTAKEFLPRTAEPGYLFTRVVAVDSD---EGENARLTYSILRGNDMS-LFRMDWRTGELRTARKI-----------TNKRDPHRPFE-------LVVEVRDHGQPP 643          

HSP 2 Score: 89.3521 bits (220), Expect = 2.480e-17
Identity = 118/486 (24.28%), Postives = 205/486 (42.18%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSG----QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQ-LYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRAS-KLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPT 2201
            + I++ DINDN P F +      I E+      F +             DL + N+     +   N  F LD+  Q  G   A++     LD EQ   H   + + A DGG    + TA L I++L+ ND  P        QQI    S+ E +    ++  +  +D D   N       +  N   + +     P    +   +     +D E +  +       V VQ  D   N +P++    + + + D+NDNPP+ + +     + E+ +   V   A     D+D   NG++  H +   +    + FR+       Y      + D E  + Y+  V+A D+G P  LSS+ +I V++ D NDN+P+F+Q+ +  +V EN   G  I  ++ATD+D         +I++ D Q  +    ++++   G +      D E+    +F VE+++       L   A + I + D ND+ P 
Sbjct:  106 VEIEVLDINDNPPVFPQSDIQVEISESATPGTRFPL---------ESAYDLDVGNNSLRTYEITTNSYFNLDVQTQGDGNKFAELVLKKQLDREQQALH--RYVLTAIDGGTPQRTGTALLTIKVLDSNDNVPVFE-----QQIYT-VSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPKVRDIFGIDP----RTGRIEIIGELDYEDSGSYQ------VYVQAKDLGPNAVPVH--CKVLVKVLDLNDNPPEISFSTVKESVSESASPGTVV--ALFSVTDRDSEENGQI--HCEILGD----VPFRLKLSYKNYYTIVTEGTLDREAMATYTVTVLARDRGTPP-LSSTKSIQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTFDYEQLKDFSFMVEARDGGT--PPLSSNATVNIIIVDQNDNAPA 551          

HSP 3 Score: 54.6842 bits (130), Expect = 9.344e-7
Identity = 66/242 (27.27%), Postives = 108/242 (44.63%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIR-TIKENV--IVDPIF---QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILN 1139
            I+V V D NDN+P F         IE N P  Y   +      +    ++S Y LE   + G S    ++ + ++G  YL    T D E+   ++F + A DG     ++  T + I I D NDNAP    P     T KE +    +P +   +++  D DE EN R+   +            +L  +D   G+++   +  N  D    +  FE  +  +D G+  LSSTA +++QI++
Sbjct:  428 IQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQ-GMSVFTYVSINSENG--YLYALRTFDYEQLKDFSFMVEARDGGTPPLSSNAT-VNIIIVDQNDNAPAIVSPQGRNGTAKEFLPRTAEPGYLFTRVVAVDSDEGENARLTYSILRGND------MSLFRMDWRTGELRTARKITNKRD---PHRPFELVVEVRDHGQPPLSSTALIQVQIVD 656          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Xenopus
Match: pcdh10 (protocadherin 10 [Source:NCBI gene;Acc:779938])

HSP 1 Score: 209.149 bits (531), Expect = 8.647e-55
Identity = 199/654 (30.43%), Postives = 303/654 (46.33%), Query Frame = 3
Query:  282 LKVSKQIDREELCP--PQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVD--DENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGVPY--LIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQ--DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNA-----PQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSP 2195
            L V+++IDRE++C   P  ML L                       E    F RV ++  D NDN PVFP        I E+   G R PL  A DLD    S+ +Y++        +S F L  +   DG  +  L++   LDRE+ +++ + L AIDG    R TG   +TIK+ D NDN P FE+ IY  ++ EN      + Q+  TD+DE +NG +     +     +  IF +D           ++  I  LDYE    S++  + A+D G N++     + +++L++ND  PEI F       T   S+ E      ++A   V+D DS  N Q+ C +L         +  FR  ++    +++ T   +DREA   +       VTV   D     PL++  SI + + DVNDN P+FTQ +Y   + EN N    ++ +A+ A DKD   N  ++Y+I   D +  S   Y  I+S+NG +Y  ++FD+E+   +SF+V A D G P  LSS++T+ + I DQNDNA     PQ        F+    E G+L  ++ A D D   E ++ R        N  S L  +D  TG++RT   I              ++P R F        +V+ VRD    P
Sbjct:   71 LYVNEKIDREQICKQNPSCMLHLEVFL-------------------ENPLEFFRVEIEVLDINDNPPVFPQSDI-QVEISESATPGTRFPLESAYDLDVGNNSLRTYEIT------TNSYFNLDVQTQGDGNKFAELVLKKQLDREQQALHRYVLTAIDGGTPQR-TGTALLTIKVLDSNDNVPVFEQQIYTVSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPKVRDIFGID-------PRTGRIEIIGELDYED-SGSYQVYVQAKDLGPNAVPVHCKVLVKVLDLNDNPPEISFS------TVKESVSESASPGTVVALFSVTDRDSEENGQIHCEILG--------DVPFRLKLSYKNYYTIVTEGTLDREAMATY------TVTVLARDRGTP-PLSSTKSIQVQVADVNDNSPRFTQAIYNVYVIEN-NVPGAYI-SAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTFDYEQLKDFSFMVEARDGGTPP-LSSNATVNIIIVDQNDNAPAIVSPQGRNGTAKEFLPRTAEPGYLFTRVVAVDSD---EGENARLTYSILRGNDMS-LFRMDWRTGELRTARKI-----------TNKRDPHRPFE-------LVVEVRDHGQPP 643          

HSP 2 Score: 89.3521 bits (220), Expect = 2.301e-17
Identity = 118/486 (24.28%), Postives = 203/486 (41.77%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSG----QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQ-LYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRAS-KLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPT 2201
            + I++ DINDN P F +      I E+      F +             DL + N+     +   N  F LD+  Q  G   A++     LD EQ   H   + + A DGG    + TA L I++L+ ND  P        QQI    S+ E +    ++  +  +D D   N       +  N   + +     P    +   +     +D E +  +       V VQ  D   N +P++    + + + D+NDNPP+ + +     + E+ +   V   A     D+D   NG++   I         + FR+       Y      + D E  + Y+  V+A D+G P  LSS+ +I V++ D NDN+P+F+Q+ +  +V EN   G  I  ++ATD+D         +I++ D Q  +    ++++   G +      D E+    +F VE+++       L   A + I + D ND+ P 
Sbjct:  106 VEIEVLDINDNPPVFPQSDIQVEISESATPGTRFPL---------ESAYDLDVGNNSLRTYEITTNSYFNLDVQTQGDGNKFAELVLKKQLDREQQALH--RYVLTAIDGGTPQRTGTALLTIKVLDSNDNVPVFE-----QQIYT-VSLPENSPPGTMVIQLNATDQDEGQNGEVVYSFSSHNSPKVRDIFGIDP----RTGRIEIIGELDYEDSGSYQ------VYVQAKDLGPNAVPVH--CKVLVKVLDLNDNPPEISFSTVKESVSESASPGTVV--ALFSVTDRDSEENGQIHCEIL------GDVPFRLKLSYKNYYTIVTEGTLDREAMATYTVTVLARDRGTPP-LSSTKSIQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQGMSVFTYVSINSENGYLYALRTFDYEQLKDFSFMVEARDGGT--PPLSSNATVNIIIVDQNDNAPA 551          

HSP 3 Score: 54.6842 bits (130), Expect = 9.757e-7
Identity = 66/242 (27.27%), Postives = 108/242 (44.63%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIR-TIKENV--IVDPIF---QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILN 1139
            I+V V D NDN+P F         IE N P  Y   +      +    ++S Y LE   + G S    ++ + ++G  YL    T D E+   ++F + A DG     ++  T + I I D NDNAP    P     T KE +    +P +   +++  D DE EN R+   +            +L  +D   G+++   +  N  D    +  FE  +  +D G+  LSSTA +++QI++
Sbjct:  428 IQVQVADVNDNSPRFTQAIYNVYVIENNVPGAYISAVSATDKDEEENANISYYILECDIQ-GMSVFTYVSINSENG--YLYALRTFDYEQLKDFSFMVEARDGGTPPLSSNAT-VNIIIVDQNDNAPAIVSPQGRNGTAKEFLPRTAEPGYLFTRVVAVDSDEGENARLTYSILRGND------MSLFRMDWRTGELRTARKITNKRD---PHRPFELVVEVRDHGQPPLSSTALIQVQIVD 656          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Xenopus
Match: PCDH17 (protocadherin 17 [Source:NCBI gene;Acc:100485388])

HSP 1 Score: 203.756 bits (517), Expect = 7.579e-53
Identity = 193/638 (30.25%), Postives = 295/638 (46.24%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL----AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILV----TDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP-----QFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L  +D DS +  +KQ IDRE LC      QL+               ++  N++E+    I+V + D NDN+P FP  Q     I EN   G R PL  A D D     + +Y +          DF L     K   DG   P L+I   LDRE+ S +   L A+DG +  R +   +I +K+ D NDN+P FE   Y+  I EN    P+ +I++    TD DE  NG +         + I ++F++D      G +Q +     NLDYE+     E  + A+D G N +     + +++++ ND +P I FV   Q      +I E      ++A V+V+D DS  N QL C +L   N+       F+   N    +++ T + +DRE      I  +  VT+   D +   PLN+  S  + I D NDNPP FT+ +Y  Q+ EN    E     ++ A D DL  NG V+Y I      + S   +  ++  NG IY  +SF++E+   + F V+A D G P+ L S++T+ V + D NDNAP               V  NV +G+LI  + A D D     +    IV  +  +    L  +D +TG+I+T  P   E +  +   ++
Sbjct:   65 LLDVDQDSGVLYTKQRIDRESLCRRSPKCQLS--------------LEVFANDKEI--CMIKVDILDINDNSPNFPSEQIDI-DISENASPGTRFPLTSAHDPDAGENGLKTYVI-------TRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILTALDGGDPPR-SATIQINVKVIDSNDNSPVFEALSYMVEIPEN---SPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSID---SKTGIIQVK----GNLDYEE-NGLIEIDVQARDQGPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQG-----AISEAAPPGTVIALVRVTDKDSGKNGQLICRVLG--NV------PFKLEENYDNLYTVVTDRPLDRE------IQDEYNVTIIARD-NGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYL--GSVLAQDPDLGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPH-LESNATVRVSVLDVNDNAPVICLPTLQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIVYGNEDH----LFEIDSVTGEIKTLTPYWDEVSPVVELVIK 639          

HSP 2 Score: 91.6633 bits (226), Expect = 5.303e-18
Identity = 144/582 (24.74%), Postives = 242/582 (41.58%), Query Frame = 3
Query:  591 KLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIK--------------IRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQ---LQCSLLTPRNILMIEESRFRHPVNI-YKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRAS--KLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQ 2258
            KL +P + G  S+F +    ++  P+L     LD ++ S   +T   ID     R + K +++++              I DINDN+P F        I EN      F +    D D  ENG   LK +   ++    +F+LD+  +  G    ++     LD E+  H  +  + A DGG    S+T  + +++++ ND SP        + ++    I E +   +I+  +  +DAD   N       S   P         R R   +I  K   ++   N+D E N    ID      VQ  D   N IP +   ++ +I  D NDN P  +  +V  G I E      V   A +   DKD   NG++   +         + F+++     +Y     +  D E +  Y+  ++A D G P  L+S+ +  V+I D+NDN P F+++ +   V EN   G  +G + A D D L  +  + + +        S    ++++P  G I      + E+T    F V +K+       L   A + ++V D+ND+ P            +I L TLQ
Sbjct:   43 KLGIPER-GRKSNFRV---LENSAPHL-----LDVDQDSGVLYTKQRIDRESLCRRSPKCQLSLEVFANDKEICMIKVDILDINDNSPNFPSEQIDIDISENASPGTRFPLTSAHDPDAGENG---LKTYVITRDDFG-LFSLDVKSRGDGTKFPELVIQKELDREEQSH-HKLILTALDGGDPPRSATIQINVKVIDSNDNSPVF------EALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAP--------DRIRELFSIDSKTGIIQVKGNLDYEENGLIEID------VQARDQGPNPIPKHCKVTVKVI--DKNDNAPSISFVSVRQGAISEAAPPGTVI--ALVRVTDKDSGKNGQLICRVL------GNVPFKLEENYDNLYTVVTDRPLDREIQDEYNVTIIARDNGSP-PLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYLGSVLAQDPD-LGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPH--LESNATVRVSVLDVNDNAP------------VICLPTLQ 564          

HSP 3 Score: 79.7221 bits (195), Expect = 2.348e-14
Identity = 86/311 (27.65%), Postives = 142/311 (45.66%), Query Frame = 3
Query: 1371 LRTTQNIDREA---NEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQN-GKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIP 2285
            L T Q IDRE+     P     K  ++++    D EI +     I + I D+NDN P F        I EN +    F   + H  D D   NG  TY I   DF   S  +  R D     ++   +  D E++S +  I+ A D G P R S++  I V++ D NDN+P F    +   + EN  +G ++  +NATD D    + ++ +     + +R  +L ++D  TG I+ +  +D E+   I   V++++     N + +   + + V D ND+ P+            IS  +++QG I E+ P
Sbjct:   75 LYTKQRIDRESLCRRSP-----KCQLSLEVFANDKEICM-----IKVDILDINDNSPNFPSEQIDIDISENASPGTRFPLTSAH--DPDAGENGLKTYVITRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILTALDGGDPPR-SATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADE-GSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYEENGLIEIDVQARDQGP--NPIPKHCKVTVKVIDKNDNAPS------------ISFVSVRQGAISEAAP 357          

HSP 4 Score: 70.0922 bits (170), Expect = 1.968e-11
Identity = 132/557 (23.70%), Postives = 228/557 (40.93%), Query Frame = 3
Query:  252 GLFILDSDS--------NLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNAT-----FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGK-TEITIKIRDINDNAPKFERPIYIRTIKENVIVDP------IFQILVTDEDEDENGRIDLKMHNSG----QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKF---TQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVR 1838
            GLF LD  S         L + K++DREE    +++L               LD      +  +Q   I V V D NDN+PVF  +      I EN PLG  +    A D D  +     +S S Y  +   +L        +   K G+  + +   LD E+  +    + A D  +G     K  ++T+K+ D NDNAP     I   ++++  I +       I  + VTD+D  +NG++  ++  +     +E  + ++T+ + D+ + +              ++   +   I+A+D G   L+ST +  ++IL+ ND  P         Q++      E  +  + L  V   D D   N      + P ++           V+IY   S+  T N    A   F  +       +    D+  P L +NA++ + + DVNDN P     T      +I    N    ++   + A D D   +G++TY I  + N  +   F IDS  G+I     +  E   +   ++  TD G P+ LS+ + +I++
Sbjct:  168 GLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILT-------------ALDGGDPPRSATIQ---INVKVIDSNDNSPVFEALSY-MVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIREL-------FSIDSKTGI--IQVKGNLDYEENGLIEIDVQARD--QGPNPIPKHCKVTVKVIDKNDNAPS----ISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRVLGNVPFKLEENYDNLYTV-VTDRPLDR--------------EIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVS------ENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHV---------GDVSIYTFVSVNPT-NGAIYALRSFNYEQTKYFEFKVLAKDSGSPHLESNATVRVSVLDVNDNAPVICLPTLQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIV-YGNEDH--LFEIDSVTGEIKTLTPYWDEVSPVVELVIKVTDNGKPS-LSAVAKLIIK 657          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Xenopus
Match: PCDH17 (protocadherin 17 [Source:NCBI gene;Acc:100485388])

HSP 1 Score: 203.371 bits (516), Expect = 9.335e-53
Identity = 193/638 (30.25%), Postives = 295/638 (46.24%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL----AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILV----TDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP-----QFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L  +D DS +  +KQ IDRE LC      QL+               ++  N++E+    I+V + D NDN+P FP  Q     I EN   G R PL  A D D     + +Y +          DF L     K   DG   P L+I   LDRE+ S +   L A+DG +  R +   +I +K+ D NDN+P FE   Y+  I EN    P+ +I++    TD DE  NG +         + I ++F++D      G +Q +     NLDYE+     E  + A+D G N +     + +++++ ND +P I FV   Q      +I E      ++A V+V+D DS  N QL C +L   N+       F+   N    +++ T + +DRE      I  +  VT+   D +   PLN+  S  + I D NDNPP FT+ +Y  Q+ EN    E     ++ A D DL  NG V+Y I      + S   +  ++  NG IY  +SF++E+   + F V+A D G P+ L S++T+ V + D NDNAP               V  NV +G+LI  + A D D     +    IV  +  +    L  +D +TG+I+T  P   E +  +   ++
Sbjct:   65 LLDVDQDSGVLYTKQRIDRESLCRRSPKCQLS--------------LEVFANDKEI--CMIKVDILDINDNSPNFPSEQIDI-DISENASPGTRFPLTSAHDPDAGENGLKTYVI-------TRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILTALDGGDPPR-SATIQINVKVIDSNDNSPVFEALSYMVEIPEN---SPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIRELFSID---SKTGIIQVK----GNLDYEE-NGLIEIDVQARDQGPNPIPKHCKVTVKVIDKNDNAPSISFVSVRQG-----AISEAAPPGTVIALVRVTDKDSGKNGQLICRVLG--NV------PFKLEENYDNLYTVVTDRPLDRE------IQDEYNVTIIARD-NGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYL--GSVLAQDPDLGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPH-LESNATVRVSVLDVNDNAPVICLPTLQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIVYGNEDH----LFEIDSVTGEIKTLTPYWDEVSPVVELVIK 639          

HSP 2 Score: 90.8929 bits (224), Expect = 7.767e-18
Identity = 144/582 (24.74%), Postives = 242/582 (41.58%), Query Frame = 3
Query:  591 KLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIK--------------IRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQ---LQCSLLTPRNILMIEESRFRHPVNI-YKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRAS--KLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQ 2258
            KL +P + G  S+F +    ++  P+L     LD ++ S   +T   ID     R + K +++++              I DINDN+P F        I EN      F +    D D  ENG   LK +   ++    +F+LD+  +  G    ++     LD E+  H  +  + A DGG    S+T  + +++++ ND SP        + ++    I E +   +I+  +  +DAD   N       S   P         R R   +I  K   ++   N+D E N    ID      VQ  D   N IP +   ++ +I  D NDN P  +  +V  G I E      V   A +   DKD   NG++   +         + F+++     +Y     +  D E +  Y+  ++A D G P  L+S+ +  V+I D+NDN P F+++ +   V EN   G  +G + A D D L  +  + + +        S    ++++P  G I      + E+T    F V +K+       L   A + ++V D+ND+ P            +I L TLQ
Sbjct:   43 KLGIPER-GRKSNFRV---LENSAPHL-----LDVDQDSGVLYTKQRIDRESLCRRSPKCQLSLEVFANDKEICMIKVDILDINDNSPNFPSEQIDIDISENASPGTRFPLTSAHDPDAGENG---LKTYVITRDDFG-LFSLDVKSRGDGTKFPELVIQKELDREEQSH-HKLILTALDGGDPPRSATIQINVKVIDSNDNSPVF------EALSYMVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAP--------DRIRELFSIDSKTGIIQVKGNLDYEENGLIEID------VQARDQGPNPIPKHCKVTVKVI--DKNDNAPSISFVSVRQGAISEAAPPGTVI--ALVRVTDKDSGKNGQLICRVL------GNVPFKLEENYDNLYTVVTDRPLDREIQDEYNVTIIARDNGSP-PLNSTKSFSVKILDENDNPPHFTKAMYVLQVSENNIPGEYLGSVLAQDPD-LGHNGTVSYSILPSHVGDVSIYTFVSVNPTNGAIYALRSFNYEQTKYFEFKVLAKDSGSPH--LESNATVRVSVLDVNDNAP------------VICLPTLQ 564          

HSP 3 Score: 79.7221 bits (195), Expect = 2.515e-14
Identity = 86/311 (27.65%), Postives = 142/311 (45.66%), Query Frame = 3
Query: 1371 LRTTQNIDREA---NEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQN-GKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIP 2285
            L T Q IDRE+     P     K  ++++    D EI +     I + I D+NDN P F        I EN +    F   + H  D D   NG  TY I   DF   S  +  R D     ++   +  D E++S +  I+ A D G P R S++  I V++ D NDN+P F    +   + EN  +G ++  +NATD D    + ++ +     + +R  +L ++D  TG I+ +  +D E+   I   V++++     N + +   + + V D ND+ P+            IS  +++QG I E+ P
Sbjct:   75 LYTKQRIDRESLCRRSP-----KCQLSLEVFANDKEICM-----IKVDILDINDNSPNFPSEQIDIDISENASPGTRFPLTSAH--DPDAGENGLKTYVITRDDFGLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILTALDGGDPPR-SATIQINVKVIDSNDNSPVFEALSYMVEIPENSPLGRIVIDLNATDADE-GSNGEVVYSFSGYAPDRIRELFSIDSKTGIIQVKGNLDYEENGLIEIDVQARDQGP--NPIPKHCKVTVKVIDKNDNAPS------------ISFVSVRQGAISEAAP 357          

HSP 4 Score: 70.0922 bits (170), Expect = 1.797e-11
Identity = 132/557 (23.70%), Postives = 228/557 (40.93%), Query Frame = 3
Query:  252 GLFILDSDS--------NLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNAT-----FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGK-TEITIKIRDINDNAPKFERPIYIRTIKENVIVDP------IFQILVTDEDEDENGRIDLKMHNSG----QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKF---TQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVR 1838
            GLF LD  S         L + K++DREE    +++L               LD      +  +Q   I V V D NDN+PVF  +      I EN PLG  +    A D D  +     +S S Y  +   +L        +   K G+  + +   LD E+  +    + A D  +G     K  ++T+K+ D NDNAP     I   ++++  I +       I  + VTD+D  +NG++  ++  +     +E  + ++T+ + D+ + +              ++   +   I+A+D G   L+ST +  ++IL+ ND  P         Q++      E  +  + L  V   D D   N      + P ++           V+IY   S+  T N    A   F  +       +    D+  P L +NA++ + + DVNDN P     T      +I    N    ++   + A D D   +G++TY I  + N  +   F IDS  G+I     +  E   +   ++  TD G P+ LS+ + +I++
Sbjct:  168 GLFSLDVKSRGDGTKFPELVIQKELDREEQSHHKLILT-------------ALDGGDPPRSATIQ---INVKVIDSNDNSPVFEALSY-MVEIPENSPLGRIVIDLNATDADEGSNGEVVYSFSGYAPDRIREL-------FSIDSKTGI--IQVKGNLDYEENGLIEIDVQARD--QGPNPIPKHCKVTVKVIDKNDNAPS----ISFVSVRQGAISEAAPPGTVIALVRVTDKDSGKNGQLICRVLGNVPFKLEENYDNLYTV-VTDRPLDR--------------EIQDEYNVTIIARDNGSPPLNSTKSFSVKILDENDNPPHFTKAMYVLQVS------ENNIPGEYLGSVLAQDPDLGHNGTVSYSILPSHV---------GDVSIYTFVSVNPT-NGAIYALRSFNYEQTKYFEFKVLAKDSGSPHLESNATVRVSVLDVNDNAPVICLPTLQNDTAEIHVPRNVGVGYLITTVRAMDNDFGESGRLTYEIV-YGNEDH--LFEIDSVTGEIKTLTPYWDEVSPVVELVIKVTDNGKPS-LSAVAKLIIK 657          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Xenopus
Match: ENSXETT00000027853.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:18074243:18087174:1 gene:ENSXETG00000012517.1 transcript:ENSXETT00000027853.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.897 bits (494), Expect = 6.667e-51
Identity = 164/549 (29.87%), Postives = 272/549 (49.54%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTP-YCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQIL-VTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQD--FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQ-FSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIR 2057
            I V + D NDN P+F   QT     I EN P G +I +  A D D    S  +Y L+ P K   S               L++   LDREK + +  TL A D     R +G T+I I ++D+NDNAP F  PIY  +I EN  V  +  +L  TD DE ENG I+    + G   + ++F ++       K   +V     LDYE   + +E  + A+D  +  ++    + + + +VND  PEI+       ++G  ++ E +    ++A   V+D DS  N Q++C +  P N+    +S+F +       +SL    N+DRE+   +         V     DN IP L+T A I+  ++D+NDNPP FT+ +Y+  I ENI    +     + A+DKD   N ++ Y + +   +  S + +  I+  +G +++  SFD+EK  ++   V   D G P+ LS+++ I V I+DQND++P+  S    +  V  ++++GHL+ ++ A D D+     +     + D  +  + L ++D  +G+IR
Sbjct:   73 INVEISDVNDNAPLFQ--QTADTIFIRENNPPGSQIYIVSASDSDTGQNSFITYSLKSPSKDNKSKSL-----------VLVLNQALDREKQASHLLTLTAADCGTPKR-SGTTQIRILVQDVNDNAPTFRHPIYRVSIPENYAVGSLIVVLKATDLDEGENGVIEYSFSSIGSRSVKQLFKIE-------KNNGEVHLKGLLDYENKKY-YEIHVQAKDTAQLPMTGHCKVIVDVTDVNDNPPEIKI----SSLSG--AVKEDSSPGFVIALFTVTDRDSGPNGQVRCQI--PDNLPFYLDSKFSN------YYSLVLKDNLDRESVAEY--------NVPISATDNGIPALSTTAYIYFSVDDINDNPPLFTEELYFFSIAENILPGSLIFQ--VSASDKDSGKNAQLLYALLESYVEGMSVSHFISINPDSGNVFSVDSFDYEKMQMFQLQVEVKDHGLPS-LSNTANITVFIQDQNDHSPEVLSPVPTSEMVLRSMKVGHLVTKLRAVDADA---GYNAWLTYEMDPVSNTT-LFSVDSYSGEIR 570          

HSP 2 Score: 94.7449 bits (234), Expect = 3.855e-19
Identity = 136/520 (26.15%), Postives = 228/520 (43.85%), Query Frame = 3
Query:  330 MMLQLNKVCGSIHTCCHILDFQIS-CNNEEMQSNF-IRVFVDDENDNNPVF--PIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKD-GVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQIL---VTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSP----EIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYK-QFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEV-FMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRI 1841
            ++L LN+         H+L    + C   +      IR+ V D NDN P F  PI +    +I EN  +G  I + KA DLD     V  Y       +G+ S  +L K  K+ G  +L     LD E    Y   + A D  +    TG  ++ + + D+NDN P+ +       +KE+    P F I    VTD D   NG++  ++ ++   +         LD       + V   +NLD E +   +   I A D G  +LS+TA +   + ++ND  P    E+ F          FSI E  L   ++  V  SD DS  N QL  +LL       +E     H ++I     ++ +  + D E  + F         +Q +  D+ +P L+  A+I + I D ND+ P+    V   ++   + + +V  +   + A D D   N  +TY +      SN   F +DS +G+I  +++    +E+++  +V+  D G P++ S+ +TI++ I
Sbjct:  138 LVLVLNQALDREKQASHLLTLTAADCGTPKRSGTTQIRILVQDVNDNAPTFRHPIYR---VSIPENYAVGSLIVVLKATDLDEGENGVIEYSFS---SIGSRSVKQLFKIEKNNGEVHL--KGLLDYENKKYYEIHVQAKDTAQLPM-TGHCKVIVDVTDVNDNPPEIKISSLSGAVKEDS--SPGFVIALFTVTDRDSGPNGQVRCQIPDNLPFY---------LDSKFSNYYSLVLK-DNLDRESVAE-YNVPISATDNGIPALSTTAYIYFSVDDINDNPPLFTEELYF----------FSIAENILPGSLIFQVSASDKDSGKNAQLLYALLES----YVEGMSVSHFISINPDSGNVFSVDSFDYEKMQMF--------QLQVEVKDHGLPSLSNTANITVFIQDQNDHSPEVLSPVPTSEMV--LRSMKVGHLVTKLRAVDADAGYNAWLTYEMDPV---SNTTLFSVDSYSGEIRIARNIKETEENMHKLVVIVRDHGQPSK-STLATIMINI 607          

HSP 3 Score: 90.5077 bits (223), Expect = 8.173e-18
Identity = 103/391 (26.34%), Postives = 157/391 (40.15%), Query Frame = 3
Query: 1059 FEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQ-LQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNAS-IFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHK-------DIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            ++  I A+D G  SLS + T+ ++I +VND +P        QQ      I E       +  V  SD+D+  N  +  SL +P               N  K   L   Q +DRE     L+    +    C       P  +  + I I++ DVNDN P F   +Y   I EN     + +   + A D D   NG + Y      + S    F+I+  NG+++     D+E +  Y   V A D      ++    +IV + D NDN P+   S  +  V E+   G +I     TDRDS P  +       ++ F + S   N  S L+  D L          DRE  +     + + +       L   A I  +V D+ND+PP F
Sbjct:   53 YQVVITAKDEGSPSLSISMTINVEISDVNDNAPLF------QQTADTIFIRENNPPGSQIYIVSASDSDTGQNSFITYSLKSPSKD------------NKSKSLVLVLNQALDREKQASHLL---TLTAADCG-----TPKRSGTTQIRILVQDVNDNAPTFRHPIYRVSIPENYAVGSLIV--VLKATDLDEGENGVIEYSFSSIGSRSVKQLFKIEKNNGEVHLKGLLDYENKKYYEIHVQAKDTAQL-PMTGHCKVIVDVTDVNDNPPEIKISSLSGAVKEDSSPGFVIALFTVTDRDSGPNGQVRCQIPDNLPFYLDSKFSNYYS-LVLKDNL----------DRESVAEYNVPISATDNG--IPALSTTAYIYFSVDDINDNPPLF 401          

HSP 4 Score: 82.8037 bits (203), Expect = 2.140e-15
Identity = 82/324 (25.31%), Postives = 149/324 (45.99%), Query Frame = 3
Query: 1365 FSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN-INNHEVFMNAAIHAADKDLHLNGKVTYHIQDFK--NSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL-------KDPSKSQLIISLETLQ------QGQICESIP 2285
            FSL     +DRE    +    ++++T +    D   P L+ + +I + I+DVNDN P F Q      I EN     ++++   + A+D D   N  +TY ++     N S ++   ++         Q+ D EK++ +   + A D G P R S ++ I + ++D NDNAP F    +   + EN  +G LI  + ATD D   E+  I +   S       +L  ++   G++  +  +D E        V++K+ +++   +     +++ V D+ND+PP  ++       K+ S    +I+L T+        GQ+   IP
Sbjct:   37 FSLAVDAPLDRENKSEY----QVVITAK----DEGSPSLSISMTINVEISDVNDNAPLFQQTADTIFIRENNPPGSQIYI---VSASDSDTGQNSFITYSLKSPSKDNKSKSLVLVLN---------QALDREKQASHLLTLTAADCGTPKR-SGTTQIRILVQDVNDNAPTFRHPIYRVSIPENYAVGSLIVVLKATDLDE-GENGVIEYSFSSIGSRSVKQLFKIEKNNGEVHLKGLLDYENKKYYEIHVQAKDTAQL--PMTGHCKVIVDVTDVNDNPPEIKISSLSGAVKEDSSPGFVIALFTVTDRDSGPNGQVRCQIP 336          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Mouse
Match: Pcdh17 (protocadherin 17 [Source:MGI Symbol;Acc:MGI:2684924])

HSP 1 Score: 222.631 bits (566), Expect = 6.467e-59
Identity = 194/644 (30.12%), Postives = 296/644 (45.96%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILV----TDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFV--RNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQF----SLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTY-----HIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNA-----PQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L  +D+DS L  +KQ IDRE LC      + N  C         L  ++  N++E+    I+V + D NDN P FP  Q     I EN   G R PL  A D D     + +Y L       +   F L  K   DG   P L+I   LDRE  + +T  L A+DG E  R +   +I +K+ D NDN+P FE P Y+  + EN    P+  +++    TD DE  NG +     +   + + ++F++D            +R   NLDYE+     E  + A+D G N + +   + +++++ ND +P I FV  R G       ++ E      ++A V+V+D DS  N QLQC +L               P  + + +    ++ T + +DRE  + +       VT+   D     PLN+  S  + I D NDNPP+FT+ +Y  Q+ EN    E     ++ A D DL  NG V+Y     HI D    S   Y  ++  NG IY  +SF++E+   + F V+A D G P  L S++T+ V + D NDNA     P          V  N  +G+L+  + A D D     +    IV  +  +    L  +DP +G+IRT +P   + T  +   V+
Sbjct:   75 LLDVDADSGLLYTKQRIDRESLC------RHNAKCQ--------LSLEVFANDKEI--CMIKVEIQDINDNAPSFPSDQIEM-DISENAAPGTRFPLTSAHDPDAGENGLRTYLL----TRDDHGLFALDVKSRGDGTKFPELVIQKALDRELQNHHTLVLTALDGGEPPR-SATVQINVKVIDSNDNSPVFEAPSYLVELPENA---PLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSID-------PKTGLIRVKGNLDYEE-NGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQG-------ALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGLGGPGSVPFKLEENYDNFYTVVTDRPLDRETQDEY------NVTIVARD-GGSPPLNSTKSFAVKILDENDNPPRFTKGLYVLQVHENNIPGEYL--GSVLAQDPDLGQNGTVSYSILPSHIGDV---SIYTYVSVNPTNGAIYALRSFNYEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDH----LFEIDPSSGEIRTLHPFWEDVTPVVELVVK 662          

HSP 2 Score: 92.0485 bits (227), Expect = 2.610e-18
Identity = 127/499 (25.45%), Postives = 206/499 (41.28%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENG-RIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE-QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQ---LQCSLLTPRNILMIEESRFRHPVNIYKQFSL-RTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI------QDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRAS--KLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I ++I+DINDNAP F        I EN      F +    D D  ENG R  L   +      + +F LD+  +  G    ++     LD E Q +H+    + A DGG    S+T  + +++++ ND SP        +  +    + E      ++  +  +DAD   N       S   P         R R   +I  +  L R   N+D E N    ID      VQ  D   N IP +   ++ +I  D NDN P     +V  G + E      V   A +   D+D   NG++   +              ++ F+++      Y     +  D E +  Y+  +VA D G P  L+S+ +  V+I D+NDN P+F++  +   V EN   G  +G + A D D L ++  + + +        S    ++++P  G I      + E+T    F V +K+ S     L   A + +TV D+ND+ P   L
Sbjct:  119 IKVEIQDINDNAPSFPSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDD-----HGLFALDVKSRGDGTKFPELVIQKALDRELQNHHTL--VLTALDGGEPPRSATVQINVKVIDSNDNSPVF------EAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVP--------DRVRELFSIDPKTGLIRVKGNLDYEENGMLEID------VQARDLGPNPIPAHCKVTVKLI--DRNDNAPSIGFVSVRQGALSEAAPPGTVI--ALVRVTDRDSGKNGQLQCRVLGGGGTGGGLGGPGSVPFKLEENYDNFYTVVTDRPLDRETQDEYNVTIVARDGGSPP-LNSTKSFAVKILDENDNPPRFTKGLYVLQVHENNIPGEYLGSVLAQDPD-LGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSFNYEQTKAFEFKVLAKD-SGAPAHLESNATVRVTVLDVNDNAPVIVL 583          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Mouse
Match: Pcdhgc4 (protocadherin gamma subfamily C, 4 [Source:MGI Symbol;Acc:MGI:1935203])

HSP 1 Score: 214.157 bits (544), Expect = 9.839e-57
Identity = 182/585 (31.11%), Postives = 280/585 (47.86%), Query Frame = 3
Query:  243 INNGLFILDSDSN-LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIF-QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNS--SNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF------SQSHFAFFVDENVEIGHLIGQINATDRDS 1958
            +N   F +D DS  L +   IDRE LC            G   +C   L+F ++    EM    + +   D ND+ P FP  Q     I E  P G R PL KAQD D  + S+SSY+L       ++  F L  K   DG  VP L++   LDREK S Y   L A+DG    R +G  E+ + + D+NDNAP F++  Y  ++ E+     +  Q+  +D D   +G +         + +  +F+   L  + GK+  Q      LD+E   + +EF + A+DGG  ++    +LR+ +L+VND +P I             ++ E      ++A + V D DS  N    SL  P ++    +S FR+      QFSL T   +DREA       S   + V   D  N  PL+T+ +IF+ I+DVNDNPP F Q  +   + E  NN    +  ++ A+D D  LN  ++Y + + +N   S + +  ++ Q G ++ ++SFD+E+     F V A D+G P  LSS+ T+ + + D NDNAP          S     +  +V  GHL+ ++ A D DS
Sbjct:   73 VNQRHFRVDLDSGALLIKNPIDREALC------------GLSASCIVPLEF-VTEGPLEMYRAEVEIV--DVNDHAPRFPRQQL-DLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLS------SNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPR-SGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVTFSFSGHTPDRVRNLFS---LHPTTGKLTLQ----GPLDFESENY-YEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPHITVTSELG------TLPESAEPGTVVALISVQDPDSGSNG-DVSLRIPDHLPFALKSAFRN------QFSLVTAGPLDREAR------SSYDIMVTASDAGNP-PLSTHRTIFLNISDVNDNPPSFFQRSHEVFVPE--NNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGSPP-LSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLVTKVTAVDLDS 603          

HSP 2 Score: 124.79 bits (312), Expect = 2.062e-28
Identity = 158/595 (26.55%), Postives = 247/595 (41.51%), Query Frame = 3
Query:  522 LGY-----RIPLPK-----------AQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFK----DGVPYLIITSTLDREK-TSMYTFTLIAIDGV-EGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQI-LVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLR-TTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSL-----------PEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPT 2201
            LGY     R P+P+           AQD    T S+S+ +L++  ++         +HF+     G   L+I + +DRE    +    ++ ++ V EG     + E+  +I D+ND+AP+F R      I E       F +    D D   N     ++ +      N+ F LD+  +S G +  ++     LD E+    +   + A DGG    S TA LR+ +L+VND +P        QQ +   S+ E   +  +L  +  SD D          L P   +    S    P  +   FSL  TT  +  +    F  ++     V+  D  +   +  + S+ + + DVNDN P  T     G + E+     V   A I   D D   NG V+  I D    +    FR       +  +   D E  S Y  +V A+D G+P  LS+  TI + I D NDN P F Q     FV EN   G L+  + A+D DS            P ++D+           AS  I+L+P TG +      D E+T T+ F V++++  R    L     + + V DLND+ P 
Sbjct:   27 LGYVYGQIRYPVPEESQEGTFVGNVAQDFLLDTESLSARRLQVAGEVNQ-------RHFRVDLDSGA--LLIKNPIDREALCGLSASCIVPLEFVTEGPLEMYRAEV--EIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSS------NEHFALDVKKRSDGSLVPELLLEKPLDREK-QSDYRLVLTAVDGGNPPRSGTAELRVSVLDVNDNAPAF------QQSSYRISVLESAPAGMVLIQLNASDPD----------LGPSGNVTFSFSG-HTPDRVRNLFSLHPTTGKLTLQGPLDFESENYYEFDVRARDGGSPA-MEQHCSLRVDLLDVNDNAPHITVTSELGTLPESAEPGTVV--ALISVQDPDSGSNGDVSLRIPDHLPFALKSAFR---NQFSLVTAGPLDREARSSYDIMVTASDAGNPP-LSTHRTIFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDV----------SASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARD--RGSPPLSSTVTVRLFVLDLNDNAPA 567          

HSP 3 Score: 93.5893 bits (231), Expect = 8.930e-19
Identity = 98/369 (26.56%), Postives = 164/369 (44.44%), Query Frame = 3
Query: 1125 IQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS---------LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            ++I++VND +P  RF R  QQ+     I E     +     +  DAD   N +    L+      ++  + R   ++  +  L   + +DRE       D ++++T    D  N  P +  A + + + DVNDN P F Q+ Y   + E+     V +   ++A+D DL  +G VT+             F +    GK+      DFE E+ Y F V A D G P  +    ++ V + D NDNAP  + +     + E+ E G ++  I+  D DS         +P+H  + F +KS  +N+ S L+T  PL  + R+ Y I       +    ++ NP      L     I + + D+ND+PP+F
Sbjct:  124 VEIVDVNDHAP--RFPR--QQLD--LEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFALDVKK-RSDGSLVPELLLE--KPLDREKQS----DYRLVLTAV--DGGNP-PRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQ--LNASDPDLGPSGNVTFSFSGHTPDRVRNLFSLHPTTGKLTLQGPLDFESENYYEFDVRARDGGSPA-MEQHCSLRVDLLDVNDNAPHITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDH--LPFALKSAFRNQFS-LVTAGPLDREARSSYDI-------MVTASDAGNPP-----LSTHRTIFLNISDVNDNPPSF 458          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Mouse
Match: Pcdh10 (protocadherin 10 [Source:MGI Symbol;Acc:MGI:1338042])

HSP 1 Score: 196.052 bits (497), Expect = 5.372e-51
Identity = 185/650 (28.46%), Postives = 305/650 (46.92%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIE--ENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGVPY--LIITSTLDREKTSMYTFTLIAIDGVEG------------------NRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN-INNHEVFMNAAIHAADKDLHLNGKVTYHIQD--FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF-------SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT--RYPIDREKTSTITFFVESKN 2120
            L V+++IDRE++C      + +  C        +L  ++   N  ++   + + V D NDN P FP    P  T+E  E+   G R PL  A D D  T S+  Y++        +S F L  +   DG  +  L++   LDRE+ +++ + L A+DG  G                   + TG   +TI++ D NDN P F++P+Y  ++ EN      + Q+  TD DE +NG +     +       ++F L       G+++        LDYE+    ++  + A+D G N++ +   + +++L+ ND +PEI F       T   ++ EG     ++A   V+D DS  N Q+QC LL         +  FR   +    +++ T   +DREA      DS  +  V  D    E  L+T+ SI + ++DVNDN P+F+Q VY   + EN +    ++   A+ A D+D   N K+TY I +   +  S   Y  I+S NG +Y  +SFD+E+   +SF V A D G P  L+ ++T+ + I DQNDNAP         + +     +  + E G+L+ ++ A D D     +    IV+ +  N    L  LD  TG++RT  R P  R+        +E ++
Sbjct:   73 LYVNEKIDREQIC------KQSPSC--------VLHLEVFLENP-LELFRVEIEVLDINDNPPSFP---EPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEIT------PNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGGGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLS---PRTGRLEVS----GELDYEE-SPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFS------TVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLG--------DVPFRLKSSFKNYYTIVTEAPLDREAG-----DSYTLTVVARDR--GEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIY---AVSATDRDEGANAKLTYSILECQIQGMSVFTYVSINSDNGYLYALRSFDYEQIKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMN----LFRLDWRTGELRTARRVPAKRDPQRPYELVIEVRD 662          

HSP 2 Score: 55.0694 bits (131), Expect = 5.869e-7
Identity = 71/249 (28.51%), Postives = 105/249 (42.17%), Query Frame = 3
Query:  423 SNFIRVFVDDENDNNPVF--PIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIR--TIKENVI---VDPIF---QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILN 1139
            S  I+V V D NDN P F  P+    Y T E N P  Y I    A D D    +  +Y + L  ++   S F       D   YL    + D E+   ++F + A D        G   + I I D NDNAP    P+  R  T    V+    +P +   ++   D D+ EN R+   +    +        L  LD   G+++   R     D ++ Y   E  I  +D G+  LSSTATL +Q+++
Sbjct:  446 SKSIQVQVSDVNDNAPRFSQPVYDV-YVT-ENNVPGAY-IYAVSATDRDEGANAKLTYSI-LECQIQGMSVFTYVSINSDNG-YLYALRSFDYEQIKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNE------MNLFRLDWRTGELRTARRVPAKRDPQRPY---ELVIEVRDHGQPPLSSTATLVVQLVD 680          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 194.126 bits (492), Expect = 1.849e-50
Identity = 197/675 (29.19%), Postives = 304/675 (45.04%), Query Frame = 3
Query:  291 SKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYC--TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL---AKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEI-TIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIY-KQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN---PSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQL-IISLETLQQGQICE 2276
            S +IDRE+LC      + N+       C   L+  I   N+  +   I++ V D NDN P+FP   +P    +I EN  +  R P+P A D D     V  Y+L     L   S F L        +  P LI+   LDRE+   Y   +   DG  G      T I  + + D+NDN P F+       I EN  V   + Q+  TD D   N  I             ++F L+    + G +  Q     +LD E+     +  ++A DG  +S  + AT+ I + +VND  P I        I G   + E    N  +A + VSD D+ +N         + I  IE     H   +Y  Q+ L T+  +D E  + F    KI+ +      D+  P LN  A + + + D NDNPP F Q V    + EN N   +++   I A D+D   N  + Y +       NA +F +D + G +  S+ F+ E++  + F V A D G P  L S + +IV + D+NDN+P+F+ +HF FFV EN+     +G I  TD D+  E+K +   + +D++N       LDP +G I++    DRE+ S+ TF V++ +   P R        A + I V D+ND+ P   +  PS +   ++ L  +    + E
Sbjct:   89 SNRIDREKLCAGASYAEENE-------CFFELEVVI-LPNDFFRLIKIKIIVKDTNDNAPMFP---SPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYEL-----LNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG--GTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALN---NTTGLITVQ----RSLDREET-AIHKVTVLASDG--SSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNG--------KVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSF--KIVAS------DSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSEN-NRRGLYL-TTISATDEDSGKNADIVYQL-----GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTP-PLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDA-GENKAVTLSILNDNEN-----FVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPR-----SSTAKVTINVMDVNDNSPVV-ISPPSNTSFKLVPLSAIPGSVVAE 699          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Mouse
Match: Pcdh10 (protocadherin 10 [Source:MGI Symbol;Acc:MGI:1338042])

HSP 1 Score: 195.282 bits (495), Expect = 2.316e-50
Identity = 185/650 (28.46%), Postives = 305/650 (46.92%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIE--ENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGVPY--LIITSTLDREKTSMYTFTLIAIDGVEG------------------NRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQI-EENINNHEVFMNAAIHAADKDLHLNGKVTYHIQD--FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF-------SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT--RYPIDREKTSTITFFVESKN 2120
            L V+++IDRE++C      + +  C        +L  ++   N  ++   + + V D NDN P FP    P  T+E  E+   G R PL  A D D  T S+  Y++        +S F L  +   DG  +  L++   LDRE+ +++ + L A+DG  G                   + TG   +TI++ D NDN P F++P+Y  ++ EN      + Q+  TD DE +NG +     +       ++F L       G+++        LDYE+    ++  + A+D G N++ +   + +++L+ ND +PEI F       T   ++ EG     ++A   V+D DS  N Q+QC LL         +  FR   +    +++ T   +DREA      DS  +  V  D    E  L+T+ SI + ++DVNDN P+F+Q VY   + E N+    ++   A+ A D+D   N K+TY I +   +  S   Y  I+S NG +Y  +SFD+E+   +SF V A D G P  L+ ++T+ + I DQNDNAP         + +     +  + E G+L+ ++ A D D     +    IV+ +  N    L  LD  TG++RT  R P  R+        +E ++
Sbjct:   73 LYVNEKIDREQIC------KQSPSC--------VLHLEVFLENP-LELFRVEIEVLDINDNPPSFP---EPDLTVEISESATPGTRFPLESAFDPDVGTNSLRDYEIT------PNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYVLTAVDGGGGGGGGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLS---PRTGRLEVS----GELDYEE-SPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFS------TVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLG--------DVPFRLKSSFKNYYTIVTEAPLDREAG-----DSYTLTVVARDR--GEPALSTSKSIQVQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIY---AVSATDRDEGANAKLTYSILECQIQGMSVFTYVSINSDNGYLYALRSFDYEQIKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNEMN----LFRLDWRTGELRTARRVPAKRDPQRPYELVIEVRD 662          

HSP 2 Score: 55.0694 bits (131), Expect = 6.285e-7
Identity = 71/249 (28.51%), Postives = 105/249 (42.17%), Query Frame = 3
Query:  423 SNFIRVFVDDENDNNPVF--PIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIR--TIKENVI---VDPIF---QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILN 1139
            S  I+V V D NDN P F  P+    Y T E N P  Y I    A D D    +  +Y + L  ++   S F       D   YL    + D E+   ++F + A D        G   + I I D NDNAP    P+  R  T    V+    +P +   ++   D D+ EN R+   +    +        L  LD   G+++   R     D ++ Y   E  I  +D G+  LSSTATL +Q+++
Sbjct:  446 SKSIQVQVSDVNDNAPRFSQPVYDV-YVT-ENNVPGAY-IYAVSATDRDEGANAKLTYSI-LECQIQGMSVFTYVSINSDNG-YLYALRSFDYEQIKDFSFQVEARDAGSPQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLLTRVAAVDADDGENARLTYSIVRGNE------MNLFRLDWRTGELRTARRVPAKRDPQRPY---ELVIEVRDHGQPPLSSTATLVVQLVD 680          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. UniProt/SwissProt
Match: sp|O14917|PCD17_HUMAN (Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2)

HSP 1 Score: 219.55 bits (558), Expect = 4.462e-57
Identity = 196/647 (30.29%), Postives = 296/647 (45.75%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILV----TDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRF--VRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESR-------FRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTY-----HIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNA-----PQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L  +D+DS L  +KQ IDRE LC      + N  C         L  ++  N++E+    I+V + D NDN P F   Q     I EN   G R PL  A D D     + +Y L       +   F L  K   DG   P L+I   LDRE+ + +T  L A+DG E  R +   +I +K+ D NDN+P FE P Y+  + EN    P+  +++    TD DE  NG +     +   + + ++F++D            +R   NLDYE+     E  + A+D G N + +   + +++++ ND +P I F  VR G       ++ E      ++A V+V+D DS  N QLQC +L                   F+   N    +++ T + +DRE  + +       VT+   D     PLN+  S  I I D NDNPP+FT+ +Y  Q+ EN    E     ++ A D DL  NG V+Y     HI D    S   Y  ++  NG IY  +SF+FE+   + F V+A D G P  L S++T+ V + D NDNA     P          V  N  +G+L+  + A D D     +    IV  +  +    L  +DP +G+IRT +P   + T  +   V+
Sbjct:   74 LLDVDADSGLLYTKQRIDRESLC------RHNAKCQ--------LSLEVFANDKEI--CMIKVEIQDINDNAPSFSSDQIEM-DISENAAPGTRFPLTSAHDPDAGENGLRTYLL----TRDDHGLFGLDVKSRGDGTKFPELVIQKALDREQQNHHTLVLTALDGGEPPR-SATVQINVKVIDSNDNSPVFEAPSYLVELPENA---PLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSID-------PKTGLIRVKGNLDYEE-NGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQG-------ALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTVVTDRPLDRETQDEY------NVTIVARD-GGSPPLNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPGEYL--GSVLAQDPDLGQNGTVSYSILPSHIGDV---SIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDH----LFEIDPSSGEIRTLHPFWEDVTPVVELVVK 664          

HSP 2 Score: 92.0485 bits (227), Expect = 1.973e-17
Identity = 126/501 (25.15%), Postives = 204/501 (40.72%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENG-RIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQ---LQCSLLTPRNILMIEESRFRHPVNIYKQFSL-RTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI---------QDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRAS--KLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I ++I+DINDNAP F        I EN      F +    D D  ENG R  L   +      + +F LD+  +  G    ++     LD EQ  H     + A DGG    S+T  + +++++ ND SP        +  +    + E      ++  +  +DAD   N       S   P         R R   +I  +  L R   N+D E N    ID      VQ  D   N IP +   ++ +I  D NDN P     +V  G + E      V   A +   D+D   NG++   +                 ++ F+++      Y     +  D E +  Y+  +VA D G P  L+S+ +  ++I D+NDN P+F++  +   V EN   G  +G + A D D L ++  + + +        S    ++++P  G I      + E+T    F V +K+ S     L   A + +TV D+ND+ P   L
Sbjct:  118 IKVEIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDD-----HGLFGLDVKSRGDGTKFPELVIQKALDREQQNH-HTLVLTALDGGEPPRSATVQINVKVIDSNDNSPVF------EAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVP--------DRVRELFSIDPKTGLIRVKGNLDYEENGMLEID------VQARDLGPNPIPAHCKVTVKLI--DRNDNAPSIGFVSVRQGALSEAAPPGTVI--ALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTVVTDRPLDRETQDEYNVTIVARDGGSPP-LNSTKSFAIKILDENDNPPRFTKGLYVLQVHENNIPGEYLGSVLAQDPD-LGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSFNFEQTKAFEFKVLAKD-SGAPAHLESNATVRVTVLDVNDNAPVIVL 585          

HSP 3 Score: 87.4261 bits (215), Expect = 4.904e-16
Identity = 80/314 (25.48%), Postives = 145/314 (46.18%), Query Frame = 3
Query: 1371 LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQ---------DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIP 2285
            L T Q IDRE+      ++K  ++++    D EI +     I + I D+NDN P F+ +     I EN      F   + H  D D   NG  TY +          D K+  +   F       ++   ++ D E+++ ++ ++ A D G P R S++  I V++ D NDN+P F    +   + EN  +G ++  +NATD D  P + ++ +   S   +R  +L ++DP TG IR +  +D E+   +   V++++     N +     + + + D ND+ P+            I   +++QG + E+ P
Sbjct:   84 LYTKQRIDRESL--CRHNAKCQLSLEVFANDKEICM-----IKVEIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAH--DPDAGENGLRTYLLTRDDHGLFGLDVKSRGDGTKFP------ELVIQKALDREQQNHHTLVLTALDGGEPPR-SATVQINVKVIDSNDNSPVFEAPSYLVELPENAPLGTVVIDLNATDADEGP-NGEVLYSFSSYVPDRVRELFSIDPKTGLIRVKGNLDYEENGMLEIDVQARDLGP--NPIPAHCKVTVKLIDRNDNAPS------------IGFVSVRQGALSEAAP 366          

HSP 4 Score: 77.411 bits (189), Expect = 5.850e-13
Identity = 124/506 (24.51%), Postives = 207/506 (40.91%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIE--ENKPLGYRIPLPKAQDLDNAT-----FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP------IFQILVTDEDEDENGRIDLKMHNSG-------------------QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP--LNTNASIFIIINDVNDNPPKF---TQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVR 1838
            I V V D NDN+PVF   + P   +E  EN PLG  +    A D D        +S SSY  +   +L        +   K G+  + +   LD E+  M    + A D +  N      ++T+K+ D NDNAP     I   ++++  + +       I  + VTD D  +NG++  ++   G                   +E  +  +T+ + D+ + +              +    +   IVA+DGG   L+ST +  I+IL+ ND  P  RF + G  +     + E  +  + L  V   D D   N      + P +I           V+IY   S+  T N    A   F  +       +    D+  P  L +NA++ + + DVNDN P     T      +++   N    ++ + + A D D   +G++TY I D    ++   F ID  +G+I     F  +   +   +V  TD G P  LS+ + +I+R
Sbjct:  229 INVKVIDSNDNSPVF---EAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVREL-------FSIDPKTGL--IRVKGNLDYEENGMLEIDVQARD-LGPNPIPAHCKVTVKLIDRNDNAPS----IGFVSVRQGALSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDNFYTV-VTDRPLDR--------------ETQDEYNVTIVARDGGSPPLNSTKSFAIKILDENDNPP--RFTK-GLYV---LQVHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHI---------GDVSIYTYVSVNPT-NGAIYALRSFNFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVD---GNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPT-LSAVAKLIIR 682          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. UniProt/SwissProt
Match: sp|Q5DRA3|PCDGL_PANTR (Protocadherin gamma-C4 OS=Pan troglodytes OX=9598 GN=PCDHGC4 PE=3 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.492e-55
Identity = 180/585 (30.77%), Postives = 279/585 (47.69%), Query Frame = 3
Query:  243 INNGLFILDSDSN-LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIF-QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNS--SNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF------SQSHFAFFVDENVEIGHLIGQINATDRDS 1958
            +N   F +D DS  L +   IDRE LC            G   +C   L+F ++    EM    + +   D ND+ P FP  Q     I E  P G R PL KAQD D  + S+SSY+L       ++  F L  K   DG  VP L++   LDREK S Y   L A+DG    R +G  E+ + + D+NDNAP F++  Y  ++ E+     +  Q+  +D D   +G +         + +  +F+L            ++  +  LD+E   + +EF + A+DGG  ++    +LR+ +L+VND +P I             ++ E      ++A + V D DS  N    SL  P ++    +S FR+      QFSL T   +DREA       S   + V   D  N  PL+T+ +IF+ I+DVNDNPP F Q  +   + E  NN    +  ++ A+D D  LN  ++Y + + +N   S + +  ++ Q G ++ ++SFD+E+     F V A D+G+P  LSS+ T+ + + D NDNAP          S     +  +V  GHLI ++ A D DS
Sbjct:   70 VNQRHFRVDLDSGALLIKNPIDREALC------------GLSASCIVPLEF-VTEGPLEMYRAEVEIV--DVNDHAPRFPRQQL-DLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLS------SNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPR-SGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLH-------PTTGKLTLLGPLDFESENY-YEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPYITVTSELG------TLPESAEPGTVVALISVQDPDSGSNG-DVSLRIPDHLPFALKSAFRN------QFSLVTAGPLDREAK------SSYDIMVTASDAGNP-PLSTHRTIFLNISDVNDNPPSFFQRSHEVFVPE--NNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPP-LSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDS 600          

HSP 2 Score: 122.865 bits (307), Expect = 5.925e-27
Identity = 159/601 (26.46%), Postives = 248/601 (41.26%), Query Frame = 3
Query:  522 LGY-----RIPLPK-----------AQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFK----DGVPYLIITSTLDREK-TSMYTFTLIAIDGV-EGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQI-LVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQN-------IDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSL-----------PEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPT 2201
            LGY     R P+P+           AQD    T S+S+ +L++  ++         +HF+     G   L+I + +DRE    +    ++ ++ V EG     + E+  +I D+ND+AP+F R      I E       F +    D D   N     ++ +      N+ F LD+  +S G +  ++     LD E+    +   + A DGG    S TA LR+ +L+VND +P        QQ +   S+ E   +  +L  +  SD D          L P   +    S    P  +   FSL  T         +D E+   +  D      V+  D  +   +  + S+ + + DVNDN P  T     G + E+     V   A I   D D   NG V+  I D    +    FR       +  +   D E +S Y  +V A+D G+P  LS+  TI + I D NDN P F Q     FV EN   G L+  + A+D DS            P ++D+           AS  I+L+P TG +      D E+T T+ F V++++  R    L     + + V DLND+ P 
Sbjct:   24 LGYVCGQIRYPVPEESQEGTFVGNVAQDFLLDTDSLSARRLQVAGEVNQ-------RHFRVDLDSGA--LLIKNPIDREALCGLSASCIVPLEFVTEGPLEMYRAEV--EIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSS------NEHFALDVKKRSDGSLVPELLLEKPLDREK-QSDYRLVLTAVDGGNPPRSGTAELRVSVLDVNDNAPAF------QQSSYRISVLESAPAGMVLIQLNASDPD----------LGPSGNVTFYFSG-HTPDRVRNLFSLHPTTGKLTLLGPLDFESENYYEFD------VRARDGGSPA-MEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVV--ALISVQDPDSGSNGDVSLRIPDHLPFALKSAFR---NQFSLVTAGPLDREAKSSYDIMVTASDAGNPP-LSTHRTIFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDV----------SASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARD--RGNPPLSSTVTVRLFVLDLNDNAPA 564          

HSP 3 Score: 93.2041 bits (230), Expect = 7.392e-18
Identity = 100/372 (26.88%), Postives = 165/372 (44.35%), Query Frame = 3
Query: 1125 IQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS---------LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            ++I++VND +P  RF R  QQ+     I E     +     +  DAD   N +    L+      ++  + R   ++  +  L   + +DRE       D ++++T    D  N  P +  A + + + DVNDN P F Q+ Y   + E+     V +   ++A+D DL  +G VT++            F +    GK+      DFE E+ Y F V A D G P  +    ++ V + D NDNAP  + +     + E+ E G ++  I+  D DS         +P+H  + F +KS  +N+ S L+T  PL          DRE  S+    V   ++ NP      L     I + + D+ND+PP+F
Sbjct:  121 VEIVDVNDHAP--RFPR--QQLD--LEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFALDVKK-RSDGSLVPELLLE--KPLDREKQS----DYRLVLTAV--DGGNP-PRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQ--LNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLHPTTGKLTLLGPLDFESENYYEFDVRARDGGSPA-MEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDH--LPFALKSAFRNQFS-LVTAGPL----------DREAKSSYDIMVTASDAGNPP-----LSTHRTIFLNISDVNDNPPSF 455          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. UniProt/SwissProt
Match: sp|Q9Y5F7|PCDGL_HUMAN (Protocadherin gamma-C4 OS=Homo sapiens OX=9606 GN=PCDHGC4 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.492e-55
Identity = 180/585 (30.77%), Postives = 279/585 (47.69%), Query Frame = 3
Query:  243 INNGLFILDSDSN-LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIF-QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNS--SNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF------SQSHFAFFVDENVEIGHLIGQINATDRDS 1958
            +N   F +D DS  L +   IDRE LC            G   +C   L+F ++    EM    + +   D ND+ P FP  Q     I E  P G R PL KAQD D  + S+SSY+L       ++  F L  K   DG  VP L++   LDREK S Y   L A+DG    R +G  E+ + + D+NDNAP F++  Y  ++ E+     +  Q+  +D D   +G +         + +  +F+L            ++  +  LD+E   + +EF + A+DGG  ++    +LR+ +L+VND +P I             ++ E      ++A + V D DS  N    SL  P ++    +S FR+      QFSL T   +DREA       S   + V   D  N  PL+T+ +IF+ I+DVNDNPP F Q  +   + E  NN    +  ++ A+D D  LN  ++Y + + +N   S + +  ++ Q G ++ ++SFD+E+     F V A D+G+P  LSS+ T+ + + D NDNAP          S     +  +V  GHLI ++ A D DS
Sbjct:   70 VNQRHFRVDLDSGALLIKNPIDREALC------------GLSASCIVPLEF-VTEGPLEMYRAEVEIV--DVNDHAPRFPRQQL-DLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLS------SNEHFALDVKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPR-SGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQLNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLH-------PTTGKLTLLGPLDFESENY-YEFDVRARDGGSPAMEQHCSLRVDLLDVNDNAPYITVTSELG------TLPESAEPGTVVALISVQDPDSGSNG-DVSLRIPDHLPFALKSAFRN------QFSLVTAGPLDREAK------SSYDIMVTASDAGNP-PLSTHRTIFLNISDVNDNPPSFFQRSHEVFVPE--NNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPP-LSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLITKVTAVDLDS 600          

HSP 2 Score: 122.865 bits (307), Expect = 5.925e-27
Identity = 159/601 (26.46%), Postives = 248/601 (41.26%), Query Frame = 3
Query:  522 LGY-----RIPLPK-----------AQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFK----DGVPYLIITSTLDREK-TSMYTFTLIAIDGV-EGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQI-LVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQN-------IDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSL-----------PEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPT 2201
            LGY     R P+P+           AQD    T S+S+ +L++  ++         +HF+     G   L+I + +DRE    +    ++ ++ V EG     + E+  +I D+ND+AP+F R      I E       F +    D D   N     ++ +      N+ F LD+  +S G +  ++     LD E+    +   + A DGG    S TA LR+ +L+VND +P        QQ +   S+ E   +  +L  +  SD D          L P   +    S    P  +   FSL  T         +D E+   +  D      V+  D  +   +  + S+ + + DVNDN P  T     G + E+     V   A I   D D   NG V+  I D    +    FR       +  +   D E +S Y  +V A+D G+P  LS+  TI + I D NDN P F Q     FV EN   G L+  + A+D DS            P ++D+           AS  I+L+P TG +      D E+T T+ F V++++  R    L     + + V DLND+ P 
Sbjct:   24 LGYVCGQIRYPVPEESQEGTFVGNVAQDFLLDTDSLSARRLQVAGEVNQ-------RHFRVDLDSGA--LLIKNPIDREALCGLSASCIVPLEFVTEGPLEMYRAEV--EIVDVNDHAPRFPRQQLDLEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSS------NEHFALDVKKRSDGSLVPELLLEKPLDREK-QSDYRLVLTAVDGGNPPRSGTAELRVSVLDVNDNAPAF------QQSSYRISVLESAPAGMVLIQLNASDPD----------LGPSGNVTFYFSG-HTPDRVRNLFSLHPTTGKLTLLGPLDFESENYYEFD------VRARDGGSPA-MEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVV--ALISVQDPDSGSNGDVSLRIPDHLPFALKSAFR---NQFSLVTAGPLDREAKSSYDIMVTASDAGNPP-LSTHRTIFLNISDVNDNPPSFFQRSHEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDV----------SASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARD--RGNPPLSSTVTVRLFVLDLNDNAPA 564          

HSP 3 Score: 93.2041 bits (230), Expect = 7.392e-18
Identity = 100/372 (26.88%), Postives = 165/372 (44.35%), Query Frame = 3
Query: 1125 IQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS---------LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            ++I++VND +P  RF R  QQ+     I E     +     +  DAD   N +    L+      ++  + R   ++  +  L   + +DRE       D ++++T    D  N  P +  A + + + DVNDN P F Q+ Y   + E+     V +   ++A+D DL  +G VT++            F +    GK+      DFE E+ Y F V A D G P  +    ++ V + D NDNAP  + +     + E+ E G ++  I+  D DS         +P+H  + F +KS  +N+ S L+T  PL          DRE  S+    V   ++ NP      L     I + + D+ND+PP+F
Sbjct:  121 VEIVDVNDHAP--RFPR--QQLD--LEIGEAAPPGQRFPLEKAQDADVGSNSISSYRLSSNEHFALDVKK-RSDGSLVPELLLE--KPLDREKQS----DYRLVLTAV--DGGNP-PRSGTAELRVSVLDVNDNAPAFQQSSYRISVLESAPAGMVLIQ--LNASDPDLGPSGNVTFYFSGHTPDRVRNLFSLHPTTGKLTLLGPLDFESENYYEFDVRARDGGSPA-MEQHCSLRVDLLDVNDNAPYITVTSELGTLPESAEPGTVVALISVQDPDSGSNGDVSLRIPDH--LPFALKSAFRNQFS-LVTAGPL----------DREAKSSYDIMVTASDAGNPP-----LSTHRTIFLNISDVNDNPPSF 455          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. UniProt/SwissProt
Match: sp|Q9Y5G8|PCDG5_HUMAN (Protocadherin gamma-A5 OS=Homo sapiens OX=9606 GN=PCDHGA5 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.924e-50
Identity = 190/624 (30.45%), Postives = 308/624 (49.36%), Query Frame = 3
Query:  255 LFILDSDSN-LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLE--LPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQD--FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF-------SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT-RYPIDRE 2081
            LF L+  S  L  + +IDREELC        + +C        +++F I   N+ M+   + V + D NDN P F   +     + EN   G R+ LP A+D D    S+ SY+L   L F L   S  +  K+     P L++   LDREK +++   L A+DG +    +G T I + + D NDNAP F    Y  ++ EN+ V   +  +  TD DE  NG++     N  +E I++ F    LD ++G    ++  + +LDYE+    +  ++VAQDGG  +L ++A + + + +VND +PE+        +T   SI E  L   ++A   V D DS  N ++ CS+  PRN+       F+   ++   + L TT+++DRE       D  I +TV   D+    PL+T + I + + DVNDNPP F Q  Y   + E  NN       ++ A D D   N +VTY + +  F+ +  + Y  I+S  G +Y  +SFD+E+       V A+D G+P  LSS+ ++ + + DQNDN P+          S        + E G+L+ ++ A D+DS  ++  + + +   S+     L  +   TG++RT R  +DR+
Sbjct:   74 LFALNPRSGSLVTAGRIDREELC------AQSPLC--------VVNFNILVENK-MKIYGVEVEIIDINDNFPRFRDEEL-KVKVNENAAAGTRLVLPFARDADVGVNSLRSYQLSSNLHFSLDVVSGTDGQKY-----PELVLEQPLDREKETVHDLLLTALDGGDPVL-SGTTHIRVTVLDANDNAPLFTPSEYSVSVPENIPVGTRLLMLTATDPDEGINGKLTYSFRNE-EEKISETFQ---LDSNLG----EISTLQSLDYEE-SRFYLMEVVAQDGG--ALVASAKVVVTVQDVNDNAPEVILT----SLTS--SISEDCLPGTVIALFSVHDGDSGENGEIACSI--PRNL------PFKLEKSVDNYYHLLTTRDLDREETS----DYNITLTVM--DHGTP-PLSTESHIPLKVADVNDNPPNFPQASYSTSVTE--NNPRGVSIFSVTAHDPDSGDNARVTYSLAEDTFQGAPLSSYVSINSDTGVLYALRSFDYEQLRDLQLWVTASDSGNPP-LSSNVSLSLFVLDQNDNTPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDS-GQNAWLSYRLLKASE---PGLFAVGLHTGEVRTARALLDRD 636          

HSP 2 Score: 83.1889 bits (204), Expect = 9.913e-15
Identity = 93/354 (26.27%), Postives = 162/354 (45.76%), Query Frame = 3
Query: 1296 LTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDRE---ANEPF-LIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNG-------KIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKS-------QLIISL------ETLQQGQICESIP 2285
            L  R + ++   R +      +  SL T   IDRE   A  P  +++  I+V  +   Y  E+           I D+NDN P+F       ++ EN       +     A D D+ +N   +Y +     SSN ++F +D  +G       ++   Q  D EKE+++  ++ A D G P  LS ++ I V + D NDNAP F+ S ++  V EN+ +G  +  + ATD D     K + +  +++ + + S+   LD   G+I T   +D E++      V +++       L+  A +V+TV+D+ND+ P   L   + S         +I+L      ++ + G+I  SIP
Sbjct:   59 LAERGVRIVSRGRTQLFALNPRSGSLVTAGRIDREELCAQSPLCVVNFNILVENKMKIYGVEVE----------IIDINDNFPRFRDEELKVKVNENAAAGTRLV--LPFARDADVGVNSLRSYQL-----SSN-LHFSLDVVSGTDGQKYPELVLEQPLDREKETVHDLLLTALDGGDP-VLSGTTHIRVTVLDANDNAPLFTPSEYSVSVPENIPVGTRLLMLTATDPDEGINGK-LTYSFRNE-EEKISETFQLDSNLGEISTLQSLDYEESRFYLMEVVAQDGGA----LVASAKVVVTVQDVNDNAPEVILTSLTSSISEDCLPGTVIALFSVHDGDSGENGEIACSIP 387          

HSP 3 Score: 80.1073 bits (196), Expect = 8.272e-14
Identity = 122/486 (25.10%), Postives = 209/486 (43.00%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE-QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFS-LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRA--SKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            + ++I DINDN P+F        + EN        +L    D D    + +    S Q   N  F+LD++  + G+   ++     LD E +  H  +  + A DGG   LS T  +R+ +L+ ND +P   F  +   ++   +I  GT     L  +  +D D  IN +L  S    RN    EE +      +      + T Q++D E +  +L++    V  Q     +   L  +A + + + DVNDN P+         I E+     V    ++H  D D   NG++   I   +N    + F+++      Y+   ++  D E+ S Y+  +   D G P  LS+ S I +++ D NDN P F Q+ ++  V EN   G  I  + A D DS  ++  + + +  D+   A  S  ++++  TG +      D E+   +  +V   +S NP      L     + + V D ND+ P
Sbjct:  119 VEVEIIDINDNFPRFRDEELKVKVNENAAAGTRL-VLPFARDAD----VGVNSLRSYQLSSNLHFSLDVVSGTDGQKYPELVLEQPLDREKETVH--DLLLTALDGGDPVLSGTTHIRVTVLDANDNAP--LFTPSEYSVSVPENIPVGTR----LLMLTATDPDEGINGKLTYSF---RN----EEEKISETFQLDSNLGEISTLQSLDYEESRFYLME----VVAQ-----DGGALVASAKVVVTVQDVNDNAPEVILTSLTSSISEDCLPGTVIALFSVH--DGDSGENGEIACSIP--RN----LPFKLEKSVDNYYHLLTTRDLDREETSDYNITLTVMDHGTPP-LSTESHIPLKVADVNDNPPNFPQASYSTSVTENNPRGVSIFSVTAHDPDS-GDNARVTYSLAEDTFQGAPLSSYVSINSDTGVLYALRSFDYEQLRDLQLWVTASDSGNPP-----LSSNVSLSLFVLDQNDNTP 560          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. UniProt/SwissProt
Match: sp|Q8TAB3|PCD19_HUMAN (Protocadherin-19 OS=Homo sapiens OX=9606 GN=PCDH19 PE=1 SV=3)

HSP 1 Score: 197.978 bits (502), Expect = 2.672e-50
Identity = 188/655 (28.70%), Postives = 305/655 (46.56%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELC--PPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELA-KHFKDGVPY--LIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFS-LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIF-IIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDN-----APQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVI 2168
            L  ++  S L V+KQ IDR+ LC   P+ ++ L  +  S+  C                   I+V + D NDN P FP  Q      E   P G RIPL  A D D+ +F V +Y+L  P +L     F L  K   DG  +  L++  +LDRE  S Y+F + A+DG +  R  G   ++IK+ D NDN P F    Y  ++ EN   + P+ ++  +D DE  NG++    +    +   ++F +D            V     LDYE+  H +E  + A+D G NS+ +   + + +L+ ND  P I  +    ++     + E      ++A V+VSD DS +N ++QC LL   N+       FR  +  Y+ FS +     +DRE ++ + +      T+Q    D  +P+  +A  F ++I D NDN P F++  Y   ++EN N    ++  ++ A D DL LNG V+Y I     ++     Y  I+  +G IY  +SF+ E+   + F V+A D G P+ L S++T+ V I D NDN     AP         ++  N  IG+L+  + A D D   E ++ R        +R      +D + G++RT         S+    V + +  +    L   A+++I
Sbjct:   71 LVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEIC------------------VIKVEIKDLNDNAPSFPAAQIELEISEAASP-GTRIPLDSAYDPDSGSFGVQTYEL-TPNEL-----FGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPR-LGTVGLSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQID-------PHSGLVTVTGALDYEE-GHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSEL---VEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLG--NV------PFR--LQEYESFSTILVDGRLDREQHDQYNL------TIQA--RDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQEN-NTPGAYL-LSVSARDPDLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGLPS-LQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYD---EGENGRVTYDMTEGDRG--FFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGK--TSLSASALVLI 660          

HSP 2 Score: 95.9005 bits (237), Expect = 1.302e-18
Identity = 122/489 (24.95%), Postives = 215/489 (43.97%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRT-TQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFTQ-NVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKV--------TYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRF-IVKSDSQNRAS-KLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            I ++I+D+NDNAP F  P     ++ +    P  +I +    + ++G   ++ +   +   N++F L+I  +  G   A++    +LD E   H + F+I A DGG      T  L I++ + ND +P         + T   S+ E +  N  +  +  SD D   N Q+  S     N       R R    I     L T T  +D E    + +D      VQ  D   N IP +   ++ ++  D NDNPP     +V    +E + +    ++ A +  +D+D  LNG+V         + +Q++++ S  +   +D +          D E+   Y+  + A D G P  L S+ +  V I D+NDN P FS+ ++   V EN   G  +  ++A D D L  +  + + IV S  ++      ++++P +G I      + E+T    F V +K+       L   A + + + D+ND+ P
Sbjct:  115 IKVEIKDLNDNAPSF--PAAQIELEISEAASPGTRIPLDSAYDPDSGSFGVQTY---ELTPNELFGLEIKTRGDGSRFAELVVEKSLDRETQSH-YSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVF------SESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVN------DRTRELFQIDPHSGLVTVTGALDYEEGHVYELD------VQAKDLGPNSIPAHCKVTVSVL--DTNDNPPVINLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTIL---VDGR---------LDREQHDQYNLTIQARDGGVP-MLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDPD-LGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGG--LPSLQSNATVRVIILDVNDNTP 561          

HSP 3 Score: 83.9593 bits (206), Expect = 5.691e-15
Identity = 124/490 (25.31%), Postives = 200/490 (40.82%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVI-----VDPIFQIL---VTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQ--------FSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQN-VYYGQIEENI--NNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRI 1841
            + + V D NDNNPVF    T   ++ EN P    +    A D D  T     Y             F++  H       + +T  LD E+  +Y   + A D +  N      ++T+ + D NDN P     I + ++   ++       P + I    V+D D   NGR+  ++        N  F L    +S   +    R    LD EQ +  +   I A+DGG   L S  +  + I + ND  P   F +   Q+     + E       L  V   D D  +N      + P  +  +       PV  Y          ++LR+  +   +A E F + +K          D  +P L +NA++ +II DVNDN P  T   +  G  E  I  N+   ++   + A D D   NG+VTY + +     +  +F ID  NG++  +++F    +S Y  IVVA D G    LS+S+ +++ +
Sbjct:  224 LSIKVTDSNDNNPVFS-ESTYAVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSG----LVTVTGALDYEEGHVYELDVQAKD-LGPNSIPAHCKVTVSVLDTNDNPPV----INLLSVNSELVEVSESAPPGYVIALVRVSDRDSGLNGRVQCRLLG------NVPFRLQEY-ESFSTILVDGR----LDREQ-HDQYNLTIQARDGGVPMLQSAKSFTVLITDENDNHP--HFSKPYYQVI----VQENNTPGAYLLSVSARDPDLGLNGSVSYQIVPSQVRDM-------PVFTYVSINPNSGDIYALRSFNHEQTKAFE-FKVLAK----------DGGLPSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNSGIGYLVTVVKAEDYDEGENGRVTYDMTE----GDRGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGK-TSLSASALVLIYL 662          

HSP 4 Score: 71.633 bits (174), Expect = 4.027e-11
Identity = 65/241 (26.97%), Postives = 111/241 (46.06%), Query Frame = 3
Query: 1494 IFIIINDVNDNPPKFTQNVYYGQIEENIN-NHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRID-SQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I + I D+NDN P F       +I E  +    + +++A    D D    G  TY +   +     +  R D S+  ++   +S D E +S YSF + A D G P RL +   + +++ D NDN P FS+S +A  V EN      + ++NA+D D    +  + +       +R  +L  +DP +G +     +D E+       V++K+     N +     + ++V D ND+PP   L
Sbjct:  115 IKVEIKDLNDNAPSFPAAQIELEISEAASPGTRIPLDSAY---DPDSGSFGVQTYELTPNELFGLEIKTRGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVG-LSIKVTDSNDNNPVFSESTYAVSVPENSPPNTPVIRLNASDPDE-GTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTVTGALDYEEGHVYELDVQAKDLGP--NSIPAHCKVTVSVLDTNDNPPVINL 348          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. TrEMBL
Match: A0A087VWC5 (Uncharacterized protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000007700 PE=4 SV=2)

HSP 1 Score: 383.645 bits (984), Expect = 4.528e-112
Identity = 263/869 (30.26%), Postives = 430/869 (49.48%), Query Frame = 3
Query:  273 DSNLKVSKQIDREELCPPQMMLQLNKVCGS--------IHTCCHILDFQISCN-NEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELA----------------KHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRN---TGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILD---------------QSIGKV-QAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGG-FSIDEG-TLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEE---------------SRFRHPVNI--------------YKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFM---NAAIHAADKDLHLNGKVTYHIQDF--------------KNSSNAMYFRIDSQNGKIYNSQSFDFEK----ESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLI-----------QEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETL----------QQGQICESIPFXXX-XXXXXXXXXXXXXXRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPN 2525
            D  + V++ +DRE +C  Q    L++            I+ CC +L   +  +     Q  FIRV V D NDN P FP +++P+ TI E+ P+G RIPLP+A D+D+  F V  Y++ + +  GN+S F+L                  + K G PYL +   LDRE   +Y F L AIDG +G+     TG   I I++RD+NDNAP+F+   Y   ++EN +   + Q  V+D D  ENGR+ L + +   +  N +F + + +               ++ G    A V  +  LD EQL    +F I A D G+  LSS A + + I+NVND +P I F+R G+++T    ++ E  T+   I+  V V+D+DS + QL CS+ +  +   + E               S FRH +                Y+QF+LRT  N+DRE    ++      VT+ C D D+  PL  NAS+ + I+D+ND  P+F    Y G + EN  +  V     +  +   D D+  N  +T+ +++               +++S+  YFRID ++G+++   + D E+    E  Y F VVATD G P R SSS+ + V + D NDN P F    + F V+EN  +G ++GQ++  D D    ++ +RF+++   ++    L+ +D  TGQ+  R P+D EK S+I+  V ++N + +    +            EA ++I+V +LND+ P F L  P +  +I + E L           Q + CE IP+ V     D  +   CC + L + ++G+  L  +  N++C  + P + +S  + L A D  GNDS+ ++    ++  ++P+
Sbjct:   77 DLRIIVARPLDREAICEKQRAFDLSQYLSGALSGGDCPIYHCCQLLHINVVVSPTSPTQVFFIRVAVQDLNDNPPTFPHLESPFATIPEDLPVGERIPLPEAIDIDSRPFGVMDYRI-VRWIQGNASHFQLNTMTDQEDEEVSRGPAFAYMKTGHPYLSVVHPLDRETEEVYEFVLEAIDGGQGDGESPFTGSVGILIRVRDVNDNAPEFDEKAYSAVVQENTLPRRVLQFKVSDMDTGENGRVFLSIFDPTHK-ANNLFRVSLQNTLPPPEVLNRYPQSRRTPGSFYTASVHLLEYLDAEQLPPRLKFHITATDNGQPPLSSRAEVNVDIINVNDQAPNIVFLREGKRLTSSRLALPEVITVPESIVVEVHVADSDSNLGQLSCSVTSEMDAFRLIEVHPFSNGGDSAATVLSNFRHSIPSSSTFSSSSSFLFPSYRQFTLRTKVNLDRETKAAYM------VTLMCTDNDSAKPLARNASLHVSISDINDETPRFEHTAYQGHVRENQASAPVTHLSPSPTLRVTDADIGRNALITFSLKEAPEKAGKGHLLNTSTRDTSDVGYFRIDPRSGRLWTVTALDAEEDAPGEHKYIFYVVATDDGVPERRSSSALVTVLVDDVNDNPPAFEHYTYNFEVEENAPVGTVVGQVSVRDADLTEANRRVRFLLRGRPEDLF--LVDIDRATGQLSMRRPVDFEKQSSISLTVIAENEAPLATSPVVDSPMSSTAYHTEANVIISVLNLNDNRPEFVLITPHRKHIIFAWEQLPPAGVNQTLRDQRRFCEPIPYRVIDRDCDPTSRVLCCTLELDNTFDGMFGLFGEIPNVLCALKRPPQPQSYKLLLKARDGTGNDSLSSQTQLSVIVKSEPD 935          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. TrEMBL
Match: A0A068WEQ7 (Protocadherin 2 gamma c6 sCP1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000854900 PE=4 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 9.895e-111
Identity = 263/862 (30.51%), Postives = 430/862 (49.88%), Query Frame = 3
Query:  273 DSNLKVSKQIDREELCPPQMMLQLNKVCGS--------IHTCCHILDFQISCN-NEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAK---------HFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRN---TGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILD-----QSIGKVQ-----------AQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGG-FSIDEG-TLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEE---------------SRFRHPVNI--------------YKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFM---NAAIHAADKDLHLNGKVTYHIQDF--------------KNSSNAMYFRIDSQNGKIYNSQSFDFEK----ESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLI-----------QEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETL----------QQGQICESIPFXX-XXXXXXXXXXXXXXXRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPN 2525
            D  + V++ +DRE +C  Q    L++            I+ CC +L   +  +     Q  FIRV V D NDN P FP +++P+ TI E+ P+G RIPLP+A D+D+  F V  Y++    + GN+S F+L           + K G PYL +   LDRE   +Y F L AIDG +G+     TG   I I++RD+NDNAP+F+   Y   ++EN +   + Q  V D D  ENGR+ L + +   +  N +F + + +     +++ +             A V  +   D EQL    +F I A D G+  LSS A + + I+NVND +P I F+R G+++T    ++ E  T+   I+  V V+D+DS + QL CS+ +  +   + E               S FRH +                Y+QF+LRT  N+DRE    ++      VT+ C D D+  PL  NAS+ + I+D+ND  P+F    Y G + EN  N  V     +  +   D D+  N  +T+ +++               +++S+  YFRID ++G+++   + D E+    E  Y F VVATD G P R SSS+ + V + D NDN P F    + F V+EN  +G ++GQ++  D D    ++ +RF+++   ++    L+ +D  TGQ+  R P+D EK S+I+  V ++N + +    +            EA ++I+V +LND+ P F L  P +  +I + E L           Q + CE IP+ V +   D  +   CC + L + ++G+  L  +  N++C  + P + +S  + L A D  GNDS+ ++I   ++  ++P+
Sbjct:   77 DLRIIVARPLDREAICEKQRAFDLSQYLSGALNGGDCPIYHCCQLLHINVVVSPTSPTQVFFIRVAVQDLNDNPPTFPHLESPFATIPEDLPVGERIPLPEAIDIDSRPFGVMDYRIARWIQ-GNASHFQLNTMTDQEDEEVNMKTGHPYLSVVHPLDRETEEVYEFVLEAIDGGQGDGESPFTGSVGILIRVRDVNDNAPEFDEKAYSAVVQENTLPRRVLQFKVADMDAGENGRVFLSIFDPTHK-ANNLFRVSLQNTLPPPEALNRYSQSRRTPGSFYTASVHLLEYPDAEQLPPRLKFHITATDNGQPPLSSRAEVNVDIINVNDQAPNIVFLREGKRLTSSRLALPEVITVPESIVVEVHVTDSDSNLGQLSCSVTSEMDAFRLIEVHPFSNGGDSAATVLSNFRHSIPSSSTFSSSSSFLFPSYRQFTLRTKVNLDRETKAAYM------VTLMCTDNDSAKPLTRNASLHVSISDINDETPRFEHTAYQGHVRENQANAPVTHLSPSPTLCVTDADIGRNALITFSLKEAPEKAGKGHPLNASTRDTSDVGYFRIDPRSGRLWTVTALDAEEDAPGEHKYVFYVVATDDGVPERRSSSALVTVLVDDVNDNPPTFEHYTYNFEVEENAPVGTVVGQVSVRDADLTETNRRVRFLLRGRPEDLF--LVDIDRATGQLSMRRPVDFEKQSSISLTVIAENEAPLATSPVVDSPMSSAAYHTEANVIISVLNLNDNRPEFVLITPHRKHIIFAWEQLPPAGVNQTLRDQRRFCEPIPYRVIDRDCDPTSRVLCCTLELDNTFDGMFGLFGEIPNVLCALKRPPQPQSYKLLLKARDGTGNDSLSSQIQLSVIVKSEPD 928          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. TrEMBL
Match: A0A158QES7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7862 PE=4 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 1.614e-110
Identity = 271/872 (31.08%), Postives = 436/872 (50.00%), Query Frame = 3
Query:  273 DSNLKVSKQIDREELCPPQMMLQLNKVCGS---------IHTCCHILDFQISCN-NEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-----------------AKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRN---TGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQ-SIGKVQAQ---------------VRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSI--DEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILM----------IEESRF-RHPVN--------IYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFM---NAAIHAADKDLHLNGKVTYHIQDF----------KNSSNAMYFRIDSQNGKIYNSQSFDFEKE--------SIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQ-----------EAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETL-----------QQGQICESIPFXXXXXXXXXXXXX-XXXXRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPNVATQSKNQPP 2555
            D  + V++ +DRE +C  Q  L LN+  G          I+ CC +L   +  +     Q +FIRV V D NDN P+FP +++P+ TI E+ P+G RI LP+A D D+  F V  Y++ + +  GN+S F+L                     K G PYL +   LDRE   +Y F L AIDG +  R    TG   + I+IRD+NDNAP+F+   Y   + EN +   I Q  V+D D  ENGR+ L + +S  +  N +F + + +    G++ A+               +  +  LD EQL    +F I A D G+  LSS   + I I+NVND +P+I F R G ++     +  +  T    I A V V+DADS +++L C + +  +             +E S + RH V          Y+QF+LRT  N+DRE    ++      VT+ C D D+  PL  NA++ + I+D+ND  PKF   VY G + EN  N  V     +  I  AD D   N  +T+ +++           + +S+  +FRID ++G+++   + D E++          Y F VVATD G P R SSS+ + + + D NDN P F   H+ F V+EN  +G ++GQ++  D D    ++ +RF ++   ++    L+ +D  TGQ+  R P+D EK S+I+  V ++N + + +  I            EA ++I V ++ND+ P F    P +  +I + E L            Q + CE IP++V D D +      CC + L++ Y+G+  L ++  N++C  + P + +S  + L A D +GNDS+ ++I   ++  ++P+    ++N PP
Sbjct:   79 DLRIIVARPLDREAICEKQRALALNQHHGGHQMQGGDCPIYHCCKLLHVNVVVSPTSPPQVSFIRVAVQDLNDNPPIFPHIESPFTTIPEDIPVGERIHLPEAFDADSRPFGVVDYRI-MQWMQGNASHFQLNVIADPEEEDEVSGNQGIGFMKVGRPYLNVIHPLDRETEEVYEFILQAIDGGQNERGMPYTGSVAVIIRIRDVNDNAPEFDEKSYSAVVHENTLPQKILQFKVSDRDAGENGRLFLNIIDSPHKASN-LFRISLQNSLPPGEMVAKYTNSRPTPGSFYTVSLHLLEYLDAEQLPPRIKFYISATDNGQPPLSSRVEVNIDIVNVNDQAPKIEFYREGTRLAPNRLVLPEVITAPESIAAEVHVTDADSSLSELSCRITSEEDTFRLTEVNPFTGNVENSNYGRHLVASSSGFLFPAYRQFTLRTKVNLDRETKALYM------VTIMCTDNDSSKPLTRNATLHVSISDINDETPKFEHPVYQGHVRENEPNAPVIHLTPSPTIRVADADAGRNALITFSLKEASAVEGSSNSTRRTSDVGHFRIDPRSGRLWTVPALDAEEQVDDASGEGRKYVFYVVATDDGVPERRSSSALMNIFVDDINDNPPAFEHYHYNFEVEENAPVGTVVGQVSVRDADRTEANRKVRFSLRGRPEDLF--LVDIDRTTGQMNMRRPVDYEKQSSISLTVVAENDAPLASPSISGRPPSSSAYQTEASVIINVLNVNDNRPEFIPIAPHRKHIIFAWEQLPVAGSNQTSGKNQRRFCEPIPYKVIDKDCDPASREFCCTLELENTYDGMFGLLEEIPNVLCALKRPSQPQSYKLMLKARDGNGNDSLSSQIQLSVIIKSEPDYTKFTQNGPP 940          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. TrEMBL
Match: G4VRE5 (Putative cadherin OS=Schistosoma mansoni OX=6183 GN=Smp_145210 PE=4 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 6.601e-109
Identity = 290/896 (32.37%), Postives = 437/896 (48.77%), Query Frame = 3
Query:  258 FILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIH-------------------TCCHILDFQISCNNEEMQSNF-IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKL-------ELPFKLGNSSDFELAKHFKD---------------GVPYLIITSTLDREKTSMYTFTLIAIDGVEGN-----------RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRA--------INNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGG-FSIDE-GTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESR----------------FRHPVNI---YKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN-------PSR-------IFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETL------QQGQ------------------------------------ICESIPFXXXXXXXXXXXXXX-XXXRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPNV 2528
            FILD D  +K++K +DRE +C    +LQ   +  S++                    CC +L   I  +  E+ + F I+V V D NDN P FP + TPY  I E+  L  +I LP+A D D+  F+V+ Y+        +  F+LG S   +L   F                 G PYL IT  LDRE   +Y+FTLIAIDG  GN             TG   I IKI D+NDN P FE+  Y   + EN +  PI + ++ D D  +NGR+ +                 ++D   G+ Q   R         I+ LD E+  +   F +VA D G+  LSS   ++I+I+NVND  P+I F+ NG++++ G  S+ E  T    I+A V V+D DS I Q++C L+   ++   EE+                 F   + I   YKQ+ +RT +  DRE    +       VTV+C D + +  L+ NAS+ I I D+N++ P FT++++ GQ+ EN  + EV M   IHA D D+ +N  +TY      N  +  +FRID   GK++  QS D E  S Y  +V+A D G P  LSSS+ I++ ++D NDN P+F  +H+ F V EN   G  IG + A D+D    ++ +R+ ++ +  N   KLIT+D  +G +RTR PIDRE  S+I+  VE++N       PS        I N +  EA +VIT+ +LND+ P F L +P +S +  + E L      +Q Q                                    +CE +P  V D D  ++     C++ L  NYNGL +L     +++C    P   ++  +TLIA D   NDS+ +++ F ++  +DPN+
Sbjct:   34 FILD-DFLIKLAKPLDREMIC----LLQTESLRHSVNRNDPSIASYSDTSQVCLPGACCKLLHVNIITSPTELPTPFYIQVAVQDINDNPPRFPPLHTPYIVIREDIKLDEKIWLPQASDADSDQFNVAEYRAINWIHGNQSHFRLGVSDSNDLNNDFIGDVHEIPSSINLNSHLGKPYLTITEGLDRELIDLYSFTLIAIDG-GGNIPVSNTPDMNKALTGSVSIIIKISDVNDNHPTFEQNAYRAEVAENSVNSPIIEFVLIDRDIGDNGRVTI-----------------VIDDPTGQAQHLFRTYYKGSLQIISPLDAERHLNLLRFHLVANDHGQPILSSRCEIQIRIINVNDNPPKIVFLNNGKRLSDGRISLPEVETPQRAIVALVHVTDDDSPIEQIRCHLIKEDDMFSFEETGSTNFLTHQQTQQSYNLFNEAIGIHSTYKQYVIRTRKIPDREEKHFY------TVTVECIDDEGQYALSRNASLHITITDINEHKPIFTKSIFTGQVIENQLHAEVHMLTPIHATDLDVGVNALITY---SLVNPYDTAFFRIDPITGKLWTIQSLDCENRSEYHLVVIARDSGSPVPLSSSANIVITVEDTNDNVPEFLNTHYLFEVAENAPGGTEIGVVEAIDKDVTIINQRVRYNLRGN--NEDLKLITIDRNSGTLRTRRPIDRESRSSISLIVEAENEVPIHRSPSARNDNFNTIMNHIGTEASVVITILNLNDNRPEFMLIEPHRSHVTFTWEQLNPLIIPKQNQLNATTVHLKSDNQFGKKEKPIKEENQELSSLENANPVCEPLPHRVIDRDMESDSMLDCCILELLDNYNGLFALIPQAPSVLCAMYRPPSPQTYKLTLIAKDGLTNDSLSSQVHFTVIIRSDPNL 895          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. TrEMBL
Match: A0A5K3F6N9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 2.266e-103
Identity = 264/864 (30.56%), Postives = 440/864 (50.93%), Query Frame = 3
Query:  273 DSNLKVSKQIDREELCPPQMML--QLNKVCGS--IHTCCHILDFQISCNNEEM-QSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-----------------AKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRN---TGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLD----ILDQSIGKVQAQVRA------------INNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSI--DEGTLSNKILAYVQVSDADSMINQLQCSL--------LTPRN------------ILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFM---NAAIHAADKDLHLNGKVTYHIQDF----KNS--------SNAMYFRIDSQNGKIYNSQSFDFE---KESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLI----------QEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLE---------TLQQGQICESIPFXX-XXXXXXXXXXXXXXXRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPNVATQSKNQPPSS 2561
            D  + V++ +DRE +C  Q  L  +L+   G   +  CC +L   +  +   + Q  FIRV V D NDN P FP V++P+ TI E+ P+G +I LPKA D+D+  F V+ Y++   +  GN+S F+L                 +++ +   PYL I  +LDRE   +Y F L AIDG +G+     TG   I I++RD+NDNAP+F++ +Y   ++EN +   + +  ++D D  ENGRI + + +   +  N +F +     I    I    A  R+            +  LD EQL     F ++A D G+ +L+S A + I I+NVND +P I F+R G+++T    +  +  T    I+A V V+D+DS +  L C +        LT  N            +L  ++S      + Y+QF+LRT  N+DRE+   +      +VT+ C D ++  P + N+S+ I I+D+ND  PKF  +VY G ++EN  N  V     +  IH  D D+  N  +T+ +++     KN         S+A  FRID ++G+++   + D +   +   Y F VVATD G P R SSS+ + + + D NDN P F   H+ F V EN   G  IG+++ +D D    ++ +RF ++   ++    L+ ++  +G++ TR PID EK S+I+  V ++N   +  D +           EA +VI+V ++ND+ P F    P +  ++   E         TL + + CESIP++V +   D  +   CC + L+  ++G+  L ++  N++C+ + P   +S  V L A D  G+DS+ +++   ++  N+ ++   S    P S
Sbjct:   79 DLRIVVARPLDREAICEKQKTLGYRLSGPFGGCLVFHCCQLLHVNVVMSPTSLTQVFFIRVAVQDVNDNAPTFPHVESPFITISEDMPVGEKILLPKAVDIDSQPFGVADYRIAR-WVQGNASHFQLNMLTDKEDDEDGNLNPVSEYAQTRRPYLDIVHSLDRETDEVYEFVLEAIDGGQGDGGAPFTGTVNILIRVRDVNDNAPEFDKLVYDAVVQENTLPQKVIRFKISDFDAGENGRIFINIVDPTHK-ANNLFRVSLQNTIPPPEIMNKYASSRSPPGSHYIGSLHLLEYLDAEQLPPRLRFHLIASDNGQPALTSRAEVNIDIINVNDQAPNIVFLREGKRLTTSRLVLPEVITAPESIVAEVHVTDSDSNLGHLTCRITSGGDAFRLTEVNPFAGSNSGTVTALLNFDQSTSPFVFSSYRQFTLRTKVNLDRESKAVY------VVTIMCTDNESVNPFSRNSSLHISISDINDQTPKFEYSVYTGHVKENEANAPVTHLSPSPTIHVTDNDVGRNALITFSLKEAPVEGKNDPNKSSIGVSDASRFRIDPRSGRLWTVPALDADDISESHKYVFYVVATDDGVPERRSSSALVHIIVDDCNDNPPAFEHYHYNFEVKENAPAGTSIGRVSVSDADKTEANRKVRFSLRGRLEDLF--LVDINRASGELTTRRPIDYEKQSSISLTVVAENEVPLVADAVGRPSRADISQAEASVVISVINVNDNRPEFVPVSPHRKHIVFVWEQLPVVGVNQTLDRRKFCESIPYKVIDKDCDPASQELCCTLELEDTFDGMFGLLEEIPNVVCVLKRPTHPQSYKVMLKARDGKGDDSLSSQMQLSVIIKNERDLDMYSLKGSPDS 932          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Cavefish
Match: pcdh17 (protocadherin 17 [Source:NCBI gene;Acc:103025306])

HSP 1 Score: 215.312 bits (547), Expect = 9.241e-57
Identity = 198/637 (31.08%), Postives = 305/637 (47.88%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILV----TDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRF--VRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP----QFSQSHFA-FFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L  +D +S L  +KQ IDRE LC      + N  C         L  ++  N++E+    I+V + D NDN P FP  Q     I EN   G R PL  A D D     + +Y++       + S F L  K   DG   P L++  +LDRE+ S +T  + A DG E  + +G  +I +K+ D NDN+P FE+P Y+  I EN    P   +L+    TD DE  NG++         + I ++FT+D     I K+Q ++      DYE+     E  + A+D G N +     + +++L+ ND  P I F  VR G       ++ E      ++A V+V+D DS  N QLQC +L   N+       FR   N    +++ T + +DRE  + + I      T+   D  N  PLN+  S  + I D NDN P+FT+ VY  Q+ EN    E     ++ A D DL  NG V+Y +   +    S   Y  I   +G IY  +SF++E+   + F V A D G+P+ L S++T+ V + D NDN P       Q+  A   V  NV +GH+I  + A D D   E   + + +   +++    L  +D +TG++RT  P+  E +  +   ++
Sbjct:   77 LIDVDPESGLLYTKQRIDREALC------KRNPRCQ--------LSMEVFANDKEI--CMIKVEIQDINDNPPSFPSEQIDI-DISENAAPGTRFPLAAAYDPDTRENGLKTYQI----TRDDYSIFSLDVKSRGDGTKFPELVVQRSLDREERSHHTLIITATDGGEYPK-SGTMQINVKVTDSNDNSPVFEQPSYVVEIPEN---SPPGTVLIDLNATDPDEGSNGQVTYAFSCYVPDRIKELFTIDPRTGVI-KIQGKI------DYEE-NPIIEIDVQAKDQGPNPIPGHCKVTVKVLDRNDNWPSIGFVAVRQG-------AVSEAAAPGTVIALVRVTDKDSGRNGQLQCRILG--NV------PFRLEENSDNFYTVVTDRPLDREVKDEYNI------TIVAKDNGNP-PLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYL--GSVLAHDPDLGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPH-LESNTTVRVSVLDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGHIITTVRAVDND-FGESGRLTYEISDGNEDH---LFEIDAVTGEVRTAQPLWEEVSPVVELIIK 651          

HSP 2 Score: 92.0485 bits (227), Expect = 2.568e-18
Identity = 127/490 (25.92%), Postives = 205/490 (41.84%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN---QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRF--IVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I ++I+DINDN P F        I EN      F +    D D  ENG   LK +   ++  + IF+LD+  +  G    ++    +LD E+  H     I A DGG    S T  + +++ + ND SP        +Q +    I E +    +L  +  +D D   N       S   P  I  +     R  V       ++    ID E N    ID      VQ  D   N IP +   ++ ++  D NDN P      V  G + E      V   A +   DKD   NG++   I         + FR++  +   Y     +  D E +  Y+  +VA D G+P  L+S+ +  V+I D+NDNAP+F++  +   V EN   G  +G + A D D L ++  + +  +  + S+   +  + + P  G I      + E+T    F V++K+       L     + ++V D+ND+ P   L
Sbjct:  121 IKVEIQDINDNPPSFPSEQIDIDISENAAPGTRFPLAAAYDPDTRENG---LKTYQITRDDYS-IFSLDVKSRGDGTKFPELVVQRSLDREERSH-HTLIITATDGGEYPKSGTMQINVKVTDSNDNSPVF------EQPSYVVEIPENSPPGTVLIDLNATDPDEGSNGQVTYAFSCYVPDRIKELFTIDPRTGV-------IKIQGKIDYEENPIIEID------VQAKDQGPNPIPGHCKVTVKVL--DRNDNWPSIGFVAVRQGAVSEAAAPGTVI--ALVRVTDKDSGRNGQLQCRIL------GNVPFRLEENSDNFYTVVTDRPLDREVKDEYNITIVAKDNGNP-PLNSTKSFTVKILDENDNAPRFTKMVYLLQVPENNIPGEYLGSVLAHDPD-LGQNGTVSYSLLPSNVSEESITTYVNIKPTDGAIYALRSFNYEQTKYFDFKVQAKDSGNPH--LESNTTVRVSVLDVNDNIPVIVL 572          

HSP 3 Score: 87.8113 bits (216), Expect = 4.432e-17
Identity = 88/312 (28.21%), Postives = 137/312 (43.91%), Query Frame = 3
Query: 1371 LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQ---------DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICES 2279
            L T Q IDREA      + +  ++++    D EI +     I + I D+NDNPP F        I EN      F  AA  A D D   NG  TY I          D K+  +   F       ++   +S D E+ S ++ I+ ATD G   + S +  I V++ D NDN+P F Q  +   + EN   G ++  +NATD D    +  + +       +R  +L T+DP TG I+ +  ID E+   I   V++K+     N +     + + V D ND+ P+            I    ++QG + E+
Sbjct:   87 LYTKQRIDREAL--CKRNPRCQLSMEVFANDKEICM-----IKVEIQDINDNPPSFPSEQIDIDISENAAPGTRFPLAA--AYDPDTRENGLKTYQITRDDYSIFSLDVKSRGDGTKFP------ELVVQRSLDREERSHHTLIITATDGGEYPK-SGTMQINVKVTDSNDNSPVFEQPSYVVEIPENSPPGTVLIDLNATDPDEG-SNGQVTYAFSCYVPDRIKELFTIDPRTGVIKIQGKIDYEENPIIEIDVQAKDQGP--NPIPGHCKVTVKVLDRNDNWPS------------IGFVAVRQGAVSEA 367          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Cavefish
Match: ENSAMXT00000016369.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:8904389:8910149:1 gene:ENSAMXG00000015901.2 transcript:ENSAMXT00000016369.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.075 bits (536), Expect = 2.428e-56
Identity = 194/614 (31.60%), Postives = 307/614 (50.00%), Query Frame = 3
Query:  273 DSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLEL--PFKLGNSSDFELAKHFKDG-VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNI---LMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQI-EENINNHEVFMNAAIHAADKDLHLNGKVTYHI-QDFKNSSNAMYF-RIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP----QFSQSHFAFFVDE---NVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT 2060
            D  L V+ +IDREE+C      + +  C        +++ +I+  N  ++ ++I V + D ND+ P+FP  +     I EN   G R  L  A+D D+   SV  YKL     F++      ++    +DG +P+LI+   LDRE +S +   L A+DG    + +G  EI + + D+NDN P F +  Y   + EN  I   + Q+  TD DE  NG +     +     + ++F LD        V  ++     +D+EQ Y  +E  I A D     L++  ++ IQI++VND +PEI         +   +I E +     +A + VSD DS +N ++ CS+  P +I   LM    +     NIY   SL TT ++DRE        S+  +T+   D  +  PL++  +I + ++DVNDN P+F+ N Y   + E N+    +F   ++ A D DL  NG ++YHI +D    +  + F  I+ + G+IY  + FDFE    Y F +VA+D G P+ +SS+ T+ V I DQNDN P      S +  A  V+E   NV  GHL+ ++ A D D +  +  + F ++  S +    L  LD  TGQIRT
Sbjct:   75 DGVLHVNGKIDREEVC------ERSSSC--------LINLKIALENP-LEIHYITVEIVDINDHAPIFP-EKEKRLEISENAVAGARFQLQAARDADSGVNSVQLYKLSQNEHFRI------DIKDRGEDGKIPFLILQKPLDRETSSKHKIHLTALDGGRPQK-SGTMEIIVDVIDVNDNVPVFTKDAYSVKLSENAPIGTAVIQVNATDADEGTNGEVFFSFGHDVDSNLLRLFDLD-------PVTGEIVVKGPIDFEQKYQ-YEIDIQASDKASAPLTTEKSIFIQIVDVNDNAPEIEVT------SLSVAIAENSKPGTTVALISVSDLDSGMNGKVSCSV--PEDIPFSLMQSSQK-----NIY---SLTTTSSLDREKT------SQYDITLTAKDAGHP-PLSSIKTITVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMF---SVSAHDLDLDENGVISYHIVRDTAEENKHLSFLNINPETGEIYALKRFDFENIKSYQFNIVASDSGTPS-MSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEISRNVNAGHLVTKVRAYDAD-IGYNGWLLFSLQEVSDH---SLFGLDRYTGQIRT 626          

HSP 2 Score: 103.99 bits (258), Expect = 3.319e-22
Identity = 141/493 (28.60%), Postives = 212/493 (43.00%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSI-GKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPV--NIYKQFSLRTTQN-------IDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDS--QNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            IT++I DIND+AP F        I EN +    FQ L    D D +G   ++++   Q   N+ F +DI D+   GK+   +     LD E      +  + A DGGR   S T  + + +++VND  P   F ++   +     + E       +  V  +DAD   N           +       F H V  N+ + F L            ID E    + ID      +Q  D  +  PL T  SIFI I DVNDN P+         I EN         A I  +D D  +NGKV+  + +     +  +  + S    IY+   + S D EK S Y   + A D GHP  LSS  TI V + D NDN+P+FS + + F+V EN   G  +  ++A D D L E+  I + +  D+  +N+    + ++P TG+I      D E   +  F +   +S  PS   N       + + + D ND+ P
Sbjct:  113 ITVEIVDINDHAPIFPEKEKRLEISENAVAGARFQ-LQAARDAD-SGVNSVQLYKLSQ---NEHFRIDIKDRGEDGKIPFLILQ-KPLDRET-SSKHKIHLTALDGGRPQKSGTMEIIVDVIDVNDNVP--VFTKDAYSV----KLSENAPIGTAVIQVNATDADEGTNG---------EVFF----SFGHDVDSNLLRLFDLDPVTGEIVVKGPIDFEQKYQYEID------IQASDKASA-PLTTEKSIFIQIVDVNDNAPEIEVTSLSVAIAENSKPGTTV--ALISVSDLDSGMNGKVSCSVPE-----DIPFSLMQSSQKNIYSLTTTSSLDREKTSQYDITLTAKDAGHP-PLSSIKTITVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSVSAHDLD-LDENGVISYHIVRDTAEENKHLSFLNINPETGEIYALKRFDFENIKSYQFNIVASDSGTPSMSSN-----VTVNVFILDQNDNVP 558          

HSP 3 Score: 86.2705 bits (212), Expect = 1.157e-16
Identity = 82/289 (28.37%), Postives = 129/289 (44.64%), Query Frame = 3
Query: 1494 IFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRID----SQNGKI---YNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL----------KDPSKSQLIISLETLQQG-------QICESIPF 2288
            I + I D+ND+ P F +     +I EN      F   A   AD  ++        +Q +K S N  +FRID     ++GKI      +  D E  S +   + A D G P + S +  IIV + D NDN P F++  ++  + EN  IG  + Q+NATD D    + ++ F    D  +   +L  LDP+TG+I  + PID E+       +++ + +     L  E  I I + D+ND+ P   +            P  +  +IS+  L  G        + E IPF
Sbjct:  113 ITVEIVDINDHAPIFPEKEKRLEISENAVAGARFQLQAARDADSGVN-------SVQLYKLSQNE-HFRIDIKDRGEDGKIPFLILQKPLDRETSSKHKIHLTALDGGRPQK-SGTMEIIVDVIDVNDNVPVFTKDAYSVKLSENAPIGTAVIQVNATDADE-GTNGEVFFSFGHDVDSNLLRLFDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKASA--PLTTEKSIFIQIVDVNDNAPEIEVTSLSVAIAENSKPGTTVALISVSDLDSGMNGKVSCSVPEDIPF 389          

HSP 4 Score: 77.411 bits (189), Expect = 5.482e-14
Identity = 71/248 (28.63%), Postives = 112/248 (45.16%), Query Frame = 3
Query: 1494 IFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS---------LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I + + DVNDN P FT++ Y  ++ EN       +   ++A D D   NG+V +      +S+    F +D   G+I      DFE++  Y   + A+D+     L++  +I ++I D NDNAP+   +  +  + EN + G  +  I+ +D DS         +PE  DI F +   SQ     L T   L          DREKTS     + +K+       L     I + V D+ND+ P F L
Sbjct:  222 IIVDVIDVNDNVPVFTKDAYSVKLSENAPIGTAVIQ--VNATDADEGTNGEVFFSFGHDVDSNLLRLFDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKASA-PLTTEKSIFIQIVDVNDNAPEIEVTSLSVAIAENSKPGTTVALISVSDLDSGMNGKVSCSVPE--DIPFSLMQSSQKNIYSLTTTSSL----------DREKTSQYDITLTAKDAGH--PPLSSIKTITVFVSDVNDNSPEFSL 452          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Cavefish
Match: pcdh1gc5 (protocadherin 1 gamma c 5 [Source:ZFIN;Acc:ZDB-GENE-041118-16])

HSP 1 Score: 209.92 bits (533), Expect = 7.419e-56
Identity = 195/626 (31.15%), Postives = 300/626 (47.92%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSD-FELAKHFKDG---VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN-INNHEVFMNAAIHAADKDLHLNGKVTYHIQDFK--NSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF--------SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L V+ +IDRE LC            G    C   L   I    E +Q + + + + D NDN P F   ++    I E+  LG R P+  A+D D+   S+ SY L       NS++ F L     DG   VP LI+   LDREK  ++   L A+DG +  R +G T + I + D NDN P FE  IY  +++E+  I   +  I  TD DE  NG I         +++ K+F       ++     ++  I  LD+E + +S+ F I AQD G   L   +++ I++++ ND  PEI        +       E      ++A + V D DS  N  + SL  P+      +S F +       +SL T  ++DRE N  + I+  I+ T          PL T  +I + I DVNDN P F+Q  Y   I+EN +    +F   +I A D D++ N  +TY + D K  +   + YF I+S+NG IY+  SFD+EK    + IV A D G P+ LSS++T+ V I DQNDNAP          S SH    +  + + GHL+ ++ A D DS   H    +I    ++   + L +++  TG++RT+  +  ++ S+    +E
Sbjct:   83 LIVNGRIDRETLC------------GQAVNCLVPLQIIIE---EPLQLHRVEIEIQDINDNAPNFHTKES-VLKIAESAALGSRFPIESAEDPDSGKNSLKSYSL-------NSNEHFRLNVKALDGGRKVPELILDKPLDREKQLIHKLILTALDGGDPVR-SGSTLLKIVVEDNNDNEPHFELQIYKASVQESAGIGSNVVTIKATDMDEGINGEIQYYFAAHTPDYVRKVF-------NVNPDSGEITVIGKLDHEGI-NSYTFDICAQDKGYPKLEGHSSVHIRVIDENDNPPEIILTSLPNPVP------ENATVGTVVALINVMDLDSGENG-KVSLKIPKGFPFKLKSSFEN------HYSLITDSSLDRELNSEYNIE--IVATDSGSP-----PLKTVKTINVTILDVNDNAPAFSQTSYNVYIKENNVAGSSLF---SITALDSDVNNNAILTYSVVDSKVNDIPASSYFYINSENGTIYSMSSFDYEKVKRLTLIVQAKDHGSPS-LSSNATLHVFILDQNDNAPSVIYPSAVMGSVSHQR--MPRSAKPGHLVTKVTAVDADS--GHN--AWISYRLAEATDASLFSVNLHTGEVRTKRSLSEQEDSSQRLLIE 646          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Cavefish
Match: ENSAMXT00000035285.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:8923404:8955697:1 gene:ENSAMXG00000041384.1 transcript:ENSAMXT00000035285.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 2.518e-54
Identity = 191/614 (31.11%), Postives = 303/614 (49.35%), Query Frame = 3
Query:  273 DSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLEL--PFKLGNSSDFELAKHFKDG-VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQI-EENINNHEVFMNAAIHAADKDLHLNGKVTYHI-----QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP----QFSQSHFAFFVDE---NVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT 2060
            D  L V+ +IDREE+C      + +  C        +++ +I+  N  ++ +++ V + D ND+ P+F   +     I EN   G R  L  A+D D+   SV  YKL     F++      E+    +DG +P+LI+  +LDRE  + +   L A+DG    + +G  EI + + DINDNAP F +  Y   + EN  I   + Q+  TD D   NG +           + ++F LD        V  ++     +D+EQ Y  +E  I A D     L++   + IQI++VND +PEI         +   ++ E + S   +A + VSD DS +N ++ CS+       +++ S+     NIY   SL T  ++DRE        S+  +T    D  +  PL++  ++ + ++DVNDN P+F+ N Y   + E N+    +F   ++ A D DL  N  ++YHI     Q+ K+SS   +  I+ + G IY  +SFDFE    Y F +VA+D G P+ LSS+ T+ V I DQNDN P      S +  A  V+E   NV  GHL+ ++ A D D +  +  + F ++  S +    L  LD  TGQIRT
Sbjct:   80 DGVLHVNGKIDREEVC------ERSSSC--------LINLKIALENP-LEIHYVTVEIVDINDHPPIFS-EKEKRLEISENAIAGVRFQLQGARDADSGVNSVQMYKLSQNEHFRI------EVRDRGEDGKMPFLILQKSLDRETCARHKLLLTALDGGRPQK-SGTMEIIVDVIDINDNAPVFTKDTYSAKLSENAPIGTKVIQVNATDLDNGPNGEVFYIFGQDVNRNLRRVFDLD-------PVTGEIVVKGPIDFEQKYQ-YEIDIQASDKALAPLTTDKIILIQIVDVNDNAPEIEVT------SLSIAVPENSHSGTTVALISVSDVDSGMNGKVSCSVPEDIPFSLLQSSQ----ENIY---SLVTKSSLDREKT------SQYDITFIAKDAGHP-PLSSIKTLTVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMF---SVSAHDLDLDENAIISYHIWRDPAQENKHSS---FLNINPETGAIYALKSFDFESTKSYQFYIVASDSGTPS-LSSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDAD-IGYNGWLLFSLQEVSDH---SLFGLDRYTGQIRT 631          

HSP 2 Score: 100.523 bits (249), Expect = 4.986e-21
Identity = 133/489 (27.20%), Postives = 210/489 (42.94%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANE-----PFLIDSKIIVTVQCDDYDNEI-PLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSD--SQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            +T++I DIND+ P F        I EN I    FQ L    D D +G   ++M+   Q   N+ F +++ D+        +    +LD E      +  + A DGGR   S T  + + ++++ND +P   F ++    T    + E       +  V  +D D+  N           +  I    F   VN     +LR   ++D    E     P   + K    +     D  + PL T+  I I I DVNDN P+         + EN  +H     A I  +D D  +NGKV+  + +     +  +  + S    IY+     S D EK S Y    +A D GHP  LSS  T+ V + D NDN+P+FS + + F+V EN   G  +  ++A D D L E+  I + +  D   +N+ S  + ++P TG I      D E T +  F++   +S  PS     L     + + + D ND+ P
Sbjct:  118 VTVEIVDINDHPPIFSEKEKRLEISENAIAGVRFQ-LQGARDAD-SGVNSVQMYKLSQ---NEHFRIEVRDRGEDGKMPFLILQKSLDRETCAR-HKLLLTALDGGRPQKSGTMEIIVDVIDINDNAPV--FTKD----TYSAKLSENAPIGTKVIQVNATDLDNGPNG---------EVFYI----FGQDVN----RNLRRVFDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKALAPLTTDKIILIQIVDVNDNAPEIEVTSLSIAVPEN--SHSGTTVALISVSDVDSGMNGKVSCSVPE-----DIPFSLLQSSQENIYSLVTKSSLDREKTSQYDITFIAKDAGHP-PLSSIKTLTVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSVSAHDLD-LDENAIISYHIWRDPAQENKHSSFLNINPETGAIYALKSFDFESTKSYQFYIVASDSGTPS-----LSSNVTVNVFILDQNDNVP 563          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Cavefish
Match: pcdh1g22 (protocadherin 1 gamma 22 [Source:ZFIN;Acc:ZDB-GENE-030131-2695])

HSP 1 Score: 202.986 bits (515), Expect = 1.474e-53
Identity = 182/621 (29.31%), Postives = 295/621 (47.50%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKEN-VIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFK--NSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP------QFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE 2111
            L V+++IDRE LC       L+  C        +L  +    N  ++ + + + + D NDN P F   Q      E   P G +  L  A D D  + S+ SY L        ++ F L    +DG+  P L++   LDREK +++   L A+DG    R +G  EITI + D NDNAP+FE+  Y  T+ EN +I + I ++   D DE  NG ++        + I  +F ++     IG           LDYEQ  +  +F ++A+D G   +    +++I+I +VND  PEI        +       E +L+N ++A +   DADS  N          N+ +   S FR   ++   ++L T   +DRE    + I    I +          P +T   + +I++DVNDNPP F+QN Y    +EN  +  +    ++ A D DL  N K++Y + D K  +   + Y  I+S+NG IY+  SFD+EK  ++   V A D G P+ LSS++T+ V I DQNDNAP          SH    +    + GHL+ ++ A D DS     +  +I    ++   + L +++  TG++RT+  +  +  S+    ++
Sbjct:   73 LVVNEKIDREFLC------GLSSPC--------LLPLEAVIENP-LRLHRVEIEIQDINDNIPSFSSSQRILNIPESINP-GAKFLLDSADDPDVGSNSLQSYSLN------KNTFFILNVKTQDGIKIPELVLNKPLDREKQAIHNLILTAVDGGNPVR-SGSCEITIVVLDNNDNAPQFEKSFYEATVGENELIGNEIVRVSAVDLDEGPNGEVEYFFAEKTTDAIKAVFAINSKTGVIG-------LKGPLDYEQA-NLHKFDVLAKDKGNPQMEGHCSVKIKINDVNDNDPEIVITSLSSPVP------ENSLNNTVVALISTKDADSGDNG-------KVNLTLASRSPFRLSPSVLNHYTLVTNAPLDREKYPVYEIKLNAIDS-------GSPPRSTQKIVTLIVSDVNDNPPVFSQNSYTVYTKENSFHGSIL--CSVSANDPDLDKNAKISYSVLDSKIQDVFVSSYIYINSENGSIYSMHSFDYEKMKVFKIQVQAKDHGSPS-LSSNATVHVFILDQNDNAPYVIYPSAVMGSHQR--MPRTAKPGHLVTKVTAVDADS----GNNGWISYRLAEATDASLFSVNLHTGEVRTKRSLSEQDDSSQRLLIQ 633          

HSP 2 Score: 82.4185 bits (202), Expect = 1.697e-15
Identity = 67/237 (28.27%), Postives = 118/237 (49.79%), Query Frame = 3
Query: 1500 IIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNG----KIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            I I D+NDN P F+ +     I E+IN    F+  +  A D D+  N   +Y +    N +      + +Q+G    ++  ++  D EK++I++ I+ A D G+P R S S  I + + D NDNAPQF +S +   V EN  IG+ I +++A D D  P + ++ +     + +    +  ++  TG I  + P+D E+ +   F V +K+       +     + I + D+ND+ P
Sbjct:  110 IEIQDINDNIPSFSSSQRILNIPESINPGAKFLLDS--ADDPDVGSNSLQSYSL----NKNTFFILNVKTQDGIKIPELVLNKPLDREKQAIHNLILTAVDGGNPVR-SGSCEITIVVLDNNDNAPQFEKSFYEATVGENELIGNEIVRVSAVDLDEGP-NGEVEYFFAEKTTDAIKAVFAINSKTGVIGLKGPLDYEQANLHKFDVLAKDKGN--PQMEGHCSVKIKINDVNDNDP 336          

HSP 3 Score: 81.2629 bits (199), Expect = 4.233e-15
Identity = 69/242 (28.51%), Postives = 118/242 (48.76%), Query Frame = 3
Query: 1494 IFIIINDVNDNPPKFTQNVYYGQIEEN--INNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITF---FVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            I I++ D NDN P+F ++ Y   + EN  I N  V     + A D D   NG+V Y   +    +    F I+S+ G I      D+E+ +++ F V+A D+G+P ++    ++ ++I D NDN P+   +  +  V EN     ++  I+  D DS  ++  +   + S S  R S  + L+  T  + T  P+DREK          ++S +P R       + ++ + V D+ND+PP F
Sbjct:  216 ITIVVLDNNDNAPQFEKSFYEATVGENELIGNEIV----RVSAVDLDEGPNGEVEYFFAEKTTDAIKAVFAINSKTGVIGLKGPLDYEQANLHKFDVLAKDKGNP-QMEGHCSVKIKINDVNDNDPEIVITSLSSPVPENSLNNTVVALISTKDADS-GDNGKVNLTLASRSPFRLSPSV-LNHYT--LVTNAPLDREKYPVYEIKLNAIDSGSPPRS-----TQKIVTLIVSDVNDNPPVF 443          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 186.422 bits (472), Expect = 1.492e-48
Identity = 189/665 (28.42%), Postives = 304/665 (45.71%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNF----IRVFVDDENDNNPVF--PIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELA-KHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDI--LDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEEN--INNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRF-IVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKS 2228
                +++DRE LC  Q               CH+ D Q+     +    F    +R+ V+D NDN P F  P++     ++ EN P G R P+  A D D+    V  Y+L LP      S FEL+     +G  VPYL++  +LDRE+  +Y   L A+DG     ++G   + I + D NDN+P F++      I EN  V   + Q+  +D D   N  +  ++  S     +      +  LDQ+ G V      +N L   +    +   I+A D G   + +TAT+ + + +VND SP I        + G   I E +  N  +A + VSD D   N  + C +  P     ++  +  +P     Q+ L T + +D E    +      +V ++  D      L+   S+ I + D NDN P FT+  Y   + EN  I  H +     + A D+D+  N ++ Y    F        F +D + G I  ++  D EK++ YSF ++A DQG P  L  ++T+IV + D NDN P+FS + F F+V+ENV     +G +   D D   E+  +R  I+ +D++    +L ++DP +G IR+    DRE+       V++ +             +VI V D+ND+ P   L  PS +
Sbjct:   96 FAAGRKMDREALCGGQ----------DPGDECHV-DVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLT---VSVPENAPAGKRFPIQPANDPDSEANGVRRYEL-LPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDG-GSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLV-----TVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLK--KLTYP----NQYLLETRETLDYETKNEY------VVQIKAADA-GATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLI----TVSATDRDMDKNAEMVY----FLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIP-VLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDE-GENGRVRLSILGTDNR----QLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRS--STVKVVIHVMDINDNSPIV-LMPPSNT 709          

HSP 2 Score: 116.701 bits (291), Expect = 9.515e-27
Identity = 166/629 (26.39%), Postives = 257/629 (40.86%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELP-------------FKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAID-GVEGNRNTGKTEI----------TIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDRE--ANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF----SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRF-IVKSDSQNRASKLITLDPLTGQIRTRYPI 2072
            L V K +DREE    +M L+        H+   +L                R+ V D NDN+PVF   +     I EN P+G  +    A D D  + +   Y+L                F+L  +S              + +   L+RE++ +Y   ++A D G E    T    +          TI+IRDI   AP     IYI       +  P+  I V+D D   NG +   ++N    +  K  T           Q  +     LDYE   + +  +I A D G  SLS T ++ I++L+ ND +P         + T   S+ E  +  K L  V  +D D   N      L P    M             +   +  T+ +DRE  AN  F I +K          D  IP L  NA++ + + DVNDN P+F+   +   + EN+  H       +  AD D   NG+V   I     + N   F ID ++G I ++  FD E+   Y   V ATD G P R SS+  +++ + D NDN+P      S + + F V   +  G ++ +++A D D+   + ++R+ IV  +  N    L  +DP+ G I    P+
Sbjct:  219 LVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVL----------------RINVTDTNDNSPVFDQAEV-NVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGL------------VTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDI--VAP-VNGVIYISEASH--VNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTY--------PNQYLLETRETLDYET-KNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVF------TEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDP--------ETGIISLTEQLDREKKANYSFTILAK----------DQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTV--GMVTVADSDEGENGRVRLSIL---GTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVR-SSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLP-GTIVTEVSAVDNDA-EINAELRYHIVGGNPHN----LFHIDPVIGNITLMEPL 768          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 1.352e-41
Identity = 181/647 (27.98%), Postives = 291/647 (44.98%), Query Frame = 3
Query:  390 FQISCNNEEMQSNFIRVFVDDENDNNPVF--PIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLI-ITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKEN-VIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQL-YHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEES-RFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENI-NNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKE--------SIYSFIVVATDQGH-PNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESI 2282
            F    + E   S  + + + +ENDN P+F  P+      ++ EN  LG  +    A DLD   F   SY         +S  F L     D    LI + + LD E T  +T T++A DG  G    G+  + I + D+NDN P F+R  Y+ T +EN   + P+ ++  TDED   N +I   +  +     +  F++     ++      V     LDYE++   +    I+A DGG   L+ST T  +++ + ND SP   F RN   I    +I E  L+   + YV  +D D      Q SL     I  +E S +FR  +N  +   + +T  +DREA     +   I++    D  D        A++ I + DVNDN P +    Y   I EN     ++F    + AAD DL+ NG + Y I D  N     ++RI++ +GKI  +     ++E        S+ S +V   D+G  P R ++S+T+ V ++D NDN P F    +A  V E +     + Q+ ATD    P+      +  S +         LD  TG I T   +DRE  +     + + +  R    L     + + V D+ND+ PTF    P++S + + +E++ +  +  S+
Sbjct:    2 FANETSGEHWGSARVHITLINENDNRPIFSLPLYN---VSVWENATLGTSVVQVLATDLDAGVFGQVSYHFS-----DDSDKFSL-----DPASGLISVAAALDFEATPRFTVTVMARDG-GGQETAGR--VRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSA--YSSYFSI-----TVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSP--IFDRNSYSI----AIPENILAGATVLYVNATDGDQSPEYGQLSL-----IYSLEGSTQFR--INA-RSGDITSTTLLDREA-----VSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFT---VSAADPDLNENGTLVYAI-DPPNP----FYRINAASGKI-RTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATD----PDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATD--RGTPALSSTTTLSLVVLDVNDNAPTFH---PARSAVSL-MESVARDSVVISL 587          

HSP 2 Score: 122.865 bits (307), Expect = 2.282e-28
Identity = 152/594 (25.59%), Postives = 250/594 (42.09%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYC-TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITST--LDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDI------LDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNS----LSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN---QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPN-RLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS----------LPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN 2120
             + VF  DENDN+P+F   +  Y   I EN   G  +    A D D    S    +L L + L  S+ F +     D      ITST  LDRE  S Y   + A+DG +GN + TG   + I + D+NDN P +    Y  TI EN      IF +   D D +ENG +              ++ +D       ++ + GK++     ++  D   +  +    IV     R S     +++AT+ + + +VND  P    +    Q+       EG  +N  L  V  +D D   N       +   PR    ++ +             + T   +DREA   + +  +++ T      D   P L++  ++ +++ DVNDN P F        + E++    V +  +++  D D  LN ++++ I           F +  ++G +    S D E ++ YS ++ A D G    R + ++T+ V + D NDN P F +  +   V ENV  G +I Q+ ATD D           +  ++D  F+V     N +S LI+        R   P+DRE  +     VE+ N
Sbjct:  228 IVEVF--DENDNSPIFD--RNSYSIAIPENILAGATVLYVNATDGDQ---SPEYGQLSLIYSLEGSTQFRINARSGD------ITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTL--------------VYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVL------EGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGL----------ITTLVQLDREAVAAYQL--RLVAT------DRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVI--SLNCTDADSGLNAELSFFITGGNQDGQ---FSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLV-----NVSSGLIS--------RGATPLDRETVALHALQVEAFN 752          

HSP 3 Score: 100.138 bits (248), Expect = 1.809e-21
Identity = 134/578 (23.18%), Postives = 235/578 (40.66%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNA-----TFSVSSYKLELPFKLGNSS---------DFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF----ERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE-QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFII-INDVNDNPPKFTQNVYYGQIEENINNHEVF--MNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESI----YSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFS-QSHFAFFVDENVEIGHLIGQINATDRD-SLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDRE 2081
            + + + DENDN P F          E     G  +    A D D        +++ S      F + N +         DFE++        YL++ +  D+ +                 R T    +++ + D+ND  P F    E PI    + E      I   + +D+D   NG ++  + +         F +   D  +     +VR    LD E Q +  +   I+A+D G   L+ST T+ +++L+V+D  P          +    S+ E      I++ V+ SDA+   N   C+ L     L    + F +    +   S      ++R  +   + + ++ +TV+ D+ DN      ++ I I+ I D NDN P F+Q  Y  +I EN  N  V   +N  I+A+D D  +N  + Y +       ++ YF ID   G +  +     ++E I        ++  D G   R +++  + V + D NDN P F+  S  A  ++ +  +G  +  + A DRD  + +   +R+ + S   +       +D  TG I T  PID E
Sbjct: 1158 VLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGL-----YLLVVTATDQPRD-------------PARRLTSTATVSVHVADVNDVTPWFLRSYEGPI---DVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPR---NEFVISPADGDL-----RVRRYVELDRETQAF--YNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVF------LNLPANASLSEAAAVLAIVSRVRASDANEGRN---CAAL-----LQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVR-DNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLL----GGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGG---RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDT----FGIDESTGLIVTVAPIDYE 1678          

HSP 4 Score: 99.7525 bits (247), Expect = 2.352e-21
Identity = 133/569 (23.37%), Postives = 230/569 (40.42%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYT-FTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERP--IYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAI--NNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFT--QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF------SQSHFAFFVDENVEIGHLIGQI-NATDRDSLPEHKDIRFIVKSDSQN-----RASKLITLDPLTGQIRTRYPI 2072
            ++ V V DENDN+P F         + E+   G  + +  A D D  +    S +            + L    + GV  + +      EKTS +  F ++A+DG    R+T    +++ + D+NDN P F  P    +  ++       +  +  TD D   NG++  ++ + G + +           SIG     +R     N+D E    ++   +VA D G   LS +A +R+ + +VND  P   F+   Q +    S+ E       +A V+ ++     N    +      I  I ++ F     ++    L T+  + +          +  +T    D+    PL   A +++ + DVND+ P F    N     I E +    V     + A D D   NG V Y         S +   FRI++ +G I  +++ D E +++YS I++A+DQG P    S+  + V + D +DN P F         + +F + E+   G  +G +  A D D         FI   +  N     R   L+ L  L  ++   Y I
Sbjct: 1824 YVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRST-TFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKL-----------SIGPSDGIIRVAPGANIDRET-RAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPA--FLAPVQTV----SVLESLSVGSFVATVKATE-----NYKGHNTKYTYKIAGIGKNAF----TVHATSGLVTSTRLLKSYE-------RFNLTAVATDHGRP-PLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMP--VVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAI 2354          

HSP 5 Score: 93.9745 bits (232), Expect = 1.362e-19
Identity = 178/711 (25.04%), Postives = 291/711 (40.93%), Query Frame = 3
Query:  258 FILDSDSNL-KVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPK----AQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREK--TSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDED----ENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILM---IEESRFRH------PVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNE-IPLNTN---ASIFIIINDVNDNPPKF-TQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVT--YHIQDFKNSSNAMYFRIDSQNG-KIYNSQSFDF-EKESIY-SFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF-SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYP--IDREKTSTITFF---VESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESI 2282
            F  DS + L  V++ +DRE +   ++ L              + D   + +     S+ + V + DENDN+PVF  V T    I EN P G  + +      A D D    +  +Y L     LG SS + L    +  V  + +   LDRE         T++  DG  G RN     + + + D+NDN P F        + EN        I+V   D D    + G +   + + G    N  F    +D+S G +      +  +DYE     +   +VA D      +++  LR+ +   N++  ++ F     Q     ++ E  +   ++  V    A  M  +    L  P  IL+    E+ R +        +    Q  + T   +DREA      DS ++  +  D    E I + TN   A +++ + D NDN P+F   +    ++ E+     +     +HA D+D   NG V+   H              I +++G  I +    DF EK S +  F +VA D G P R S++  + V + D NDN P F S   +A  V E    G L+  + ATD D+ P  + + F ++S   ++    +++ P  G IR      IDRE  +  T     V+  NP      L   A++ + V D+ND  P F     +  Q +  LE+L  G    ++
Sbjct: 1440 FYADSQTGLVYVNRPLDRERVAEYRLTLT-------------VRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQV-TYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSL-----LGGSSAYFLIDRDRGNV-SMALGQGLDREGIPGGRLELTILVQDG--GRRN-ATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGG----NDTFG---IDESTGLIV----TVAPIDYET-RPEYLLMVVATDQAPPFHTASCELRVSLQ--NELDEKLSFSLAAYQA----ALSEAAVPGTVVVRVA---APQM--KAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREAT-----DSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLT--VLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPR-STTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQ-VTFRIESGGGDK----LSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPP-----LSGSAIVRVLVDDVNDERPAFL----APVQTVSVLESLSVGSFVATV 2082          

HSP 6 Score: 93.9745 bits (232), Expect = 1.573e-19
Identity = 127/504 (25.20%), Postives = 209/504 (41.47%), Query Frame = 3
Query:  768 TEITIKIRDINDNAPKFERPIY--IRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNS---LSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLT--PRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLS----SSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLI----GQINATDRD---------SLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            T + I+I D NDNAP F    Y  + T   +     +  +  +D DE +N R+   + +      N   T  I D   G + A    +  LD+E     +   + A D  R+    L+STAT+ + + +VND++P   F+R+ +   G   + EG    +I  ++  SD DS +N +L+ S++   PRN  +I  +             +R    +DRE    + +      T+   D     PLN+  ++ + + DV+DN P F        + E      +        A++  +    + +    F N   A Y   DSQ G +Y ++  D E+ + Y   +   D  +P+  S     S  +IV I D+NDN+P FSQ  +   + EN   G ++    G I A+D D         SL       F++  D  N +  L       GQ   R  I   +   +T  V+                + +TV D+ND+ PTF
Sbjct: 1156 TSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSG-----NTAATFGI-DNGTGVLTA----VKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPW--FLRSYE---GPIDVSEGQPGPRIATFM-ASDQDSGLNGELEYSIIDGDPRNEFVISPAD--------GDLRVRRYVELDRETQAFYNL------TIMAKDMGTP-PLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFY--ADSQTGLVYVNRPLDRERVAEYRLTLTVRD--NPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMAL-------GQGLDREGIPGGRLE-LTILVQDGGRRN------ATVRLGVTVLDVNDNTPTF 1610          

HSP 7 Score: 79.7221 bits (195), Expect = 3.725e-15
Identity = 122/534 (22.85%), Postives = 212/534 (39.70%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRN-TGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE----QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDE-GTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYG------QIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSST--------------IIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRD 1955
            + V V D NDN P+F        ++ E    G  +    A D D      +    ++ F++ +    +L+    DG+  +   + +DRE  + YT  ++A+D   GN   +G   + + + D+ND  P F  P+   ++ E++ V      +   E+         K HN+  ++  KI         IGK    V A + L       + Y  F    VA D GR  L   A L +++L+VND  P      NG  +    +I E   +  +I+  + V   +     ++ S L    +   +   FR  +N      + T + +DRE+   +   S I++     D    +   +   + ++++D++DN P F      G       I E+        N +  A D D+  N  V Y I    N  N       S+ G +      D E    Y+ IV A+   +PN   + +T              + V ++D ND  P F+   +   V  + ++G  + Q+ A DRD
Sbjct: 1939 LSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDAD------AGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVD--RGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATEN--------YKGHNT--KYTYKI-------AGIGKNAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVV----NITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFR--INATSGI-ISTARALDRESQAVY---SLILL---ASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVS-GAVDADVGANAIVYYFIA-AGNEGNKFNL---SRWGLLVVLSDLDREVSPYYAIIVKASS--NPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRD 2427          

HSP 8 Score: 75.8702 bits (185), Expect = 4.772e-14
Identity = 150/625 (24.00%), Postives = 248/625 (39.68%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKL--GNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKF-ERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWIN--KIFTLDILDQSIGKVQAQVRAINN-LDYEQLYHSFEFKIVAQDGGRN---SLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDE----GTLSNKILAYVQVSDADSMINQ-LQCSLLTPRNI-LMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNA-AIHAADKDLHL--NGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPE------------HKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN--PSRIFNDLIQE--AMIVITVRDLNDSPPTF 2204
            + V V D ND  P F         + E +P G RI    A D D      S    EL + +  G+  + E      DG   +     LDRE  + Y  T++A D      N+  T + +++ D++DN P F   P      +   ++  + ++  +D +E  N    L+  +S   + N  + F  D         Q  +  +N  LD E++   +   +  +D   N   +   +  + + IL+ ND SP         Q+T    I E    GT+   +   +  SDAD  +N  L  SLL   +   +I+  R           S+   Q +DRE     +   ++ +T+   D       N    + + + DVNDN P F        + EN  +  V  +   + A D+DL +   G V Y I    N +    F ID   G I      D+E    Y  +VVATDQ  P   ++S  + V ++++ D    FS + +   + E    G ++ ++ A    + P+            H+D     K   Q  +     +  L G+I T+  +DRE T +    V S++  P      L  +  A + + V D ND+ P F
Sbjct: 1268 VSVHVADVNDVTPWFLRSYEGPIDVSEGQP-GPRIATFMASDQD------SGLNGELEYSIIDGDPRN-EFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLT-VGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQ--HSPTSFCNGERAFYAD--------SQTGLVYVNRPLDRERVAE-YRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVF------SQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDR--------GNVSMALGQGLDREG----IPGGRLELTILVQDGGRR---NATVRLGVTVLDVNDNTPTFNVTSQTAHVLEN--SPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDT----FGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFH-TASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHED-----KRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEF 1839          

HSP 9 Score: 75.8702 bits (185), Expect = 5.063e-14
Identity = 117/527 (22.20%), Postives = 211/527 (40.04%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIIT-STLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWI-NKIFTLDILDQS--IGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGG-RNSLS-----STATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQL--------QCSLLTPRNILMIEESRFRHPVNIYKQ-FSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNG--KIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATD 1949
            + V V D NDN P F +       +E +  +G  + + KA D D       + +  +    G +  F +     D    LI+T + +D E    Y   ++A D      +T   E+ + +++  D    F    Y   + E  +   +  + V         ++ L +    Q+W  +K       D +  I  +Q ++     LD E    S+   ++++DGG R +++       A + + + + ND SPE  F      +     + E      +L  +  +D D+  N            + + P+ IL+I+       V++ K  F  +T+Q I             +   V  D      P +T  ++ +I+ DVNDN P F     Y      +      + A++ A D D   NG+VT+ I+    S       I   +G  ++    + D E  + Y+ +VVA D+G+P  LS S+ + V + D ND  P F        V E++ +G  +  + AT+
Sbjct: 1596 LGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSI--ASGGNDTFGI-----DESTGLIVTVAPIDYETRPEYLLMVVATDQAP-PFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVV-VRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREAT-DSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPE--FEAGSATL---VEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFI-------------LFRIVALDG--GSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLV-ASVWATDADAGPNGQVTFRIE----SGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPP-LSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATE 2086          

HSP 10 Score: 74.7146 bits (182), Expect = 1.029e-13
Identity = 72/259 (27.80%), Postives = 114/259 (44.02%), Query Frame = 3
Query: 1473 PLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFE-KESIYSFIVVATDQGH--PNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTR--YPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQL 2234
            P     S+ I I D NDN P F    Y   + E  +   V + A + A+D D   N +V Y I    + + A  F ID+  G +   ++ DFE    +Y  +V ATDQ      RL+S++T+ V + D ND  P F +S+         + G  I    A+D+DS    +    I+  D +N       + P  G +R R    +DRE  +     + +K+       L     + + V D++D+ P F L  P+ + L
Sbjct: 1151 PAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAV-ANVTASDPDEGDNARVVYAI---VSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNE----FVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGT--PPLNSTLTVGVRVLDVHDNDPVF-LNLPANASL 1398          

HSP 11 Score: 65.4698 bits (158), Expect = 7.897e-11
Identity = 116/509 (22.79%), Postives = 196/509 (38.51%), Query Frame = 3
Query:  423 SNFIRVFVDDENDNNPVF-PIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRN-TGKTEITIKIRDINDNAPKFERP---IYIRTIKENVIVDPIFQILVTDEDEDENGRIDLK-MHNSG---QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRN-SLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVS-DADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIF------------IIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTY------HIQDFKNSSNAMY--------FRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVR 1838
            S  +RV VDD ND  P F   VQT   ++ E+  +G  +   K      AT +   +  +  +K+          H   G    ++TST  R   S   F L A+    G     G+  + +++ D+ND+ P F  P     +   +   +V  I ++L  D DE +NG +    +H  G   ++W  + F ++     I   +A       LD E     +   ++A D G+  S  ST  L++ + +++D  P    + +G      FSI E +     +  V  + DAD   N +    +   N    E ++F    N+ +   L    ++DRE +  + I       V+     N  P  T    F            + + D+ND  P FT + Y   +  +       +   + A D+D+  N  V Y      +I+   NSS  MY         R   ++G +     F       +   VVA D    N  ++    I+R
Sbjct: 2043 SAIVRVLVDDVNDERPAFLAPVQT--VSVLESLSVGSFVATVK------ATENYKGHNTKYTYKIAGIGKNAFTVHATSG----LVTST--RLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDW--ESFRINATSGIISTARA-------LDRES-QAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGN----EGNKF----NLSRWGLLVVLSDLDREVSPYYAI------IVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQ--LEAVDRDVGNNSIVLYRILSILYIKHSSNSSTRMYNIFTLGRCARAGERDGILRTYDLFTAYGPGYFMLEVVAADLAGHNDTATVGVYILR 2511          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 163.31 bits (412), Expect = 2.607e-41
Identity = 163/617 (26.42%), Postives = 277/617 (44.89%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVD--DENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFK-DGVPY--LIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQIL-VTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQL-QCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFII-INDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHF-----AFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT 2060
            + + ++D  +   + IDRE+ C            G   +C  ++ F + C         +   V+  D ND+ P F   +  +  I E+  LG R+PL  A+DLD    ++ +Y L+       +  F LA   + DG  Y  L++ S LDRE+   YT  L A DG +  R +G T + I + D NDN+P F +     T++E+     +   L  TD DE  NG +     +     + ++F    LD   GK+  +      LD+E L   +E  I A+D G +S+ +   + + + ++ND +PEI+     Q       + EG      +  V VSD DS  N L  C L    +  ++    +R        + + T  ++DRE     + D  +++       D   P    A  F + + D NDN P+F ++ Y   + EN N+   ++   + A D D   NG + Y++   +   +S + Y  I+  +G IY  +  D+E  +  +F V A D G P  L +++T+ VRI D+NDNAP  +            +  +  +G+L+  + A D DS    +    IV+ + +N    L  ++ L G++ T
Sbjct:   75 VHVEEADGTVSAREVIDREQQC------------GQAPSC--VIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEM-HVEISESVALGTRVPLEGARDLDVGGNALRAYHLD------ENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPR-SGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQ---LDPKTGKLSLK----GQLDHE-LNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLP---YR------DDYVVVTNSSLDREQ----MADYFLVLEAS----DGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLEN-NSPGAYVT-TVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPP-LVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERN----LFRINRLGGEVFT 637          

HSP 2 Score: 95.9005 bits (237), Expect = 2.335e-20
Identity = 116/488 (23.77%), Postives = 216/488 (44.26%), Query Frame = 3
Query:  780 IKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTP-----RNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENI-----NNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRF--IVKSD-SQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            +++ DIND+AP F R      I E+V +      L    D D  G   L+ ++  +   N+ F L +  ++ G   A++   + LD EQ    +  ++ A DGG    S T  +RI +L+ ND SP         Q +   ++ E      +L  +  +D D   N ++  S  +P     R +  ++           K   L     +D E N  + I      ++Q  D   + IP   +  + + + D+NDN P+   +       + +       +E F+   +  +D D   NG V  H++   +    + +R D     +  + S D E+ + Y  ++ A+D G P R+++     VR+ D+NDN P+F +S +   + EN   G  +  + A D D+  EH  +    +V+S+ +    S  ++++P +G I    P+D E  +++TF V++++       L+  A + + + D ND+ P
Sbjct:  124 VELLDINDHAPDFARSEMHVEISESVALGTRVP-LEGARDLDVGGNA-LRAYHLDE---NERFGLALRARTDGAKYAELVVKSRLDREQ-EGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVF------AQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDP----------KTGKLSLKGQLDHELNSEYEI------SIQARDMGPSSIP--AHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGL-VTVSDIDSAENGLVACHLRGHPHF-KLLPYRDDY---VVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQ-FTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADA--EHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDG--VPPLVTNATVSVRIVDENDNAP 571          

HSP 3 Score: 82.0333 bits (201), Expect = 4.728e-16
Identity = 66/239 (27.62%), Postives = 115/239 (48.12%), Query Frame = 3
Query: 1512 DVNDNPPKFTQNVYYGQIEENIN-NHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRID-SQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIK--DQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN--PSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            D+ND+ P F ++  + +I E++     V +  A    D D+  N    YH+ + +    A+  R D ++  ++      D E+E  Y+  + A D G P R   S T +VRI   D NDN+P F+Q+     V E+   G ++  +NATD D  P + ++ +   S       +L  LDP TG++  +  +D E  S     +++++  PS I         +++ V D+ND+ P  +L
Sbjct:  128 DINDHAPDFARSEMHVEISESVALGTRVPLEGA---RDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPR---SGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGP-NGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSI----PAHCKVLVHVEDINDNAPEIKL 355          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 3.179e-41
Identity = 160/596 (26.85%), Postives = 251/596 (42.11%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKH--FKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMI--NQLQCSLLTPRNILMIEESRF-RHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            +RV V D NDN P FP         +E+  +G ++ L  A D D     V+ +  ++    GN     +      K    +L  T  LDRE    Y   + A DG    R  G+ ++ + ++D NDN P FE+P Y  ++ E+  V    + L+        GR  L +                 D   G V  +      LD+E     +   + A DGG   LS  AT  IQ+L+VND  P IRFV          S+DE      + A V V+DADS     +L  S++        E   F  H   +     L+    +DRE    + +      T+   D    +  +  AS+ + +NDVND+ P+F  + Y   + E         +  + A D D  LN K+ Y I    + ++  +F +D   G +      D E  S     + A DQG   + + +S + V + D ND  P F+Q+ +     EN   G  +  ++A D D L E+  +R+    D   +  ++  LD LTG++ T   +DRE+       V++++  R    L   A + + V DLND+ P F
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKI--VSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDG-GSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLL------HRGRGPLAVP---------------FDPKTGMVSTR----QPLDFEA-RRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSA-SVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGN-----ERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNL------TILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKD--VTAMDADSGLNAKLRYSI---VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTS-LTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSD-LGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQD--RGSPPLGSTAKVTVVVGDLNDNHPVF 554          

HSP 2 Score: 153.68 bits (387), Expect = 6.997e-38
Identity = 136/520 (26.15%), Postives = 239/520 (45.96%), Query Frame = 3
Query:  669 LIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRI--DLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQ-LQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKD 2216
            +   + +DRE+ + Y   ++A  G       G+  +++ + D+N++AP F+R  Y  +I E+  V+   F +  TD+D  +NG +  ++   N G+++   IF              Q+     LD E     +   + A D G   LSS+ T+ + +L+VND  P    + N       F   E      ++  VQ +DAD+  N  +  S   P+    ++    R         SLR     DREA       +    +V   D     PL   A++ + + DVNDNPP+F ++VY   + E+ +N    +   + A+D D  +NG + Y I +         F +D+  G+I    S D E+ + Y+ +V ATD G  + L++S T+ V++ D+NDN P+F++S  +    E+  +G L+  + A+D D+ P   D+R+ + + + +       +D  TG +     +D E        V +++  R         ++V+ VRD ND+PP F   D
Sbjct:  713 IFTANAIDREEQAFYQLRVVANSG----GVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKF--GIFP-----------DGQLYVRYELDRET-REEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKP----LFNSSSYV--FHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGR-------IASLRV---FDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLR--VTASDVDEGVNGALRYAINEGNEGGK---FTVDASTGQITLLGSLDREETASYTLVVSATDSGT-SPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPS-GDVRYAIVAGNTH---ATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRS--SATILVVHVRDFNDNPPAFLPGD 1186          

HSP 3 Score: 149.443 bits (376), Expect = 1.613e-36
Identity = 184/721 (25.52%), Postives = 315/721 (43.69%), Query Frame = 3
Query:  228 FMSTVINN---GLFIL-----DSD--SNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCH-----------ILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITS-TLDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQ------EWIN-KIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQI--EENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEK------ESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICE 2276
            +++T + N   GLF++     DSD   N  V    D +     + M +L+ + G + T              ++  Q   +     +  + V V D NDN+PVF  VQ  + +I EN+P G  +    A D D        Y+L      G+++ F++     + V   + T  +LDRE+ ++Y   + A+DG  G+ R      +TI + D  D  P F R  Y   + ENV    +    V+    D N  +   + +  Q      EW   +IFT + +D+                 EQ +  ++ ++VA  GG   ++  A++ + + +VN+ +P   F R   ++    SI E    N     V+ +D DS  N              I E        I+    L     +DRE  E + +      TV   D   E PL+++ ++ + + DVNDN P F  + Y      E+ + +    +  A+ A D D   NG VTY  +  +     + F +DS+ G+I + + FD E        + +SF VVATD G P  L   +T+ V ++D NDN PQF++S +   V E+      + ++ A+D D    +  +R+ +  +  N   K  T+D  TGQI     +DRE+T++ T  V + +     + L     + + V D ND+PP F       ++ ++S++ L+  ++ E
Sbjct:  451 YVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQY-FASILENEPGGTAVTTVTATDPDRGANGTVRYQL----TAGDAARFQV-----NAVTGAVSTRVSLDREERAVYQLQVTALDG--GHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGS-VSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDRE----------------EQAF--YQLRVVANSGG---VAGEASVSVLVHDVNNHAPV--FDRASYEV----SIAEDEPVNSRFFSVRATDKDSGKNG--------EVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSL------TVSAMDTGVE-PLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGS----LVGAVQATDADAGSNGGVTYSFEKPQ-----VNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDE-GVNGALRYAI--NEGNEGGKF-TVDASTGQITLLGSLDREETASYTLVVSATDSGT--SPLAASCTVAVQVLDENDNPPRF-------TESLLSVDALESTRVGE 1094          

HSP 4 Score: 146.362 bits (368), Expect = 1.479e-35
Identity = 153/615 (24.88%), Postives = 260/615 (42.28%), Query Frame = 3
Query:  426 NFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP------IFQILVTDEDEDENGRIDLKMHNS-GQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP--LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQ------DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN---PSRIFNDLIQEAMIVITVRDLNDSPPTFRLK 2213
            N + + V+D NDN PVF + +     +EEN   G  I    A D D    ++ +Y +       + S+         GV  L  +  LDRE+ + Y  T+ A DG           +++ +RD NDN+P+F R  Y   + E+   D       I  +L  D D    G +   +  S   +W +  F L         V   +     LD E     +  +  A DGG   L++TA L + +L+ ND +P +      Q  +    + E       L  +  +D D  +N +L+ S+ +        E RF     +     L   + +DRE        S   + V+  D     P  L++   + +I+ DVNDN P FT        E++     V   A + A D D   N  V Y +            +    F +++  G++   +  D E    Y+  V+A D+G P  L+S++T+ V + D NDNAP+F +  +   + E+   G  + +++A D D    + ++R+ + S      +    LDP+ G +    P+DRE+T++    V +++   P+R        A + +T+ D+ND  P F+L 
Sbjct: 1500 NQVEISVEDVNDNPPVFAVPEM-ELEVEENTGEGEVIFTLSATDADQGQNALVTYSVL------SGSEGAFVVDAASGV--LRASRRLDREERASYLLTVRASDGTHAT----DARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLH-------PVTGALNVTRPLDRES-RACYVLRARATDGG--GLAATARLYVNVLDANDNAPSV------QNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISS-----GDPEGRF----AVGNDGQLSVARALDRERQ------SFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVV---ATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPP-LTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDE-GANGELRYDIASGDP---TGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPAR-----SDTASVRVTLSDVNDCSPAFQLS 2057          

HSP 5 Score: 139.813 bits (351), Expect = 1.531e-33
Identity = 175/658 (26.60%), Postives = 282/658 (42.86%), Query Frame = 3
Query:  270 SDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPY-CTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAID-GVEGNRNTGKTEITIKIRDINDNAPKFERPIYI-RTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYH-----SFEFKIVAQDGGR-NSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTST---ITFFVESKN-PSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            S   +  +  IDREE    Q   QL  V  S                       + V V D N++ PVF   +  Y  +I E++P+  R    +A D D      S    E+ +++G  +  E    F DG   L +   LDRE    Y+ T+ A+D GVE    +    + + + D+NDN P F    Y+    +E  +   +  +  TD D   NG +        +  +N  F LD      G++ A +R     D E L       SF F +VA DGGR   L   AT+++ + +VND  P+  F ++  Q     S+ E   +   L  V  SD D  +N      +   N    E  +F    +   Q +L    ++DRE    + +       V   D     PL  + ++ + + D NDNPP+FT+++      E+    E+ +   + A+D+D   +G V Y I     +++A  F ID   G ++ ++  DFE + +Y   V A D G P R SS++ ++V ++D NDN P F        + EN+ IG  +  + A D D+   + ++ + +    Q       T+DP +G+I T   IDRE T     +T     K  P       ++   +++T  D ND+ P F
Sbjct:  709 SGGRIFTANAIDREE----QAFYQLRVVANSGGVAGEA---------------SVSVLVHDVNNHAPVFD--RASYEVSIAEDEPVNSRFFSVRATDKD------SGKNGEVKYEIGEGNGGEKFGIFPDG--QLYVRYELDRETREEYSLTVSAMDTGVE--PLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE---KPQVN--FELD---SETGRI-ASLRV---FDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQ--FAKSVYQA----SVSESASNLTQLLRVTASDVDEGVNGALRYAINEGN----EGGKFTVDAST-GQITL--LGSLDREETASYTL------VVSATDSGTS-PLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLIT--LTASDEDTGPSGDVRYAI--VAGNTHAT-FAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPR-SSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDA-DVNGELHYSIA--RQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVT--DENDNAPRF 1292          

HSP 6 Score: 132.109 bits (331), Expect = 3.504e-31
Identity = 149/596 (25.00%), Postives = 255/596 (42.79%), Query Frame = 3
Query:  450 DENDNNPVFPIVQTP----YCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNS-SDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQ-ILVTDEDEDENGRIDLKMHNSGQE--WINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSP---EIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            D NDN+P    V  P      +++E+   G    L    D D+ T   ++ +L +    GN    F L      G+  L + S LDRE+  MY  T++A D  +    +    + + + D+ND+AP+F    Y   + E        + +   D D   N ++   +  SG +  W +       +D+S G V         +D E +  S    I AQD G    ++  +L + +L+VND  P   + ++V             E +L    +  V  +D+D   N        P       E  FR      K   + T +++DRE  E + +       VQ  D  +  PL + A + +++ D+NDN P F    Y+  I E  N         + A D D   NG V Y +     + +A  F++++  G +    S D E+ ++Y   V A D GH  R  S + + + + D  D  P F++  ++F V ENV  G L+G ++A+   +L  + ++ +++ S  Q R S   +++   G+I T   IDRE+ +     V + +       +  EA + + V D+N+  P F
Sbjct:  217 DVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPT---ANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIV-SGNDLGWFS-------VDESTGLVTTD----GKVDRE-VASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAV---------ENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYRE-MFRLDSLTGK---VTTLKSLDREELEEYPL------VVQAQDRGSP-PLGSTAKVTVVVGDLNDNHPVFYPVQYFASILE--NEPGGTAVTTVTATDPDRGANGTVRYQL----TAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGH-LRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSAS---TLDLNANVTYLIVSGDQ-RGS--FSIEWSGGRIFTANAIDREEQAFYQLRVVANS-----GGVAGEASVSVLVHDVNNHAPVF 758          

HSP 7 Score: 97.0561 bits (240), Expect = 1.738e-20
Identity = 70/248 (28.23%), Postives = 115/248 (46.37%), Query Frame = 3
Query: 1473 PLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVE-----IGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPT 2201
            P+++   + I + DVNDNPP F       ++EEN    EV     + A D D   N  VTY +     S  A  F +D+ +G +  S+  D E+ + Y   V A+D  H    ++ + + V ++D NDN+P+FS+  ++F V E+          +IG + A D DS P  +    +  S+  + A     L P+TG +    P+DRE  +       + +       L   A + + V D ND+ P+
Sbjct: 1495 PMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFT--LSATDADQGQNALVTYSV--LSGSEGA--FVVDAASGVLRASRRLDREERASYLLTVRASDGTH----ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATD----GGGLAATARLYVNVLDANDNAPS 1728          

HSP 8 Score: 61.6178 bits (148), Expect = 1.102e-9
Identity = 63/248 (25.40%), Postives = 99/248 (39.92%), Query Frame = 3
Query: 1494 IFIIINDVNDNPPKFTQ-NVYYGQIEENIN-NHEVFMNAAIHAADKDLHLNG--KVTYHIQDFKNSSNAMYFRIDSQNGKIY--NSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITF---FVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            + +++ DVNDN P F +  V     +E+     +V ++ A+   D+D+  NG     Y I         +  R  ++   ++   +   D E    Y+  V A D G P R      + V ++D NDN P F +  +   V E+  +G  +       RD L  H+            R    +  DP TG + TR P+D E     T      +  NP      L   A  VI + D+ND+ P  R 
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAV---DRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQ-VNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-------RDLL--HR-----------GRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPP-----LSGRATAVIQLLDVNDNDPAIRF 227          

HSP 9 Score: 59.3066 bits (142), Expect = 6.120e-9
Identity = 116/535 (21.68%), Postives = 204/535 (38.13%), Query Frame = 3
Query:  669 LIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGG---RNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDV--NDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRI---DSQNGKIYNSQ------SFDFEKESIY----SFIVVATDQGHPN----RLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + +   LD E   +Y   + A DG    R++  T + + +RD NDN P F       +I EN+ I   +  +   D D D NG +   +    Q      FT+D           ++     +D E     FE  + A D         S+   + + + + ND +P  RFV     +  G     G+    ++  +Q SD D   N      +T  +  ++     R  +       + T+  +DRE+           + V   +     P    A   II N +  N   P+F Q+      E  IN   +     I      L L      H  D++     ++F +    ++   + N        SFD     ++    S +    D G  +     +SS + + + ++D NDN P F+       V+EN   G +I  ++ATD D   ++  + + V S S+        +D  +G +R    +DRE+ ++    V + + +        +A + + VRD ND+ P F
Sbjct: 1134 VFLARRLDFETQRLYRLNVSAEDGGRPPRSS-ATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIAR--QFPPGAHFTID-------PESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAP--RFVTPTAILVDGLRAAAGS----VVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGI-------IETSTELDRESGH-----GAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQD-----YESPIN---LLQGQTIPMPSSYLFLR-----HHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQ-GQNALVTYSVLSGSEG----AFVVDAASGVLRASRRLDREERASYLLTVRASDGTH-----ATDARLSVAVRDANDNSPRF 1617          

HSP 10 Score: 55.8398 bits (133), Expect = 6.507e-8
Identity = 46/165 (27.88%), Postives = 70/165 (42.42%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP--IFQILVTDEDEDENGRI 920
            + V V D NDN P FP  +     I E++P G  +    A D D        Y +      G   DF L          L +   LDRE+T+ Y   + A DG  G   +    + + + D+ND +P F+   Y    +EN    P  I Q++  D+D   +G++
Sbjct: 1935 LAVTVGDANDNAPRFPRREY-EAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTG---DFRLDPVLG----TLAVARPLDRERTASYELAVRARDG-GGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQV 2090          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.221 bits (391), Expect = 9.941e-39
Identity = 181/690 (26.23%), Postives = 286/690 (41.45%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVC---GSIHTCCHILDFQISCNNEEMQSNFIRVF-----VDDENDNNPVFPIVQTPY--CTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLEL---------PFKLGNSSDFELAKHFKDGV-------PYLIITSTLDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIY--IRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDIL--DQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVR-NGQQIT-GGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQ--------NVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNS-SNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF------SQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            L V+ ++DRE LC     ++    C   G +HT       Q++   +   S+ +R+      V D ND+ P F   + P+   +I E++ +G R+PLP+A D D  T S+  Y++           PF L  S D +                  L +   LDRE    Y   L   DG  GN + +G   +TI + D NDNAP F  P    +R  + + +   + Q+   D D   NG I    H      +  + T   L  D + G V   VR    LD E +       +VA+DGG+ S S++ T+ +++ + ND +P    +   G+ +  GG  I E   S   +  + VSD D     L  S      +     +    P  +  QF L+TT+ +D E  + +         V     D   P L+   ++ I + D+NDN P F           VY   + EN     V +N  + A D D   NG +T+ + +     S A  F ++ + G++  +   D EK   Y   V A D G P R  + + + V + D+NDNAP F      +   + FFV+E   +G  +G ++ +D D     +    +V+    +        D   G +RT   +DRE        V + +  R    L     + ITV D ND+ P  
Sbjct:   83 LSVALRLDREALC-----MEEPDACRSTGFMHT------VQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAF---RAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDG--GNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTK----LTSLATQAALHVDGTTGLV--TVRNAEKLDRETM-PVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPD-----LGSSGTVDVRLEFPTGAELASPNKV--QFLLKTTRLLDYEEAQQY--------NVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLN--LLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQR-KARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGG--AGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGR--PALSASCRVSITVSDTNDNAPVI 727          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 186.037 bits (471), Expect = 1.185e-47
Identity = 195/660 (29.55%), Postives = 295/660 (44.70%), Query Frame = 3
Query:  312 ELCPPQMMLQLNKVCGSIHTCCHI-------LDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCT--IEENKPLGYRIPLPKAQDLD---NAT--FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITST-LDREKTSMYTFTLIAIDGVEGNRNT----GKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEW----INKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFV----RNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFII-INDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            E  P Q     N   G I T   I       +  Q+   N   Q   ++V VDD NDN P FP   T Y T  I E+  +    P+  A D D   N T  ++++S      F LG ++          G    +IT   LDRE T  Y   + A D     R T    G   I I I D ND+AP F +  Y+ +I EN      I ++   D D   NG I   +     +W     N IF LD    S G +    R   NLD+E + +S+ F ++A DGG  S +  AT+ I +L+ ND SP+++       NG +        E +L N  +AY+ V+D DS  N      +T  +    +E  F+  V     + ++  + +DRE   PF         +  +  D  +P  +     +I + DVNDN P FT N Y   I E   N    +   ++A D D   NG V+Y I      ++  +F++D Q+G +  ++  D E+ S  +  + A D G   + + S+T+ V I D NDN P+F +S +   + E   IG  + Q++ATD DS    +    I  SD+Q   + L  L+  TG + T+  +DRE  S  +F V +K+       L+    + +T+ D+ND+ P F
Sbjct:   36 EGSPKQ--FGFNSNTGVISTTARIDRETTTQISLQLRTLNPSNQPISVQVQVDDINDNEPRFP---TLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTA-------CPTGSTLCVITKKPLDRETTDFYQLNITATD-----RGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI-----DWDAIQSNSIFDLD---SSTGVI----RTKQNLDFE-VKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAI----RSENSLINTNIAYILVTDKDSNTNSQTELKITNGD----DEGCFK--VEFLGFYFIQLQKPLDREL-VPFY-------NLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQ--LNATDPDEGDNGTVSYSI---TGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPK-TGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQ--VNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGD--PQLMSSVKVELTISDINDNAPVF 637          

HSP 2 Score: 114.005 bits (284), Expect = 1.817e-25
Identity = 157/577 (27.21%), Postives = 255/577 (44.19%), Query Frame = 3
Query:  252 GLFILDSDSNL-KVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPY-CTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHF----KDGVPYLIITSTLDREKTSMYTFTLIAID-GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNA-MYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS 1958
            G F +D  S L   +K +DRE         Q++ V  +I    H        +  +  S  + V + D NDN P F  +++ Y  TI E   +G  +    A D+D+      +Y++       +SSD ++   F    + GV  L   S LDRE  S+Y+FT++A D G     ++ K E+TI   DINDNAP F    Y  +I EN     + Q+  TD DE  N  I   +        N  F+   +D S G +      + +LD+E +   F   I A+DGG    + TA + + +LN  D  P   F+      T   ++ +GTL  ++  Y    D +  I+    S   P N+ +++ +     +N           ++DRE    +L+   +I  V         PL+  A++ I + D NDN P+F+ +     I+      +V  NAA  A D D   NG V Y +     +SNA     I+S +G I  ++      E+ Y+  V+A+D G P +    ST+ + I    ++ P+F+ S +   V  +  + +    + A D+DS
Sbjct:  471 GWFQVDFQSGLVTTAKPLDRE---------QVSSVTITITAQDH-------GSAPKTGSTTVTVTIIDGNDNKPRF--MKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEI-------SSSDAQVNGLFELNTQTGV--LWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTIS--DINDNAPVFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNN---NGNFS---IDSSTGVIS----TLASLDHE-VEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLP--VFLYEMYNFTVYENVPKGTLVGRV--YATTKDKNGSISYAIVS-GDPTNLFLVDSTGGIIKIN----------GDMDREEKAQYLL--AVIARVGTVK-----PLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAA--AVDLDAGKNGLVRYQL-----TSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQ---HSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDS 975          

HSP 3 Score: 110.538 bits (275), Expect = 2.205e-24
Identity = 172/654 (26.30%), Postives = 267/654 (40.83%), Query Frame = 3
Query:  297 QIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSN--FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLG--YRIPLPKAQDLDNATF---SVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYE--QLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSP------EIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNA-AIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQN-DNAPQFSQSHFAFFVDENVEIG-HLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTST----ITFFVESKNPSRIFNDLIQEAMIVITVRDLN 2186
            ++DREEL          K  GS     +I+  +   N+  ++ +   + V V D NDN PVF          E + P    +RI    A + DNA F    VS   ++  F   ++ +  L+K             TLDRE TS Y   + A D    N  +T K EIT+   D ND  P F    Y   I E+ ++   +  +  +D+D  +NG I   + N     +  +F ++           ++    +LD+E  QLY   E  I AQD G   LSST  + + +L+VND +P          VR  + +  GF +   T S++         A SM +Q      TP     +  +             + T   ID E   P   DS  +V +  D       L+T  SI + + D NDN P F        +          +N   I A D D + NGKVTY I     S N  YF +    G++        +  +IY   + A+D G P+R   + T++   K+      P FS + +   V EN   G  ++  + A  + SL  + +I + + SDS     +++     TG ++T   IDRE        + + V+ + PS         A + ITV+D+N
Sbjct: 1110 RLDREELI---------KNTGS---NVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSK-------------TLDRETTSSYNLVVKATDASNANLYSTAKIEITVG--DSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGN---LAAMFDVE-------SATGRLIVAKSLDFETTQLY---ELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVR--ENVNTGFPVGRCTASDRDTG-TNAHIAFSMYSQ------TPSKTFSVNSATCE----------ITTIAAIDLET-MPAGRDSFQLVVMATDQ--GSPKLSTRKSITVQVTDENDNSPGF--------VSPPAAAAGSSLNVMTITAEDPDRNSNGKVTYSII----SGNNGYFNLHPSTGQLQMIHQIP-DNPTIYQLTIQASDGGQPSR--QTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSL--NGNIEYYLTSDSSKGGFEVV---KSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSA----RTSSATVTITVQDVN 1677          

HSP 4 Score: 108.612 bits (270), Expect = 7.297e-24
Identity = 160/661 (24.21%), Postives = 280/661 (42.36%), Query Frame = 3
Query:  255 LFILDSDSNL-KVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLE-----LPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAID-GVEGNRNTGKTEITIKIRDINDNAPKFERPIYI-RTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFII-INDVNDNPPKFTQNVYYGQIEE-NINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAM-YFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            LF++DS   + K++  +DREE    Q +L +    G++      L  Q + N E +          D NDN P F    +    I+    +G  +    A DLD     +  Y+L      L +    S   +LA+   DG               + YT  ++A D G     +T    IT+ I    ++ PKF    Y+   +    +    F ++  D+D  +NG++   +    +E +  IF         GK+  +   +     + L  S++  + A DGG  S S++  + I I + ND      FV N  +     +   GTL   ++A+       S    +  SL++        ES F   V   +   + T   +DRE  E        +  +Q +   N+  +  + +I I+ + D+NDN P F++ VY   + E ++    VF    I A D D   N K  Y +     S   M  F I+S  G+++ S++ D E  S Y+ +V ATD  + N L S++ I + + D ND  P F +S +   + E+  IG L+  +NA+D+D + ++  I++ +   S    + +  ++  TG++     +D E T      + +++   I   L     + + V D+ND+ P F
Sbjct:  786 LFLVDSTGGIIKINGDMDREEKA--QYLLAVIARVGTVKP----LSAQATVNIEVL----------DRNDNAPQFS-TSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDG-------------DETQYTVQVLASDSGSPPQHSTMTIHITLSI----NHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIF-------PGGKLYIRKSLL-----QALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRS--LFVNNTFRFAVAENSSPGTLVGTLVAHAL---DHSRTKDIVYSLIS-------SESHFAVDV---RSGQITTRVRLDRE--ELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFR---IKAMDADEGDNAKFFYSLV----SGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNAN-LYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKD-IGQNGLIKYSI---SNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLI--PLSSTVNVTVNVLDVNDNAPLF 1369          

HSP 5 Score: 107.842 bits (268), Expect = 1.267e-23
Identity = 145/550 (26.36%), Postives = 235/550 (42.73%), Query Frame = 3
Query:  426 NFIRVFVDDENDNNPVFPIVQTPYCT-IEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITST-LDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNI---LMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIR 2057
             F+ + V D NDN+P F      Y   I E    G  +    A D D       SY +     LG    F++   F+ G   L+ T+  LDRE+ S  T T+ A D     + TG T +T+ I D NDN P+F +  Y  TI E   I   + Q+  TD D  +NGRI  ++ +S  + +N +F L+     +       R   +L        + F ++A+D G   L S+  + + I ++ND +P    V          SI E     K+L  V  +DAD   N +    +   N      I+ S             + T  ++D E  E F +       +   D  N+    T      ++N   DN P F   +Y   + EN+    +     ++A  KD   NG ++Y I     ++    F +DS  G I  +   D E+++ Y   V+A   G    LS+ +T+ + + D+NDNAPQFS S     +D    +G ++    A D D+  ++  +R+ + S+    A  L+ ++  +G I+
Sbjct:  409 GFVLIDVTDVNDNSPAF--TSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGW---FQV--DFQSG---LVTTAKPLDREQVSSVTITITAQDHGSAPK-TGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQ-VNGLFELNTQTGVLWTKSQLDRETKSL--------YSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFA------SIMENEPPGKLLQ-VTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGV----------ISTLASLDHEVEEFFSL------IISAKDGGNKYAAKTAVVNVTVLNKA-DNLPVFLYEMYNFTVYENVPKGTLV--GRVYATTKDK--NGSISYAIVSGDPTN---LFLVDSTGGIIKINGDMDREEKAQYLLAVIAR-VGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDA-GKNGLVRYQLTSN----AEGLLWINSTSGVIK 901          

HSP 6 Score: 93.9745 bits (232), Expect = 2.763e-19
Identity = 120/494 (24.29%), Postives = 207/494 (41.90%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRN-----TGKTEITIKIRDINDNAPKFERPIYIRTIKE-NVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMS---PEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNI-LMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFE----KESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQF 1871
            + +++ D ND+  +F +  T    + EN   G  +    A  LD++      Y L        SS+   A   + G   +     LDRE+    T + + I   E   N       K  + + + D+NDNAP F R +Y  T+ E ++   P+F+I   D DE +N +    + +     ++K F    ++ S G++         LD E    S+   + A D    +L STA + I + + ND     PE  +  N         I E  L   ++  +  SD D   N L    ++  N+  M +       + + K     TTQ  +              +T+   D+   IPL++  ++ + + DVNDN P F        + EN+N    F      A+D+D   N  + + +    + + +  F ++S   +I    + D E        +  +V+ATDQG P +LS+  +I V++ D+NDN+P F
Sbjct: 1036 VTIYIQDSNDHRSLF-VNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLI-------SSESHFAVDVRSG--QITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSG--TGMDKFF----INSSTGELHLS----KTLDRETT-SSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVN---------ITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYE--------------LTITAQDH-GLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTG--FPVGRCTASDRDTGTNAHIAFSMY---SQTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSP-KLSTRKSITVQVTDENDNSPGF 1478          

HSP 7 Score: 89.7373 bits (221), Expect = 5.227e-18
Identity = 83/286 (29.02%), Postives = 130/286 (45.45%), Query Frame = 3
Query: 1371 LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGH-PNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPID-------REKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            L  ++ +DRE    + +       V+  D  N   L + A I I + D ND  P F ++ Y   I E+     + +N  ++A+DKD+  NG + Y I    N + A  F ++S  G++  ++S DFE   +Y   + A D G  P  LSS+  + V + D NDNAP F        V ENV  G  +G+  A+DRD+   +  I F + S +    SK  +++  T +I T   ID       R+    +    +  +P      L     I + V D ND+ P F
Sbjct: 1216 LHLSKTLDRETTSSYNL------VVKATDASNA-NLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVIN--LNASDKDIGQNGLIKYSI---SNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIP--LSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDT-GTNAHIAFSMYSQT---PSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPK-----LSTRKSITVQVTDENDNSPGF 1478          

HSP 8 Score: 78.1814 bits (191), Expect = 1.548e-14
Identity = 155/638 (24.29%), Postives = 253/638 (39.66%), Query Frame = 3
Query:  381 ILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLD-NATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPI-FQILVTDEDEDENG--RIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVN-----DMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGK-VTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEK--------------ESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKD 2216
            I+  +   N    ++  + V V ++ DN PVF + +    T+ EN P G  +    A   D N + S +          G+ ++  L      G+  + I   +DRE+ + Y   +IA  G      + +  + I++ D NDNAP+F     I  I    +V  + +     D D  +NG  R  L  +  G  WIN          S   V    R + + D  Q    +  +++A D G     ST T+ I  L++N      +S  +  V   Q ++  F             YV   D DS  N QL  S+  P+     EE  F     I+    L   +++ +     +     +IV       D  +P  + +  + I I D ND+   F  N +   + EN +   +      HA D   H   K + Y +      S+  +F +D ++G+I      D E+              E++Y+   +  D+         + +IV + D NDNAP FS++ +A  V E    G  + +I A D D   E  + +F     S     K   ++  TG++     +DRE TS+    V++ + S    +L   A I ITV D ND  P F   D
Sbjct:  710 IISAKDGGNKYAAKTAVVNVTVLNKADNLPVF-LYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVS-------GDPTNLFLVDS-TGGI--IKINGDMDREEKAQYLLAVIARVGTV-KPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWIN----------STSGVIKLARKLTDGDETQ----YTVQVLASDSGSPPQHSTMTIHIT-LSINHPPKFTLSSYVTHVLASQPLSYQF------------FYVVAVDQDSGKNGQLFYSI--PQGN---EEGLF----GIFPGGKLYIRKSLLQALKGSY----DLIVRAT----DGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALD---HSRTKDIVYSLI-----SSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDK---------AIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDAD---EGDNAKFFYSLVSGTGMDKFF-INSSTGELHLSKTLDRETTSSYNLVVKATDASNA--NLYSTAKIEITVGDSNDQRPVFPESD 1268          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 184.496 bits (467), Expect = 3.905e-47
Identity = 189/662 (28.55%), Postives = 294/662 (44.41%), Query Frame = 3
Query:  267 DSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCC-----HILDFQISCNNEE------MQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIV-DPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEE---SRFRHPVNIYKQFSL-RTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            DS +N K+S  I         M   +++  G I T        I  + ++ N ++      M +  + + + DENDN P F         I E+ P G R+    A D D       +Y + +    GNS  F+L    + G+  L + STLDRE    YT  + A D     ++     I + + D+NDNAP+FE+ ++   I+E+  V   + Q+ V D+DE  NG I L +   G +     FT+D    S G V ++      LDYE    +++  + A+DGG  S S+TA ++I I+NVND  P   FV   Q      SI E    N  +  +  +D+D           TP    ++E    S F+    I +   L    + +DRE    +     ++V         E   N NA+I ++  DVNDN P F    Y   + EN+   +    A + A D+D   N KVTY +     S     F ++   G +   +  D E ++ YS  V A D G P++ S+ + I + I D NDN+PQFSQS +   V EN   G  I ++ A+D D+    +    I+  +  N       +D  TG+I     +DRE  ++    + +K+        +  A + ITV D ND+ P F
Sbjct:  713 DSGANGKISYSILSGN---ENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF--TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAI-ISGNQGNS--FQLDP--RSGI--LSVRSTLDRETIPSYTLVVKASDAGSPQQSI-TASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN----FTID----STGFVLSKTP----LDYETT-AAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPS--FVSPAQVT----SIPEDVAINTHVVKLNATDSDG----------TPLTFDIVEGNAGSSFK----IDQSSGLISVAKRLDRETTANY----TLVVRATETGSQGESVYN-NATIRVL--DVNDNAPVFNPGSYAKSLHENLPIGQTV--AKVTATDRDEGENAKVTYELSVGDTSK----FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQ-SAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGN----AFRIDSTTGRITVVGVVDREALASYNLTISAKDSG--VPPWVSTAFVAITVADENDNSPIF 1308          

HSP 2 Score: 159.073 bits (401), Expect = 2.594e-39
Identity = 173/642 (26.95%), Postives = 278/642 (43.30%), Query Frame = 3
Query:  327 QMMLQLNKVCGSIHTCCHILD------------FQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIF-QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRT-TQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHK-DIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFR 2207
            Q M  ++   GSI T     D             Q + N        + + V DENDN P FP+  +    I EN P   ++ +  A D D+ T +  +Y L   F    S + +   + K G   +   + LD E    YT  + A DG    ++T    + I + D+NDNAP F   +Y   + E+V V  I  Q+   D D   N R+   + +    +    FT+D         Q  +R     D E    S++  + AQDGG  S S  AT+ I+IL+VND  P    V +  Q T   S+DE       +  V  SD D+  N       T  N          H   +     + T ++++D E    + +   + VT +        PL   + + I +ND+NDNPP F+ + Y  +++EN           + A D+D   NG + + I   K + + + F ID   G I  ++S D+E ++ Y   V A D+G P +  ++   I  I+D ND++P FS S+++  + E+  IG  +  + ATD DS P  + + R I              +D  +G IR    +DRE T + +  VE+++             + I ++D+ND+ P F+
Sbjct:    9 QGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPL-NSYVFNIRENTPAA-QVAIVTATDRDSGTNAAITYSL---F----SGENKFMMNSKTG--EIRTVTPLDHETKDSYTMRISAFDG----KHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSY----FTVD--------SQGVIRTKGAFDRET-KASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRP----VFSSAQYTA--SVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNT--------NHAFTLDAVTGVVTVSRSLDFEQRSSYAL--GLSVTDR-----GSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTP-----AGTQVSATDRDSSTNGALVFGI--IKGNDDGV-FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIF-IEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLI-----SGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTS--RSSSTRVTIALQDINDNSPIFQ 584          

HSP 3 Score: 152.525 bits (384), Expect = 2.593e-37
Identity = 177/661 (26.78%), Postives = 294/661 (44.48%), Query Frame = 3
Query:  258 FILDSDSNL-KVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYC-TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITST---LDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKM--HNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            F +D  S L  V+K++DRE      ++++  +  GS     +        NN       IRV   D NDN PVF      Y  ++ EN P+G  +    A D D    +  +Y+L     +G++S FE+        P   + +T   LDRE  + Y+  + A+D  + ++ +    IT+ I D+NDN+P+F +  Y  T+ EN      I ++L +D D   NGR+   +   N G  +         +D + G++      +  +D E L  S+   I A+D G     STA + I + + ND SP   F  N       + IDEG      +A V  +D D   N Q+  S      I+  + S F   +N      L   + I+RE    + +      T++  D  + + + ++  + +++NDVNDNPP F    Y G + EN       +  A  A D D+  N  + Y I    + ++   F+I+S +G I  +   DFE++S Y   V ATD    ++ ++ + + +R+ + ND  P F+Q ++   V EN      + +++A+DRDS         +  S    + S   ++D  +G I T   +DRE  S     V   ++ NP      L     + I + D ND+ P F
Sbjct: 1042 FKIDQSSGLISVAKRLDRETTANYTLVVRATE-TGSQGESVY--------NNAT-----IRVL--DVNDNAPVFN--PGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL----SVGDTSKFEVN-------PATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQ-SAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFR--------IDSTTGRITV----VGVVDREAL-ASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP--IFASNETS----YGIDEGVSIGSRVAVVTATDRDEGSNAQVFYS------IVRGDTSAF--AINAMNGV-LTVKKEINRETVPTYTL------TIRASDRGSPM-MTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVA--ADDSDVGANAVLRYSI---ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD----SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGS------LSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPP-----LSNLTWVTIKILDENDNSPKF 1617          

HSP 4 Score: 150.599 bits (379), Expect = 1.061e-36
Identity = 175/657 (26.64%), Postives = 280/657 (42.62%), Query Frame = 3
Query:  258 FILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSS-DFELAKHFKDGVPYLI-ITSTLDREKTSMYTFTLIAIDGVEGNRN-TGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNIL--MIEESRFRHPVNI-YKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENIN-NHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            F +DS   ++     DRE     Q+ L+         +    ++ +I                 D NDN PVF   Q    +++E+  +G  +    A D DN     ++  L   F  GN++  F L     D V  ++ ++ +LD E+ S Y   L   D   G+   T  + + I + DINDN P F    Y   +KEN       Q+  TD D   NG +   +     +    +FT   +D S G +        + DYE     ++  + A+D G      TA + I I +VND SP        +QI       E T+    +  V  +D DS           PR  L   +     +   NI     S+R +  +DRE    +        ++Q +  D      +++  + I + D+NDN P F Q  Y  ++ E+ +  H++     + A D D   NG V Y + D     N   F I++  G I      D+EK++ Y   V A D G P+R SS + + V + D NDN PQF++S +   V EN+  G  +  + ATD DS    K I + + S ++N A     +D  TG+I TR P+DRE  ++ +  + + + S +    +    + I++ D ND+ PTF
Sbjct:  215 FTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEIL----------------DVNDNRPVFSSAQYT-ASVDEDVAIGAAMVTVTASDKDNG----NNADLRYSFTSGNTNHAFTL-----DAVTGVVTVSRSLDFEQRSSYALGLSVTD--RGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT--QVSATDRDSSTNGALVFGIIKGNDDG---VFT---IDGSTGIISIA----KSPDYENKTR-YDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIP------ESTVIGSTVVTVTATDLDSG----------PRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSY--------SLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQI---GQVAATDADDSSNGDVRYALSD-----NTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSR-SSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGK-ISYSILSGNENMA---FAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVR--FMAATTVNISIADENDNQPTF 790          

HSP 5 Score: 142.895 bits (359), Expect = 2.323e-34
Identity = 158/596 (26.51%), Postives = 278/596 (46.64%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCT-IEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKN---PSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + +F++D ND++PVF    + Y   I E+  +G  +    A DLD+       Y+L        S + + A +       + ++S LDRE T  Y+  + A DG   +R++  T +TI ++DINDN+P F+ P   R  + +     I Q+  TD D+  NG +   + ++       +F+++    S G +  + +    LDYE+    +   + A+DGG  S SS   +++ + +VND  P+  F ++    T G ++  G      + YV  +DADS  N ++  S+L+    +     RF   +         T   +DRE    + +      T+  DD  + +      ++ I I D NDN P FT    +   E++     V     + A D+D+  NG VTY I    N  N+  F++D ++G +    + D E    Y+ +V A+D G P + S +++I V + D NDNAP+F +S F+  + E+  +   + Q+   D+D          +    S N      T+D  TG + ++ P+D E T+     V +++   PS+        A + IT+ ++ND+ P+F
Sbjct:  464 VTIFIEDVNDHSPVFS--PSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLI-------SGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSS-STRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN-----TDVFSINT---STGLITLKTQ----LDYEKKTQ-YMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQ--FAKSLYTCTVGENLAAGVA----VCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEIT--------TRVPLDRETIASYSL------TINADD-GSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRV---GQLTATDRDIGPNGAVTYAIIS-GNQGNS--FQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQ-SITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN-----FTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSK-----SATAQVKITIINVNDNVPSF 997          

HSP 6 Score: 135.576 bits (340), Expect = 4.599e-32
Identity = 164/593 (27.66%), Postives = 272/593 (45.87%), Query Frame = 3
Query:  444 VDDENDNNPVFPIVQTPYCT-IEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLI-ITSTLDREKTSMYTFTLIAID-GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKEN-VIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIF-IIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            V+D NDN PVF    + Y + ++EN P G ++    A D D++T     + +    K  +   F +     DG   +I I  + D E  + Y  T+ A D GV    +T   ++TI I D+ND++P F    Y + I E+ VI   +  +  TD D    GR++ ++  SG   +   F +D    SI       R  + LD E    S+  ++ A+DGG  S SS+  + I + ++ND SP    +  G  +   F + E +     +  V  +DAD   N  ++ +L    ++  I  S            +L+T   +D E    ++    + VT +    D   P  ++ ++  ++++DVNDNPP+F +++Y   + EN+          + A D D   NGK++Y I     + N M F +D   G+I      D E  + YS  + A D G   R  +++T+ + I D+NDN P F+     F + E+   G  +GQ+ ATDRD  P       I+  +  N       LDP +G +  R  +DRE   + T  V++ +       +   A I ++V D+ND+ P F
Sbjct:  366 VNDINDNPPVFS--PSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGI---IKGNDDGVFTI-----DGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTA--QVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLI-SGN--VKGAFNIDANSGSI-------RVSSELDRETT-PSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP----IFQGPYV---FRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTST--------GLITLKT--QLDYEKKTQYM----VTVTAK----DGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAV--CYVTATDADSGANGKISYSI--LSGNEN-MAFAMDRFTGEITTRVPLDRETIASYSLTINA-DDGSLVRFMAATTVNISIADENDNQPTFTGPS-RFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNS----FQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSIT--ASIHVSVLDVNDNAPRF 894          

HSP 7 Score: 133.265 bits (334), Expect = 2.700e-31
Identity = 161/602 (26.74%), Postives = 260/602 (43.19%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPY-CTIEENKPLGYRIPLPKAQDLDNA-----TFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNI--LMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNT-NASIFIIINDVNDNPPKFTQNVYYGQIEEN--INNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            ++V VDD NDN P F   ++ Y CT+ EN   G  +    A D D+      ++S+ S    + F +               VP       LDRE  + Y+ T+ A DG    R    T + I I D NDN P F  P      +++     + Q+  TD D   NG +   + +  Q      F LD     +      VR+   LD E +  S+   + A D G    S TA++ + +L+VND +P  RF ++   +  G   ++ ++ + +L  V+V D D   N      L+        I+ + F           + +   +D E    +    ++ VT +    D   P  +  A + I I +VNDN P F        I E+  IN H V +NA     D D      +T+ I +    S+   F+ID  +G I  ++  D E  + Y+ +V AT+ G     S  +   +R+ D NDNAP F+   +A  + EN+ IG  + ++ ATDRD     K    +   D+         ++P TG + T+ P+DRE  ++ +  V + +  +     +  A I +T+ DLND+ P F
Sbjct:  671 VKVMVDDVNDNPPQF--AKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMD-----RFTGEITTRVP-------LDRETIASYSLTINADDG-SLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQ---GNSFQLDPRSGIL-----SVRS--TLDRETI-PSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAP--RFEKS---LFSGEIREDASVHSTVL-QVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGF-----------VLSKTPLDYETTAAY----QLTVTAR----DGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNAT----DSD---GTPLTFDIVEGNAGSS---FKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGE-SVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK-----FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAV--AAITLTINDLNDNSPQF 1203          

HSP 8 Score: 129.028 bits (323), Expect = 4.431e-30
Identity = 142/516 (27.52%), Postives = 230/516 (44.57%), Query Frame = 3
Query:  687 LDREKTSMYTFTLIAIDGVEGNR-NTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTN-ASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSK 2225
             DRE  S Y  T++A D    NR + G+T + I ++D NDNAP+F    Y+  I+EN     +  +  TD D   N  I   +  SG+   NK     +++   G    ++R +  LD+E    S+  +I A DG   +        + ++ V+D++    F       TG +   E      I+  +   D D  IN +L  SL++       + S F     +  Q  +RT    DRE    +    ++ +  Q    D   P  +  A++ I I DVNDN P F+   Y   ++E++      +   + A+DKD   N  + Y    F + +    F +D+  G +  S+S DFE+ S Y+  +  TD+G P  L+ +S +++ + D NDN P FS S +   V EN   G    Q++ATDRDS      +  I+K +       + T+D  TG I      D E  +     V++++  R        A + I + D+ND  P F   + SK
Sbjct:   28 FDRESESRYRLTVLAQDAA--NRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLF-SGE---NKF----MMNSKTG----EIRTVTPLDHET-KDSYTMRISAFDGKHTTF-------VPLITVDDVNDNAPFFALSVYKTGVY---EDVAVGSIVRQLTAVDLDVGINARLSYSLVSG------DTSYF----TVDSQGVIRTKGAFDRETKASY----QVALRAQ----DGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMV--TVTASDKDNGNNADLRYS---FTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSP-PLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDG----VFTIDGSTGIISIAKSPDYENKTRYDLTVQARD--RGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSK 485          

HSP 9 Score: 129.028 bits (323), Expect = 4.907e-30
Identity = 169/622 (27.17%), Postives = 288/622 (46.30%), Query Frame = 3
Query:  417 MQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVI-VDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNI-DREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV---ESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQG 2264
            + + F+ + V DENDN+P+F   +T Y  I+E   +G R+ +  A D D      S+ ++      G++S F +  +  +GV  L +   ++RE    YT T+ A D   G+   T   E+T+ + D+NDN P F    YI +++EN      +  +   D D   N  +   + +   E   K F        I      +     LD+E+    +  ++ A D   +  ++   + I+++N+ND++P   F +  Q  T   S+ E + ++  +  V  SD DS    L  S++  +     +  +F    +I ++  + +T ++ DRE    + I       V+  D  N  PL+    + I I D NDN PKF  + Y   I EN  +     +  + A D D   N ++TY++   +N +    F I + +G I  +Q  D E +S Y   + A D G P + +SS TI V + D ND+ P  + S     V EN      + +I A+D D+   + ++ F + S   N    + TLD  TG I T+ P+DRE+ +  T  +   +  NPS     L   A ++I V D +D+ P F+   P++  + IS E+L +G
Sbjct: 1289 VSTAFVAITVADENDNSPIFASNETSYG-IDEGVSIGSRVAVVTATDRDEG----SNAQVFYSIVRGDTSAFAI--NAMNGV--LTVKKEINRETVPTYTLTIRASD--RGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE---KRF-------KINSTSGVIMTTTPLDFEEKSQ-YGLEVTATD---SKYTAKTNVTIRVINLNDITPA--FTQ--QNYTA--SVRENSPTSTSVVKVSASDRDSF-GSLSYSIVGGK-----DSDKF----SIDQRSGIISTADVLDRELVSLYAIQ------VRVTDAGNP-PLSNLTWVTIKILDENDNSPKFDSSSYSSSILEN--SAPSSFSFKLAATDADEGTNARITYNLS--RNDA----FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQ-ASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADT-GLNAELTFSLLS---NEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPS-----LSSVADVIIDVIDEDDNCPRFQ---PTEYNVTIS-ESLPRG 1840          

HSP 10 Score: 104.76 bits (260), Expect = 1.211e-22
Identity = 126/520 (24.23%), Postives = 224/520 (43.08%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKL-----ELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKM---HNSGQEWINK----IFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRD 1955
            + V V+D NDN PVF   Q+   ++ EN      +    A D D    +V  Y +     E  FK+ ++S          GV  ++ T+ LD E+ S Y   + A D    ++ T KT +TI++ ++ND  P F +  Y  +++EN        + V+  D D  G +   +    +S +  I++    I T D+LD+                  +L   +  ++   D G   LS+   + I+IL+ ND SP+         I       E +  +     +  +DAD   N      L+  +  MI  S             +   Q +DRE    + +       +Q  D+    P  ++ +I + + D+ND+ P    +   G + EN       M   I A+D D  LN ++T+ +   ++ S    F +D+  G I      D E++++Y+  +   D+G+P+ LSS + +I+ + D++DN P+F  + +   + E++  G  I Q+ A D D
Sbjct: 1398 LTVVVNDVNDNPPVFN-SQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTS----------GV--IMTTTPLDFEEKSQYGLEVTATD----SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSV-VKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDR------------------ELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSIL------ENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGAS----------SGVITLAQPLDRENKSTYDL------AIQARDHGTP-PQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMR--ILASDADTGLNAELTFSLLSNEHKS---VFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPS-LSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 150.984 bits (380), Expect = 3.113e-37
Identity = 171/621 (27.54%), Postives = 266/621 (42.83%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPY-CTIEENKPLGYRIPLPKAQDLDNA-----TFSVSSYKLELPF----KLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKEN----VIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLI---TLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQ---EAMIVITVRDLNDSPPTFRLKDPSKSQL 2234
            + + V D NDNNPVF    T Y  T+ EN P+G  +    A D D+      T+SV++      F    K+ N    E+A +             LDRE    Y  T+ A DG      T      ++I D NDN PKF    Y  +I+EN    V V     I+ TD D + N  +  +++ S             ++   G +  +V    +LD+E+  + + F ++A D       S A + I +L+ ND +P  RF+ +  Q T    I E     + +A V  +D DS +N      +   +    E  R            +R + ++DREA   ++++    V+     Y    P     ++ + + DVNDN PKFT+  +   + E +    V +NA   A D D   N  +TY       S +   F I+S  G +  ++  D E +  YSF V A D G    L S+  + V I D+NDN+PQF    +   V +   +G ++  +NA DRD           V ++     + LI    + P TG I T   +DRE+ S  T      N S   + + Q    A++ I+V D ND+ P F   + S + L
Sbjct:  100 VSIVVGDLNDNNPVFN--PTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGN-------------LDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQF-------AVNPRTGVITTRVSPPPSLDHERTTN-YTFHVIAADQAGTGHESLAEVVIHVLDANDNTP--RFIPSSIQST----ISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGR--------SDGVVRVSGSLDREAKAVYVLN----VSAIDGSYS---PREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNAT--ATDPDQGSNAAITY-------SMSYPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGGG---LESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRD-----------VGNNGHVTYAILILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVL 653          

HSP 2 Score: 132.88 bits (333), Expect = 1.378e-31
Identity = 156/603 (25.87%), Postives = 259/603 (42.95%), Query Frame = 3
Query:  429 FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITS--TLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSID--EGTLSNKILAYVQVSDADSMINQ-LQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFI-----VVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
             +R+   D NDN P F   +    +I+EN   G  +P+  A  +      + S   ++ ++L  S   + A + + GV    ++   +LD E+T+ YTF +IA D   G  +    E+ I + D NDN P+F       TI E   I   + ++   D D   NGRI   + NSG E              IG+    VR   +LD E     +   + A DG  +      T+ + + +VND +P  +F +        F++D  EG     ++     +D D   N  +  S+  P   +                 S+  T+ +DRE  + +        TV   D      L +N ++ + I D NDN P+F    Y   + +      + +  A++A D+D+  NG VTY I         + F I    G I  S   D E++S+Y+ +     +  TD G   + +S + + + + D NDN PQF+QS ++  V EN+ +G  +  + A D DS    + +  +   D       + +++P TGQIR +  I+RE      + V      R    L  +A + + V D+ND+PP F
Sbjct:  210 LVRIL--DRNDNVPKFSHARYT-GSIQENSGPG--VPVQMASSIMATDRDIES-NADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQA-GTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSI-NSGSEG----------KFEIGRSDGVVRVSGSLDREA-KAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTP--KFTKPA------FNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGFAINSNTG------------SVTITRPLDRETKQAYSF------TVHARDGGG---LESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVL--AVNAEDRDVGNNGHVTYAIL-------ILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHG-VTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDG------VFSIEPSTGQIRLQKAINREAKE--NYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVF 746          

HSP 3 Score: 132.109 bits (331), Expect = 2.483e-31
Identity = 151/605 (24.96%), Postives = 260/605 (42.98%), Query Frame = 3
Query:  393 QISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENIN-NHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDE-NVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPP 2198
            Q    +E +    I V   D NDN P F I  +   TI E   +G  +    A D D+      + ++      G+   FE+ +   DGV  + ++ +LDRE  ++Y   + AIDG    R  G   +T+ ++D+NDN PKF +P +   + E V V   I     TD D+  N  I   M   G               +I      V     LD E    ++ F + A+DGG   L S   + ++I + ND SP+   V+    +     ID   +   +LA V   D D   N      +     +++ ++            ++ T+  +DRE    + +    ++ +   D+       + A + I + D NDN P+F Q+ Y   + EN+    +V M   + A D+D  +N ++ Y +     +     F I+   G+I   ++ + E +  Y   + A+D+G P  LSS + + V + D NDN P F+   +   + E N   G  + Q+NATD D +  +  + + +     + A  + T++  TG IRT+  ++RE     T  V +++   +    +    I + V D ND+ P
Sbjct:  309 QAGTGHESLAEVVIHVL--DANDNTPRF-IPSSIQSTISEAASIGQSVARVTANDPDSGL----NGRIFFSINSGSEGKFEIGR--SDGV--VRVSGSLDREAKAVYVLNVSAIDGSYSPRE-GYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGF--------------AINSNTGSVTITRPLDRET-KQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDV-----IDRTPVGTIVLA-VNAEDRDVGNNGHVTYAILILPFIIVPDTG-----------NINTSSKLDREQQSLYTL-VHYVLNLSVTDH-GVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTM---VTARDEDSGINSQIMYSL-----TGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTP-VLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDAD-VERNGHVTYTI----MHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAV--PYMDFGTIDVHVIDKNDNTP 849          

HSP 4 Score: 89.3521 bits (220), Expect = 4.910e-18
Identity = 85/280 (30.36%), Postives = 134/280 (47.86%), Query Frame = 3
Query: 1461 DNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRID--SQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIG---HLIGQINATDRDSLPEHKDIRF-IVKSDSQNRASKLITLDPLTGQIRTRY----PIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQ 2267
            D+ +P  +    + I++ D+NDN P F    Y   + EN       ++  + A D D   N  VTY +      S+ ++  +   S +G I  + + D E    Y+  + ATD G P   ++ +  +VRI D+NDN P+FS + +   + EN   G    +   I ATDRD +  + D+R+ +  SDS   A     ++P TG I TR      +D E+T+  TF V + + +   ++ + E  +VI V D ND+ P F    PS  Q  IS E    GQ
Sbjct:   88 DHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLD--VTATDADSGQNAYVTYSVT--AGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRD-IESNADVRYRLNGSDSIQFA-----VNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAE--VVIHVLDANDNTPRFI---PSSIQSTIS-EAASIGQ 351          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 145.206 bits (365), Expect = 5.039e-35
Identity = 159/592 (26.86%), Postives = 265/592 (44.76%), Query Frame = 3
Query:  459 DNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITS-TLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKEN-VIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPS 2222
            +N P F  +Q    ++ E+  +G  +    A D D+ +  +  Y +     L +++ F +     D +  +I T   LDRE    + F + A DG E +   G  ++TI + D+NDN P FER IY   I E+  I D +  +  +D D   NG +   + NS  +  N  F       SIG+V   V  +  LD E++  ++  ++ AQD G    S+T T++I +L+VND +P+  F +     T    I E    N+++  V+ +D D   N ++   +++  ++     +R    V        R  Q +D E    F     ++VT Q    D   P L    ++ I + DVNDN P+F  + +   I EN    + F    + A DKD   NG++T+         N + F I+   G I   +  D EK   ++F + A D+G P +   ++ I + + D NDN P+FSQ  +   + EN   G  + Q+ A D DS P +  +  IV S   +R  +   ++P  G I     ++        F V + +       L   A++ + V D N   P F+ +  S
Sbjct:   15 NNPPQFSRLQED-ASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSI-----DQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLE-GYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGD--NSAF-------SIGEVSGAVTVMKKLDREKV-PTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQ--FSKKVYSAT----IREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEV--------RVKQKLDYEMIGVF----NLLVTAQ----DKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYR--VQAYDKDHGTNGEITFSFMQ-----NDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFK-EGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNV-VYSIVSSSGHDRCFR---INP-QGLITLSCTLNYNTKHVYVFSVSASD-----GMLSSTALVYVNVTDSNTHAPEFKRRSYS 549          

HSP 2 Score: 145.206 bits (365), Expect = 5.394e-35
Identity = 164/593 (27.66%), Postives = 264/593 (44.52%), Query Frame = 3
Query:  444 VDDENDNNPVFPIVQTPYCT-IEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIR--DINDNAPKFERPIYIRTIKENVIVDPIFQ-ILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTN-ASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            V D NDN P+F   +  Y   I E+K +G  +   +A D D+ +        E+ + + NS     A    +    + +   LDREK   YT  + A D  +GN     T +T+KI   D+ND  P+F + +Y  TI+E+V V+ +   +  TD D+  NG +  ++ +            D+   SI ++  +VR    LDYE +   F   + AQD G+  L +  T+ I +++VND +P+  FV +  Q      I E     +    VQ  D D   N ++  S +       I E+             +   + +DRE    F    K          D  +P     A I I + D+NDNPPKF+Q  Y+  I EN       +   + A D D      V Y I    +S +   FRI+ Q G I  S + ++  + +Y F V A+D      LSS++ + V + D N +AP+F +  ++  V E+  +G  +  + ATDRD+    K I + + +          ++D  TG I+T   +DREK  T  F V + +       L  ++ + I + D+ND+ P F
Sbjct:  118 VLDVNDNGPIFE--RNIYAADIPEDKSIGDFVLAVRASDADSGSNG------EVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQD--QGNPPRSAT-VTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGN----------DMNFFSINRINGEVRVKQKLDYEMI-GVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQ--FVSSHFQTM----IPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINEN----------TGGISIKEELDREKVPKFTFGIKA--------RDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQ--VKAIDPDSGPT-NVVYSI--VSSSGHDRCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASD----GMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAK-ISYSIATLVPE-----FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHG--IPQLKAKSFVYIHIADVNDNDPVF 646          

HSP 3 Score: 125.946 bits (315), Expect = 4.182e-29
Identity = 153/593 (25.80%), Postives = 256/593 (43.17%), Query Frame = 3
Query:  450 DENDNNPVFPIVQTPYCT-IEENKPLGYRIPLPKAQDLDNAT---FSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAID-GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            D NDN P F  V + + T I EN  +G      +A D D+ T    + S  + +LPF +  ++          G+    I   LDREK   +TF + A D GV      G  +ITI + DINDN PKF +  Y  +I EN      + Q+   D D      +   + +SG +   + F ++         Q  +     L+Y    H + F + A DG    LSSTA + + + + N  +PE +      ++      ++ +L   +L  V  +D D+  N ++  S+ T     ++ E        +     ++T  ++DRE  + +  +    VT      D+ IP L   + ++I I DVNDN P F +  Y  ++ E+I      +   + A+D D+  N ++ Y      N      F IDS  G I   +  D E    Y   VVATDQG P   +S    ++ ++D  D+ P F +  +   V E+      +  + A  +D  PE   +  IV+ +S     ++  ++P TG I+T   +D E  S     V +       +    E  +++ ++D+ND+ P  
Sbjct:  331 DVNDNAPQF--VSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTG---------GIS---IKEELDREKVPKFTFGIKARDKGVPFKE--GTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHD---RCFRIN--------PQGLITLSCTLNYNT-KHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVK-----EDASLGTSVLT-VLATDRDTGSNAKISYSIAT-----LVPEFSVDETTGV-----IKTAGSLDREKVDTYRFE----VTAT----DHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIE--VSASDADIGKNAQIIYSFAS--NGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVI-LEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNS----PQVFDINPNTGAIQTLMKLDYETQSEYRLTVRA-----TLSPFFTETTVMVYLKDINDNTPVL 854          

HSP 4 Score: 83.5741 bits (205), Expect = 3.793e-16
Identity = 127/559 (22.72%), Postives = 229/559 (40.97%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCT-IEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLI-ITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSP---------EIRF-VRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEH-----KDIRFIVKSDSQNRASKLITLDPLTGQI 2054
            I + + D NDN P F   Q  Y T I EN   G  +   KA D D+   +V        + + +SS  +  + F+     LI ++ TL+     +Y F++ A DG+     +    + + + D N +AP+F+R  Y   +KE+  +   +  +L TD D   N +I              I TL + + S+ +    ++   +LD E++  ++ F++ A D G   L + + + I I +VND  P         ++R  +R G ++    + D     N  + Y   S+ D             +    I+ +          Q  +RT + +DRE    + +   ++ T Q        P   +  + +I+ DV D+PP F + +Y   + E+       +   + A  +DL     + Y I      ++   F I+   G I      D+E +S Y   V AT     +   + +T++V +KD NDN P     H    V E        G++    R  +P +       + F V    +  A + +TL+  +G++
Sbjct:  428 ITITLLDINDNPPKFS--QEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVV-------YSIVSSSGHD--RCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGML----SSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYS-----------IATL-VPEFSVDETTGVIKTAGSLDREKV-DTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDG------------QGTFTIDST----------QGIIRTLKPLDRETIPEYEL--TVVATDQ-----GTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVIT--VKAKSQDLSPETGMMYSIV---RGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRAT----LSPFFTETTVMVYLKDINDNTPVLEAFHMNINVQE--------GKVPPEARYKIPAYDPDVSDKLTFKVM---EGNAKEWVTLNATSGEL 909          

HSP 5 Score: 62.7734 bits (151), Expect = 8.263e-10
Identity = 91/412 (22.09%), Postives = 170/412 (41.26%), Query Frame = 3
Query:  324 PQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSN-FIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFK-DGVPYLIITS-TLDREKTSMYTFTLIAID-GVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIY----KQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPP 1532
            PQ ++ L+  C   +   H+  F +S ++  + S   + V V D N + P F   ++    ++E+  LG  +    A D D  + +  SY +             L   F  D    +I T+ +LDREK   Y F + A D G+   +   K+ + I I D+NDN P F +P Y   ++E++     + ++  +D D  +N +I     ++G       FT+D         Q  +R +  LD E +   +E  +VA D G     ++  +++ + +V D  P   F +   ++T    + E T     +  V+    D          L+P   +M    R   P  ++       +++T   +D E    + +  +  ++          P  T  ++ + + D+NDN P
Sbjct:  494 PQGLITLS--CTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFK-RRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIA-----------TLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLK--AKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDG--QGTFTID-------STQGIIRTLKPLDRETI-PEYELTVVATDQGTPPGQASVKVKVILEDVKDSPP--LFEKPLYEVT----VPEDTPPRSPVITVKAKSQD----------LSPETGMMYSIVRGNSP-QVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLS----------PFFTETTVMVYLKDINDNTP 852          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Nematostella
Match: EDO46484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ20])

HSP 1 Score: 145.591 bits (366), Expect = 5.366e-35
Identity = 157/661 (23.75%), Postives = 291/661 (44.02%), Query Frame = 3
Query:  258 FILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTE---ITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNS-GQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNG--KVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKE-SIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRT----RYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            F ++++  +K + Q+D E+L P     +L       +T  +      +C+        + + ++D ND+ P F +       + EN P+G  +   KA D D     V +Y L+        SD   A     G   L    + DRE  S+++  +IA D  +GN     +E   + + + D ND+ P+F++  +  ++ E+  +   I +++ TD+D  +N +++  +    G+ W   + T+    ++ G+VQ   R    LD+E    S+   + A DG     S+T  + I I + ND+ P    +     ++  ++     ++   +  ++V   D+    +Q +L    +   I     R     +       +Q +DREA   F  +      V             +A I I + D+NDN P+F  ++Y G +EEN       M    H  D D +L G  ++ Y + D         F+ID+    +   +  D E   + ++  V+ATDQG  N+LS++    + + D ND+AP F++  F   V E+V  G+++  ++ATD D+ P + ++ F+V   ++  A     +DP  G +       Y + +    T+T    S     + +D    A ++IT+ D ND+ P F
Sbjct: 2483 FSVETNGQIKTASQLDYEQLSPGDKTFKLQVRAQEENTNLYS-----TCS--------VAITLEDVNDDKPTFDLGNYD-ARVRENAPIGTTVITIKATDRDTGDAGVVTYFLKA------GSDEHFAIDVNSGT--LTTKKSFDREGQSLFSVIVIARD--KGNNPGALSEEVAVKVLVVDENDSPPQFDQAEFQTSVSESATIGTSILEVVATDQDIGDNAKLEYFISGGDGRFWF-AVQTISKSGRTYGEVQVDAR----LDFET-KSSYTIDVTATDG---RFSATTRVLITITDANDIVPMFMTLTTPTLLSPIYTGRVSEMTGSGVEVLKVYAVDTDSPNIQYTLEGSSSYFTIAA---RQEGGKFVGIISTGSQPLDREATPIFSFNVLAKDGVHTG----------SAYIEINVTDINDNQPRFPNSLYVGYVEENKAAGTSVMYVQAHD-DDDPYLGGNAEIRYTLTDNAGGK----FKIDANTALVTTEEILDRETSPNSFTITVLATDQGA-NKLSTTKVATIYVTDANDHAPVFTKRIFRGTVSEDVRPGYVVTSVSATDTDTGP-NAELEFVVTHGNEPAA---FYVDPSKGTVHVFDILNYTLRKSYNLTVTV---SDRGMPVLSDN-SPAYVLITITDANDNAPIF 3083          

HSP 2 Score: 122.865 bits (307), Expect = 3.757e-28
Identity = 155/611 (25.37%), Postives = 259/611 (42.39%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGN----RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVA------QDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFS------LRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGH-PNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNR-ASKLITLDPLT-GQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            +RV V+ +N   P F   +    TI+EN   G  I    A D D        YK+     +G    F +     +    +I TS+LDRE  + YT  + A DG  G     R      + ++++D+NDN P F    Y+ +I+    I   +  +  TD D  +N +I     +   ++         +D + G ++ +V      D  +     +  +VA      Q G  N+      + I I    D++P +               D+   + +IL  + V+      + L+ S   P    ++  S  +   +I ++FS      ++T   +D E   P     K+ V  Q ++ +    L +  S+ I + DVND+ P F    Y  ++ EN       +   I A D+D    G VTY    F  + +  +F ID  +G +   +SFD E +S++S IV+A D+G+ P  LS    + V + D+ND+ PQF Q+ F   V E+  IG  I ++ ATD+D     K   FI   D +   A + I+    T G+++    +D E  S+ T  V + +             ++IT+ D ND  P F
Sbjct: 2206 VRVNVEYKNMYRPEF--TKCGKATIQENLLKGQLIATVTATDRDQGRNGEVEYKI---VPVGGQDFFTINNKTGE----VITTSSLDRETKATYTVIITAEDGGHGKDPAERLMSYCFLEVEVQDVNDNYPSFITRAYLGSIQNTKPIGTSVLTVSATDPDAGDNAKITYAFKSPNDKFE--------IDSTSGDIRTKVALTGTKDVNE-----KMTVVASNTEAIQGGDANNRDRETEVTIYI---TDLAPPV--------------CDKNLFTARILESLSVNS-----DVLKVSAQAPGGKSIVY-SPVKANADIDEKFSVETNGQIKTASQLDYEQLSPGDKTFKLQVRAQEENTN----LYSTCSVAITLEDVNDDKPTFDLGNYDARVRENAPIGTTVIT--IKATDRDTGDAGVVTY----FLKAGSDEHFAIDVNSGTLTTKKSFDREGQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQFDQAEFQTSVSESATIGTSILEVVATDQDIGDNAKLEYFISGGDGRFWFAVQTISKSGRTYGEVQVDARLDFETKSSYTIDVTATD-----GRFSATTRVLITITDANDIVPMF 2756          

HSP 3 Score: 100.523 bits (249), Expect = 2.837e-21
Identity = 149/614 (24.27%), Postives = 256/614 (41.69%), Query Frame = 3
Query:  432 IRVFVDDENDNNPVFPIVQTPYCT-IEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHF--KDGVPY--LIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDI-------------------LDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNI-DREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLS--SSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLT-GQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLND 2189
            ++V V DEND+ P F   Q  + T + E+  +G  I    A D D       + KLE  F  G    F  A     K G  Y  + + + LD E  S YT  + A DG    R +  T + I I D ND  P F       T+    ++ PI+            GR+  +M  SG E + K++ +D                      Q  GK    +   +     +    F F ++A+DG     + +A + I + ++ND  P     R    +  G+ ++E   +   + YVQ  D D     L  +      +      +F+   N     +L TT+ I DRE +     +S  I  +  D   N++     A+I++   D ND+ P FT+ ++ G + E++     ++  ++ A D D   N ++ + +    + +    F +D   G ++     ++     Y+  V  +D+G P  LS  S + +++ I D NDNAP F  + +   V E++ +G  +  + A D DS    K +  I   +  +    +   D  + G +RTR P+DRE T      + +K+       L  +A + +T+ D+ND
Sbjct: 2634 VKVLVVDENDSPPQFD--QAEFQTSVSESATIGTSILEVVATDQDIG----DNAKLEY-FISGGDGRFWFAVQTISKSGRTYGEVQVDARLDFETKSSYTIDVTATDG----RFSATTRVLITITDANDIVPMF------MTLTTPTLLSPIY-----------TGRVS-EMTGSGVEVL-KVYAVDTDSPNIQYTLEGSSSYFTIAARQEGGKFVGIISTGSQPLDREATPIFSFNVLAKDGVH---TGSAYIEINVTDINDNQP-----RFPNSLYVGY-VEENKAAGTSVMYVQAHDDDDPY--LGGNAEIRYTLTDNAGGKFKIDANT----ALVTTEEILDRETSP----NSFTITVLATDQGANKLSTTKVATIYV--TDANDHAPVFTKRIFRGTVSEDV--RPGYVVTSVSATDTDTGPNAELEFVV---THGNEPAAFYVDPSKGTVHVFDILNYTLRKSYNLTVTVSDRGMP-VLSDNSPAYVLITITDANDNAPIFIPNQYNKTVAEDLAVGSPVVVVTAVDYDSGDNAKFVFDITGGNPNDLFEVVPNPDNSSLGIVRTRLPLDRETTPIHHLEITAKDT----GGLTGKAHVWLTLLDVND 3186          

HSP 4 Score: 78.1814 bits (191), Expect = 1.878e-14
Identity = 120/487 (24.64%), Postives = 214/487 (43.94%), Query Frame = 3
Query:  771 EITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQ-DGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSL--LTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDI--RFIVKSDSQNRASKLITLDPLTG--QIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            ++ I +   +D   +F +  Y  +I EN  ++  +F+   T         I   +     E  N +F++D           +V  +  LD E+   S++  +     GG  +L++     + + +VND +P   F R  +Q    F +D    +N I+A ++  D+D   N Q+  S+    P N  +  ++    P N+     L+TT  +        +ID +I  TV+  D  +  P  +  ++ + + ++   PP F Q  Y   ++EN    +  ++      D +  L          F + +    F IDS +G+I  +Q  D E    Y+ + V    G+    +    ++V + D ND++P F++S + FF +E++  G  IG++ ATDRDS   H  I  RF+  SD Q+       LD  TG   + +   +D E  S    FV +++     N L   A + I +RD+ND+ P F
Sbjct:  983 DVFISVYPSSDTPVRFSQNPYSASIAENSPLNTEVFRATATKSGSSSG--IAYSLVGGQIENGNTMFSID--------SSGRVLLLRQLDRERT-KSYKLYVRGTYTGGSLTLATDVECLVTVTDVNDNTPLFTFDRVNKQ----FVVDNYAPANTIIATLRAVDSDEGANAQVTMSIQGTVPSNAPITIDT----PSNV-----LKTTTKLST------VIDYQI--TVRATDKGSP-PQYSETTVIVKVLNIQ-TPPVFGQAKYTVDVQENTKVGQQVISVKATYGDSNALLQ-------YSFVSGNLGDAFCIDS-SGQITVAQPLDREVLPSYT-LRVRVALGNNEDFTE---VVVSLTDINDDSPTFTKSVYEFFANEDISSGTSIGKVAATDRDS-GSHGQISYRFLYASDIQSMDK--FDLDQTTGIISLASGKSLDYEDISMHVLFVRAEDNGA--NKLSAIAEVRIYLRDINDNDPKF 1418          

HSP 5 Score: 76.6406 bits (187), Expect = 5.349e-14
Identity = 135/600 (22.50%), Postives = 246/600 (41.00%), Query Frame = 3
Query:  444 VDDENDNNPVFPIVQTPYC-TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKM-HNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNS-----LSSTATLRIQILNVNDMSPEIRFVRNGQQITGGF--SIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESI--YSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            ++D NDN PVF   +  Y   +  +   G  I    A+D D        Y +         S  E   + + GV  L +   L     S Y+  + A D  + N       + + +   N   P+F +     TI+EN++    I  +  TD D+  NG ++ K+    GQ++            +I     +V   ++LD E    ++   I A+DGG        L S   L +++ +VND  P          IT  +  SI         +  V  +D D+  N ++  +  +P +   I+ +      +I  + +L  T+++    NE   + +     +Q  D +N    +    + I I D+   PP   +N++  +I E+++ +   +  +  A        GK   +     N+     F +++ NG+I  +   D+E+ S    +F +    Q     L S+ ++ + ++D ND+ P F   ++   V EN  IG  +  I ATDRD+  +   + + +K+ S         +D  +G + T+   DRE  S  +  V +++       L +E  + + V D NDSPP F
Sbjct: 2111 LEDTNDNAPVFK--RNDYLFRMTADASTGSMIGAVIARDQDQDDIEKVRYSV--------VSGTEFNVNTETGV--LTVAKDLSTGAKSEYSMEIRATDSTKSN----DARVRVNVEYKNMYRPEFTK-CGKATIQENLLKGQLIATVTATDRDQGRNGEVEYKIVPVGGQDFF-----------TINNKTGEVITTSSLDRET-KATYTVIITAEDGGHGKDPAERLMSYCFLEVEVQDVNDNYPSF--------ITRAYLGSIQNTKPIGTSVLTVSATDPDAGDNAKITYAFKSPNDKFEIDSTSG----DIRTKVALTGTKDV----NEKMTVVASNTEAIQGGDANNR---DRETEVTIYITDL--APPVCDKNLFTARILESLSVNSDVLKVSAQAP------GGKSIVYSPVKANADIDEKFSVET-NGQIKTASQLDYEQLSPGDKTFKLQVRAQEENTNLYSTCSVAITLEDVNDDKPTFDLGNYDARVRENAPIGTTVITIKATDRDT-GDAGVVTYFLKAGSDEH----FAIDVNSGTLTTKKSFDREGQSLFSVIVIARDKGNNPGALSEEVAVKVLVVDENDSPPQF 2648          

HSP 6 Score: 76.6406 bits (187), Expect = 5.675e-14
Identity = 137/601 (22.80%), Postives = 252/601 (41.93%), Query Frame = 3
Query:  486 QTPY-CTIEENKPLG---YRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGK------TEITIKIRDINDNAPKFERPIYIRTIKENVI--VDPIFQILVT----DEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSID--EGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNG--KIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVE---SKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDP 2219
            Q PY  +I EN PL    +R    K+       +S+   ++E     GN+  F +     D    +++   LDRE+T  Y         V G    G        E  + + D+NDN P F    + R  K+ V+    P   I+ T    D DE  N ++ + +   G    N   T+D    ++ K   ++  +  +DY+         + A D G     S  T+ +++LN+   +P +     GQ     +++D  E T   + +  V+ +  DS    LQ S ++                 I     +   Q +DRE    + +  ++ +    +D+           + + + D+ND+ P FT++VY     E+I++        + A D+D   +G+++Y      +  +   F +D   G   + + +S D+E  S++   V A D G  N+LS+ + + + ++D NDN P+FS + +   +  +  +   + Q+ ATD D+    + IR+ + + +Q  A +++T +   G IR    +     S+    +E   S +P R  +  +Q  +       L D PP F L DP
Sbjct: 1000 QNPYSASIAENSPLNTEVFRATATKSGSSSGIAYSLVGGQIEN----GNTM-FSI-----DSSGRVLLLRQLDRERTKSYKLY------VRGTYTGGSLTLATDVECLVTVTDVNDNTPLF---TFDRVNKQFVVDNYAPANTIIATLRAVDSDEGANAQVTMSIQ--GTVPSNAPITIDT-PSNVLKTTTKLSTV--IDYQ-------ITVRATDKGSPPQYSETTVIVKVLNI--QTPPVF----GQ---AKYTVDVQENTKVGQQVISVKATYGDSNA-LLQYSFVS---------GNLGDAFCIDSSGQITVAQPLDREVLPSYTLRVRVALG-NNEDF---------TEVVVSLTDINDDSPTFTKSVYEFFANEDISSGTSI--GKVAATDRDSGSHGQISYRFLYASDIQSMDKFDLDQTTGIISLASGKSLDYEDISMHVLFVRAEDNGA-NKLSAIAEVRIYLRDINDNDPKFSAASYHAKLSLDAPVLEHVVQVTATDLDTANNGR-IRYSIVAGNQEGAFQVLTDN---GLIRVAKSLTTVAASSFLLTLEAADSGDPERKGSVNVQVNVF------LPDGPPKFVL-DP 1526          

HSP 7 Score: 72.7886 bits (177), Expect = 8.965e-13
Identity = 156/670 (23.28%), Postives = 275/670 (41.04%), Query Frame = 3
Query:  264 LDSDSNLKVSKQIDREELCPPQMMLQLNKVC----GSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIV-QTPYC-TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREK-TSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPL-----NTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI-----QDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGH----PNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRI----FNDLIQEAMIVITVRDLNDSPP 2198
            LDS SN  +  Q+  E +  P M+  L +        + T  + LD  I  +  +   N  +  VD E   +P  P+  ++ Y  T+ E  P   +I        D    SVS  +L      GN+ +  LAK   D    +++ S LD E+  S++   + A + +    ++ + ++TI + + ND  P F+ P+Y   + E+  V     +++T    D +   D        ++  +  T   +DQ+   V A+      LDYE        K++A D G    ++   + + + + ND +P   F RN            G++   ++A  Q  D D +                    + R+ V    +F++ T   +        L  +K + T    +Y  EI       + +A + + +   N   P+FT+      I+EN+   ++   A + A D+D   NG+V Y I     QDF        F I+++ G++  + S D E ++ Y+ I+ A D GH      RL S   + V ++D NDN P F    +   +     IG  +  ++ATD D+  ++  I +  KS +         +D  +G IRT+  +   K       V + N   I     N+  +E  + I + DL  +PP
Sbjct: 1841 LDSGSNGLIGFQL--ENIPTPFMINPLTRQIEVGQPRLQTSRYGLDI-IPFDYGKPSVNGTKATVDIETVQSP--PVFNESSYTFTVSERAPTMTKIG-------DVTAVSVSGARLSYTIIEGNTGNKFLAKDNGD----IVLNSLLDFERDQSVFNLKVEAKEQIPKGLSS-EVDVTITVINANDFHPYFDDPVYRLKVPESRGVG---DVIMTVTARDCDCPSDCTCQVGQLKYSVEAGTSFDIDQTGAIVVAR-----TLDYETSKVQV-LKVMASDQGEKVFTAVTFVVVTLEDTNDNAP--VFKRNDYLFRMTADASTGSMIGAVIARDQ--DQDDI-------------------EKVRYSVVSGTEFNVNTETGV--------LTVAKDLSTGAKSEYSMEIRATDSTKSNDARVRVNVEYKNMYRPEFTK-CGKATIQENLLKGQLI--ATVTATDRDQGRNGEVEYKIVPVGGQDF--------FTINNKTGEVITTSSLDRETKATYTVIITAEDGGHGKDPAERLMSYCFLEVEVQDVNDNYPSFITRAYLGSIQNTKPIGTSVLTVSATDPDA-GDNAKITYAFKSPNDK-----FEIDSTSGDIRTKVALTGTKDVNEKMTVVASNTEAIQGGDANNRDRETEVTIYITDL--APP 2434          

HSP 8 Score: 72.4034 bits (176), Expect = 1.135e-12
Identity = 146/661 (22.09%), Postives = 263/661 (39.79%), Query Frame = 3
Query:  258 FILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIIN--DVNDNPPKFTQNVYYGQIEENINN--HEVFMNAAIHAADKDLHLNGKVTYHIQ-DFKNSSNAMYFRIDSQNGKIYNSQSFDFEK-ESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQIN---ATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            F +DS   + V++ +DRE L  P   L++    G               NNE+     + V + D ND++P F      +    E+   G  I    A D D+ +    SY+      + +   F+L +    G+  L    +LD E  SM+   + A D    N+ +   E+ I +RDINDN PKF    Y   +  +  +++ + Q+  TD D   NGRI   +    QE   ++ T    D  + +V   +  +          SF   + A D G      +  +++ +  + D  P  +FV +   +       EG  +N+ +A  + + ++++  ++        ++  I  S             + TT+ +D E    ++++      +  D  D       +AS+ +IIN  ++NDN P F      GQI+  +       F+   + A DKD  +  +V Y I  + +N     YF ID +   I  +   D +   S + F + A D G P ++ +++ ++V +  +    P          V E    G +I ++     T   S+   +   F + +D               G +    P+D E+ +     V  K  S    + I    + ITV D+ND+ P F +
Sbjct: 1255 FCIDSSGQITVAQPLDREVL--PSYTLRVRVALG---------------NNEDFTE--VVVSLTDINDDSPTFTKSVYEFFA-NEDISSGTSIGKVAATDRDSGSHGQISYRFLYASDIQSMDKFDLDQ--TTGIISLASGKSLDYEDISMHVLFVRAEDN-GANKLSAIAEVRIYLRDINDNDPKFSAASYHAKLSLDAPVLEHVVQVTATDLDTANNGRIRYSIVAGNQEGAFQVLT----DNGLIRVAKSLTTV-------AASSFLLTLEAADSGDPERKGSVNVQVNVF-LPDGPP--KFVLDPVIVNA----TEGIAANQRVAVAKAATSEALKYEILSG--NTNDMFAINPS----------SGVILTTRELDYEEATGYIMN-----IIARDTRDR------SASVQVIINVVNINDNEPMFPGET-NGQIDRKVAGPFAPGFIATRLTAVDKD--IGDRVYYKISIEAEN-----YFTIDERGQLICKN---DLKGIASPFRFTIEARDGGLPQKVHTANVLLVFVNYRPKQQP------VRVIVPETTRAGTVITRVPRYFPTGEFSIVYPEKTNFTIDND---------------GNVTLNRPLDYEEIAFTLITVREKQASGPLENYID---VEITVLDVNDNAPFFTM 1816          

HSP 9 Score: 67.0106 bits (162), Expect = 4.770e-11
Identity = 123/517 (23.79%), Postives = 206/517 (39.85%), Query Frame = 3
Query:  714 TFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENV-IVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFV-------RN-------GQQITGGFSIDEGTLSNKILAYVQVS--DADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNA--AIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFR 2207
            T T+ A DG  G  + G T I I I+D N+N P FE+  Y  TI E+  ++  I ++   D D   NG I   + N+      + FT+D        +   +R I  LD+ Q       ++ A+D  R S    A + +Q+   +D+S     V       RN       G   T   SI E    N  +  V+ +  DA S   QL+ SL    N  +   S            +L+T   ++ +AN    +   ++     +     +  + N  I ++  D N+N P F       Q+E  ++           + A D D   +G+V Y I      S    F++ +  G +  +   D EK S Y  ++ A D+    + SS+  ++V+I+D +D+ PQF+Q  +     E       +  +   D D L E      +  S +   + K++   P +G I T  PID     +    V +   S           + + +    +SPP F+
Sbjct:  213 TLTVRANDG--GGLH-GTTRIQIDIQDTNNNPPVFEKSEYTVTIGEDTPVMTSILRVRARDADIGRNGGIYYYLRNT------QDFTID-------AITGVIRPIRMLDF-QSGQQRTLEVTARD--RGSSPKAANVNVQVTIRSDISGYPPVVVPSSSSDRNRPPVFPEGPSFT--LSIREDFPVNGAIQVVKANDLDAGSTNGQLRYSLSGNNNFAIDSTSGV---------VTLQT--QLEYKANPAQDVIDLVVTATDRNGLSGALSASVNLKIEVLDVDDNNNAPVFNPQ----QLELTVSEDTAVGRTIRRVSATDSDDGSDGQVVYSI---IQGSGLGVFQVQATTGDLIVAAPLDREKMSFYDLVIKAEDKATFPK-SSNLYVMVKIQDVDDHFPQFTQPMYYAKAPEKSPENTFVTVVKVVDHD-LGES-----VSYSITGACSFKIV---PTSGLILTTGPIDLTTEPSTYELVVTATSSNYGTTKRATGQVNVEITSKTESPPVFK 680          

HSP 10 Score: 63.5438 bits (153), Expect = 4.894e-10
Identity = 118/512 (23.05%), Postives = 206/512 (40.23%), Query Frame = 3
Query:  468 PVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIR------DINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAIN-----NLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGK-VTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQ-INATDRDSL 1961
            PVFP   +   +I E+ P+   I + KA DLD       S   +L + L  +++F +      GV  + + + L+ +         + +   + N  +G    ++ ++      D N+NAP F       T+ E+  V   I ++  TD D+  +G++              ++++ I    +G  Q Q    +      LD E++   ++  I A+D      SS   + ++I +V+D  P+        Q        E +  N  +  V+V D D +   +  S+    +  ++  S             + TT  ID    EP   +  ++VT    +Y           + + I    ++PP F    Y   + EN        N    AA   +   G+ V Y I+     S    F IDS++G+  + QSFD+E    Y   + A     PN ++SSS + + IKD+ D  PQFSQS +   V E   +   + + I   D D+L
Sbjct:  359 PVFPEGPSFTLSIREDFPVNGAIQVVKANDLD-----AGSTNGQLRYSLSGNNNFAIDS--TSGV--VTLQTQLEYKANPAQDVIDLVVTATDRNGLSGALSASVNLKIEVLDVDDNNNAPVFNPQQLELTVSEDTAVGRTIRRVSATDSDDGSDGQV--------------VYSI-IQGSGLGVFQVQATTGDLIVAAPLDREKMSF-YDLVIKAEDKATFPKSSNLYVMVKIQDVDDHFPQF------TQPMYYAKAPEKSPENTFVTVVKVVDHD-LGESVSYSITGACSFKIVPTSGL-----------ILTTGPIDL-TTEPSTYE--LVVTATSSNYGTT--KRATGQVNVEITSKTESPPVFKNTPYAISVPEN---QGSIANLVCVAA---IDTKGQPVIYSIE-----SRGEPFGIDSKSGRFSSLQSFDYETADKYRIQISAQSGIAPNIMTSSSDVAITIKDEKD-PPQFSQSEYKVSVPEGASVRSTLSRGIRFVDEDTL 810          

HSP 11 Score: 60.8474 bits (146), Expect = 3.930e-9
Identity = 135/599 (22.54%), Postives = 239/599 (39.90%), Query Frame = 3
Query:  528 YRIPLPKAQDLDNATFSVSSYKLELP----FKLGN-SSDFELAKHFK-DGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYI-RTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEW-IN---KIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN---QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIF--IIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNA-AIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQ-----GHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPL--------------TGQIRTRYPIDREKTSTI--TFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            YR+ +P+++ + +   +V++   + P     ++G      E    F  D    +++  TLD E + +    ++A D  E    T  T + + + D NDNAP F+R  Y+ R   +      I  ++  D+D+D+  ++   +  SG E+ +N    + T+   D S G                    +  +I A D  +   S+ A +R+ +   N   PE  F + G+      +I E  L  +++A V  +D D   N   + +   +  ++   I            K   + TT ++DRE    +     +I+T +   +  +      +  F  + + DVNDN P F    Y G I+   N   +  +   + A D D   N K+TY    FK+ ++   F IDS +G I    +    K+      VVA++      G  N     + + + I D    AP           D+N+    ++        +SL  + D+   +K  +Q    K I   P+               GQI+T   +D E+ S    TF ++ +      N L     + IT+ D+ND  PTF L
Sbjct: 2020 YRLKVPESRGVGDVIMTVTARDCDCPSDCTCQVGQLKYSVEAGTSFDIDQTGAIVVARTLDYETSKVQVLKVMASDQGE-KVFTAVTFVVVTLEDTNDNAPVFKRNDYLFRMTADASTGSMIGAVIARDQDQDDIEKVRYSVV-SGTEFNVNTETGVLTV-AKDLSTGA----------------KSEYSMEIRATDSTK---SNDARVRVNVEYKNMYRPE--FTKCGKA-----TIQENLLKGQLIATVTATDRDQGRNGEVEYKIVPVGGQDFFTINN----------KTGEVITTSSLDRETKATY----TVIITAEDGGHGKDPAERLMSYCFLEVEVQDVNDNYPSFITRAYLGSIQ---NTKPIGTSVLTVSATDPDAGDNAKITYA---FKSPNDK--FEIDSTSGDIRTKVALTGTKDVNEKMTVVASNTEAIQGGDANNRDRETEVTIYITDL---APPV--------CDKNLFTARIL--------ESLSVNSDV---LKVSAQAPGGKSIVYSPVKANADIDEKFSVETNGQIKTASQLDYEQLSPGDKTFKLQVRAQEENTN-LYSTCSVAITLEDVNDDKPTFDL 2544          

HSP 12 Score: 57.3806 bits (137), Expect = 3.491e-8
Identity = 89/413 (21.55%), Postives = 167/413 (40.44%), Query Frame = 3
Query: 1008 AQVRAINNLDYEQLYHSFEFKIVAQDG-GRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYK--------QFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQD----FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
             +  ++ + DYE     +  +I AQ G   N ++S++ + I I +  D  P+         +  G S+   TLS  I    +  D D++  QL+CS+         EE   R P++           +F +  T  +D      F  D K+         D   P +     + + + D N   P F++  ++    + +      M   I   DKD+   G+VTY + D       +S    FR+D  +GKI ++        ++Y     A D G P  L ++  + + +   +D   +FSQ+ ++  + EN  +   + +  AT   S      I + +        + + ++D  +G++     +DRE+T +   +V           L  +   ++TV D+ND+ P F
Sbjct:  729 GRFSSLQSFDYETA-DKYRIQISAQSGIAPNIMTSSSDVAITIKDEKD-PPQFSQSEYKVSVPEGASV-RSTLSRGI----RFVDEDTLSTQLECSM---------EEMTSRIPLDYLSVVQDGGECKFVIEKT--LDTFVASKFTFDMKVT--------DKNFPGMFATTKVEVTVADTNTYTPVFSRTSFWASKPDTLPTDTSVMQLPI--IDKDMGSLGEVTYQLIDPTVSAGETSGYDRFRVD-DSGKIESTNIL--TANTLYKLQAKAKDGGSP-ALEATVDVFISVYPSSDTPVRFSQNPYSASIAENSPLNTEVFRATATKSGS---SSGIAYSLVGGQIENGNTMFSIDS-SGRVLLLRQLDRERTKSYKLYVRGTYTGGSLT-LATDVECLVTVTDVNDNTPLF 1104          

HSP 13 Score: 55.0694 bits (131), Expect = 1.762e-7
Identity = 54/226 (23.89%), Postives = 101/226 (44.69%), Query Frame = 3
Query: 1596 MNAAIH---AADKDL-HLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEK---ESIYSFIVVATDQ-GHPNRLSSSSTIIVRI--KDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLND-----SPPTFRLKDPSKS 2228
            +N AI    A D D    NG++ Y +    N      F IDS +G +      +++    + +   +V ATD+ G    LS+S  + + +   D N+NAP F+       V E+  +G  I +++ATD D   + + +  I+    Q     +  +   TG +    P+DREK S     +++++ +           +++ ++D++D     + P +  K P KS
Sbjct:  377 VNGAIQVVKANDLDAGSTNGQLRYSLSGNNN------FAIDSTSGVVTLQTQLEYKANPAQDVIDLVVTATDRNGLSGALSASVNLKIEVLDVDDNNNAPVFNPQQLELTVSEDTAVGRTIRRVSATDSDDGSDGQVVYSII----QGSGLGVFQVQATTGDLIVAAPLDREKMSFYDLVIKAEDKATFPKS--SNLYVMVKIQDVDDHFPQFTQPMYYAKAPEKS 590          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Medaka
Match: PCDH17 (protocadherin-17 [Source:NCBI gene;Acc:101168002])

HSP 1 Score: 221.476 bits (563), Expect = 7.800e-59
Identity = 205/638 (32.13%), Postives = 308/638 (48.28%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILV----TDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIP-LNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTY-----HIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP----QFSQSHFAFF-VDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFV 2108
            L  +D +S L  +KQ IDRE LC      + N  C         L  ++  N++E+    I++ + D NDN+P FP        I EN   G R PL  A DLD+    + +Y++       + + F L  K   DG   P L++   LDRE  S +T  L AIDG E  R +G  +I +++ D NDN+P FE+  Y+  I EN+   P  +IL+    TD+DE  NG++         E I  +F++D  +  + KVQ ++      D+E+     EF + A+D G N +     + +++ + ND SP I FV   Q      +I E    + ++A V+V+D DS  N QLQC +L   N+       FR   N    ++L T + +DRE  + + +    IV       DN IP LN   S  + I D NDN P+FT+++Y  Q+ EN    E     +I A D D+  NG VTY     HI D    S   Y  ++  NG IY S+SF++E+   + F V A D G P+ + S+ST+ V I D NDN P       Q+  A   V  NV IG+++  + A D D    H D   +    ++     L  +DP+ G++RT + +  E    +   V
Sbjct:   65 LVDVDPESGLIFTKQRIDRETLC------RRNPKCQ--------LSMEVFANDKEI--CMIKIDIQDINDNSPSFPSDHV-NIDISENAAAGTRFPLTIAHDLDSGENGIKTYQV----TRDDYNTFSLDLKVRGDGTIYPELVVQRPLDREDQSHHTLLLTAIDGGEYPR-SGSMQINVRVTDSNDNSPVFEKSSYVIEIPENL---PPGKILIDLNATDQDEGSNGQVVYSFTGYASERIQDLFSID-PNTGVIKVQGEI------DFEE-NPIIEFDVQAKDLGPNPIPGHCKITVKVQDKNDNSPVITFVSVRQG-----AISEAAPPDSVIALVRVTDKDSGRNGQLQCRVLG--NV------PFRLQENNDNFYTLLTDRPLDRETRDEYNV---TIVA-----RDNGIPSLNNTRSFTVKILDENDNAPRFTKSLYVLQVPENNIPGEYL--GSILAHDPDVGRNGTVTYSILPSHIGDV---SVYTYVSVNPTNGAIYASRSFNYEQTKSFEFKVQAKDGGSPH-MESTSTVRVNILDVNDNLPVIILPLLQNDTAEIPVPRNVGIGYIVATVKAVDHD----HGDSGHLTYEITEGNDDHLFEIDPVGGEVRTAHALWEEIAPVVELVV 638          

HSP 2 Score: 89.3521 bits (220), Expect = 1.495e-17
Identity = 127/495 (25.66%), Postives = 200/495 (40.40%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYN---SQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS----------LPEH-KDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I I I+DINDN+P F        I EN      F + +  D D  ENG   +K +   ++  N  F+LD+  +  G +  ++     LD E   H     + A DGG    S +  + +++ + ND SP   F ++   I     I E     KIL  +  +D D   N       T      I++     P        ++    ID E N     D      VQ  D     P+  +  I + + D NDN P  T  +V  G I E      V   A +   DKD   NG++   +         + FR+   N   Y     +  D E    Y+  +VA D G P+ L+++ +  V+I D+NDNAP+F++S +   V EN   G  +G I A D D           LP H  D+               ++++P  G I      + E+T +  F V++K+       +   + + + + D+ND+ P   L
Sbjct:  109 IKIDIQDINDNSPSFPSDHVNIDISENAAAGTRFPLTIAHDLDSGENG---IKTYQVTRDDYN-TFSLDLKVRGDGTIYPELVVQRPLDREDQSH-HTLLLTAIDGGEYPRSGSMQINVRVTDSNDNSP--VFEKSSYVI----EIPENLPPGKILIDLNATDQDEGSNGQVVYSFTGYASERIQDLFSIDP----NTGVIKVQGEIDFEENPIIEFD------VQAKDLGPN-PIPGHCKITVKVQDKNDNSPVITFVSVRQGAISEAAPPDSVI--ALVRVTDKDSGRNGQLQCRVL------GNVPFRLQENNDNFYTLLTDRPLDRETRDEYNVTIVARDNGIPS-LNNTRSFTVKILDENDNAPRFTKSLYVLQVPENNIPGEYLGSILAHDPDVGRNGTVTYSILPSHIGDVSVYT----------YVSVNPTNGAIYASRSFNYEQTKSFEFKVQAKDGGSPH--MESTSTVRVNILDVNDNLPVIIL 560          

HSP 3 Score: 88.5817 bits (218), Expect = 2.230e-17
Identity = 91/309 (29.45%), Postives = 140/309 (45.31%), Query Frame = 3
Query: 1377 TTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHI--QDFKNSSNAMYFRIDSQNGKIYNS----QSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIP 2285
            T Q IDRE       + K  ++++    D EI +     I I I D+NDN P F  +     I EN      F     H  D D   NG  TY +   D+   S  +  R D   G IY      +  D E +S ++ ++ A D G   R S S  I VR+ D NDN+P F +S +   + EN+  G ++  +NATD+D    +  + +     +  R   L ++DP TG I+ +  ID E+   I F V++K+     N +     I + V+D ND+ P            +I+  +++QG I E+ P
Sbjct:   77 TKQRIDRETL--CRRNPKCQLSMEVFANDKEICM-----IKIDIQDINDNSPSFPSDHVNIDISENAAAGTRFPLTIAH--DLDSGENGIKTYQVTRDDYNTFSLDLKVRGD---GTIYPELVVQRPLDREDQSHHTLLLTAIDGGEYPR-SGSMQINVRVTDSNDNSPVFEKSSYVIEIPENLPPGKILIDLNATDQDE-GSNGQVVYSFTGYASERIQDLFSIDPNTGVIKVQGEIDFEENPIIEFDVQAKDLGP--NPIPGHCKITVKVQDKNDNSP------------VITFVSVRQGAISEAAP 357          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Medaka
Match: ENSORLT00000041785.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 217.624 bits (553), Expect = 9.719e-58
Identity = 193/647 (29.83%), Postives = 308/647 (47.60%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGV-----PYLIITSTLDREKTSMYTFTLIAIDGVEGNRN-TGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPI-FQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFK--NSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFF-------VDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITV 2174
            L V+ +IDRE LC      + +  C        +L  Q+  + + +Q   + V + D NDN+PVFP  +     I E+   G R PL  A DLD    SV SY L        S D   + + KD       P L+++ TLDREK   +  T+ A+DG  GN N +G ++I I + D NDN P FE+ +Y  T+ EN     I  ++   D D+  NG ++        + +  +F        I K   ++R I NLD+E    S+E  + A D G   +    ++ I++L+VND +P I             S+ E   S  ++A +   D DS  N  + +L  P++      S F+   +    ++L T++ +DRE        S+  V +   D  +  PL+    I + I DVNDNPP FTQ  Y   ++EN     +    ++ A+D D   N K++Y I D K  + S + Y  ++S+NG IY+  SFD+EK  ++   V A DQG P+ LSS++T+ V I DQNDNAP       A         +  + + GHL+ ++ A D DS   H    +I    ++   + L T+   TG++RT+  +  +  S+    +E K+      + +Q A + +++
Sbjct:  102 LLVNDRIDREALC------RQSASC--------VLTLQVVID-KPLQLFKVEVEIIDINDNSPVFPSSEK-NLQIAESTAAGTRFPLDTALDLDVGVNSVRSYTL--------SKDDYFSLNVKDMAGGRKNPELVLSKTLDREKMPTHQLTITAVDG--GNPNKSGISQINIYVLDNNDNFPVFEKNVYKVTLSENSEKSSIVLKLAAKDSDDGVNGEVEYSFGPQTPDAVLSVF-------GINKDSGEIRLIGNLDFETT-SSYEIDVSATDKGTPKMEGHCSVHIEVLDVNDNAPYIFLTSQPN------SVPENAPSGTVVALISARDLDSGDNG-KVTLQVPKS------SPFKLKASFSDNYALITSRALDRETF------SEYSVEITATDLGSP-PLSNKKMISVTITDVNDNPPVFTQRSYNVYLKENGVPGSILF--SVSASDLDSSENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPS-LSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADS--GHN--AWISYRLAEATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKDD----GEPLQSATVTVSI 683          

HSP 2 Score: 75.8702 bits (185), Expect = 2.006e-13
Identity = 76/245 (31.02%), Postives = 110/245 (44.90%), Query Frame = 3
Query: 1494 IFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDS-------LPEHKDIRFIVKSD-SQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            I I + D NDN P F +NVY   + EN     + +  A  A D D  +NG+V Y        +    F I+  +G+I    + DFE  S Y   V ATD+G P ++    ++ + + D NDNAP    +     V EN   G ++  I+A D DS       L   K   F +K+  S N A  LIT   L  +  + Y ++      IT       P      L  + MI +T+ D+ND+PP F
Sbjct:  246 INIYVLDNNDNFPVFEKNVYKVTLSENSEKSSIVLKLA--AKDSDDGVNGEVEYSFGPQTPDAVLSVFGINKDSGEIRLIGNLDFETTSSYEIDVSATDKGTP-KMEGHCSVHIEVLDVNDNAPYIFLTSQPNSVPENAPSGTVVALISARDLDSGDNGKVTLQVPKSSPFKLKASFSDNYA--LITSRALDRETFSEYSVE------ITATDLGSPP------LSNKKMISVTITDVNDNPPVF 473          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Medaka
Match: ENSORLT00000042182.1 (protocadherin gamma-C5 [Source:NCBI gene;Acc:101169865])

HSP 1 Score: 214.157 bits (544), Expect = 2.137e-56
Identity = 188/645 (29.15%), Postives = 301/645 (46.67%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDG---VPYLIITSTLDREKTSMYTFTLIAIDGVEGNR-NTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIF-QILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFK--NSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFF-------VDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITV 2174
            L V+ +IDRE LC            G   +C  +L  QI   N  +Q + I V + D NDN+PVF + +  +  I E+   G R PL  A+DLD  + SV  Y L        +  F L      G   VP L++   LDREK S++   LIA DG  GN   TG  +IT+ + DINDN P F+ P Y  T+ EN +V  +  ++  TD D+  NG I+        + +  +F        I + +  +  +  LDYE+    +E +I A+D G   +     ++I ++++ND  PEI              + E +    ++A +   D DS  N           + +   S F    +    ++L T   +DRE    + ++   I +          PL++   I + + DVNDNPP FTQ  Y   ++EN     +    ++ A+D D   N K++Y I D K  + S + Y  ++S+NG IY+  SFD+EK  ++   V A DQG P+ LSS++T+ V I DQNDNAP       A         +  + + GHL+ ++ A D DS   H    +I    ++   + L T+   TG++RT+  +  +  S+    +E K+      + +Q A + +++
Sbjct:  167 LLVNDRIDREALC------------GQSASC--VLPLQIVTENP-LQLHRIEVEIKDINDNSPVF-LTEERFLKIAESTATGVRFPLDPAEDLDVGSNSVKIYTLS------KNECFSLKMKELSGDRQVPELVLDKPLDREKQSVHHLLLIASDG--GNPVKTGTAKITVSVMDINDNVPVFKMPFYNVTVPENGVVGSVLLRVEATDADDGVNGEIEYVFAEHTPQSLQSVF-------KINQEKGDISLLEPLDYEK-GAIYEIRITARDKGVPQMEGHCRVQIMVMDINDNVPEIVITSKPN------PVQEDSPKGTVVALINARDQDSGNN-------GKVKLKITNGSPFALKPSFSNNYALITNGALDRETFSEYNVEITAIDS-------GSPPLSSVKMITVSVTDVNDNPPVFTQRSYNVYLKENGVPGSILF--SVSASDLDSGENSKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPS-LSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADS--GHN--AWISYRLAEATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKDD----GEPLQSATVTVSI 748          

HSP 2 Score: 75.0998 bits (183), Expect = 3.312e-13
Identity = 72/256 (28.12%), Postives = 115/256 (44.92%), Query Frame = 3
Query: 1461 DNEIPLNTN-ASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHK-------DIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            D   P+ T  A I + + D+NDN P F    Y   + EN     V +   + A D D  +NG++ Y   +    S    F+I+ + G I   +  D+EK +IY   + A D+G P ++     + + + D NDN P+   +     V E+   G ++  INA D+DS    K          F +K    N  + LIT   L  +  + Y ++      IT  ++S +P      L    MI ++V D+ND+PP F
Sbjct:  299 DGGNPVKTGTAKITVSVMDINDNVPVFKMPFYNVTVPENGVVGSVLLR--VEATDADDGVNGEIEYVFAEHTPQSLQSVFKINQEKGDISLLEPLDYEKGAIYEIRITARDKGVP-QMEGHCRVQIMVMDINDNVPEIVITSKPNPVQEDSPKGTVVALINARDQDSGNNGKVKLKITNGSPFALKPSFSNNYA-LITNGALDRETFSEYNVE------ITA-IDSGSPP-----LSSVKMITVSVTDVNDNPPVF 538          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Medaka
Match: pcdh17 (protocadherin 17 [Source:NCBI gene;Acc:101155999])

HSP 1 Score: 213.386 bits (542), Expect = 3.602e-56
Identity = 198/623 (31.78%), Postives = 298/623 (47.83%), Query Frame = 3
Query:  255 LFILDSDSNLKVSKQ-IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL----AKHFKDGV--PYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQIL-VTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRF--VRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMIN-QLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEI-PLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAM--YFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAP----QFSQSHFA-FFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRY 2066
            L  +D  S L  +KQ IDRE LC      + N  C         L  ++  N++E+    I++ + D NDN+PVFP  Q     I EN   G R PL  A D D     + +Y++          D+ L     K   DG   P L+I   LDRE+ S +T  L A DG E  R +G  +I +K+ D NDN+P F+ P Y+  I EN     +   L  TD DE  NG+I         E I ++F++D     I K+Q ++      DYE+     E  + A+D G N +     + +++L+ ND  P I F  VR G       +I E      ++A V+V+D DS  N QLQC +L   N+       F+   N    +++ T + +DRE  + + +    IV       DN I PLN+  S  + I D NDN P+FT++VY  QI EN    E     ++ A D DL  NG V Y I +   S   +  Y  +++ NG IY  +SF++E+   + F V+A D G P+ L S++T+ + ++D NDN P       Q+  A   V  NV +G+++  + A D D    + +   +    S      L  +DP+TG++RT +
Sbjct:   70 LIDVDPQSGLLYTKQRIDRETLC------KRNPKCQ--------LSMEVFANDKEI--CMIKIDIQDINDNSPVFPSDQI-DIDISENAVPGTRFPLTSAHDPDAGENGLKTYQI-------TRDDYNLFSLEVKSRGDGTKFPELVIQRPLDREERSHHTLILSATDGGEYPR-SGTMQINVKVIDSNDNSPVFDPPSYVVEIPENSTPGKVLIDLNATDPDEGNNGQIVYSFSGYAPERIRELFSIDSRTGVI-KIQGEI------DYEE-SPVIEIDVQAKDLGPNPIPGHCKVTVKVLDRNDNWPSIGFVSVRQG-------AISEAAPPGTVIALVRVTDKDSGRNGQLQCRVLG--NV------PFKLEENYDNFYTVVTERPLDREMQDEYNV---TIVA-----KDNGIPPLNSTKSFTVKILDENDNVPRFTKSVYILQISENNIPGEYL--GSVLAHDPDLGQNGTVYYSIVNSNVSGGDVNTYVNVNAANGAIYAVRSFNYEQIKYFDFKVLAKDAGSPH-LESNATVRISVQDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGYIVTTVRAVDND----YGESGRLTYEISDGNEEHLFEIDPVTGEVRTAH 629          

HSP 2 Score: 86.6557 bits (213), Expect = 9.357e-17
Identity = 126/491 (25.66%), Postives = 208/491 (42.36%), Query Frame = 3
Query:  774 ITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVT-DEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSP---EIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKII-VTVQCDDYD-NEIPLNTNASIFIIINDVNDNPPKFT-QNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQD---FKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRF-IVKSD-SQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRL 2210
            I I I+DINDN+P F        I EN +    F +    D D  ENG   LK +   ++  N +F+L++  +  G    ++     LD E+  H     + A DGG    S T  + +++++ ND SP      +V           I E +   K+L  +  +D D              N  ++       P  I + FS+ +   + +   E    +S +I + VQ  D   N IP +   ++ ++  D NDN P     +V  G I E      V   A +   DKD   NG++   +     FK   N   F        +   +  D E +  Y+  +VA D G P  L+S+ +  V+I D+NDN P+F++S +   + EN   G  +G + A D D L ++  + + IV S+ S    +  + ++   G I      + E+     F V +K+       L   A + I+V+D+ND+ P   L
Sbjct:  114 IKIDIQDINDNSPVFPSDQIDIDISENAVPGTRFPLTSAHDPDAGENG---LKTYQITRDDYN-LFSLEVKSRGDGTKFPELVIQRPLDREERSH-HTLILSATDGGEYPRSGTMQINVKVIDSNDNSPVFDPPSYV---------VEIPENSTPGKVLIDLNATDPDEG-----------NNGQIVYSFSGYAPERIRELFSIDSRTGVIKIQGEIDYEESPVIEIDVQAKDLGPNPIPGHCKVTVKVL--DRNDNWPSIGFVSVRQGAISEAAPPGTVI--ALVRVTDKDSGRNGQLQCRVLGNVPFKLEENYDNFYT------VVTERPLDREMQDEYNVTIVAKDNGIP-PLNSTKSFTVKILDENDNVPRFTKSVYILQISENNIPGEYLGSVLAHDPD-LGQNGTVYYSIVNSNVSGGDVNTYVNVNAANGAIYAVRSFNYEQIKYFDFKVLAKDAGSPH--LESNATVRISVQDVNDNIPVIVL 565          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Medaka
Match: ENSORLT00000037422.1 (pep primary_assembly:ASM223467v1:10:14795752:14799434:-1 gene:ENSORLG00000025685.1 transcript:ENSORLT00000037422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 208.764 bits (530), Expect = 3.213e-55
Identity = 187/645 (28.99%), Postives = 304/645 (47.13%), Query Frame = 3
Query:  282 LKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDG--VPYLIITSTLDREKTSMYTFTLIAIDGVEGNR-NTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDP-IFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFK--NSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFF-------VDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITV 2174
            L V+ +IDRE LC            G   +C  +L  QI   N  +Q + + V + D NDN P F +       I E++  G R PL  A+D D  +  + +Y L           F L  K  ++G  +P L++T +LDREK ++++  L A+DG  GN   +G ++ITI + DINDN P+FE   Y   +KEN+     +      D DE  NG I+  +       + ++F +D            +     LD+E    S+   I A+D G   +    T+++ +++VND +PEI             S+ E + S  ++A + V D DS              + +++ S F    +    ++L T   +DRE+    + D  I VT +        PL +  +I + I DVNDNPP FTQ  Y   ++EN     +    ++ A+D D   N K++Y I D K  + S + Y  ++S+NG IY+  SFD+EK  ++   V A DQG P+ LSS++T+ V I DQNDNAP       A         +  + + GHL+ ++ A D DS   H  +  I    ++   + L T+   TG++RT+  +  +  S+    +E K+      + +Q A + +++
Sbjct:   82 LVVNDRIDREALC------------GQSASC--LLPLQIVIENP-LQLHRMEVEIKDVNDNAPTF-LKSDHVIEIAESRVAGVRFPLEMAEDPDVGSNGLKTYTLS------KDECFTLKVKEIENGRKIPELVLTKSLDREKKAVHSLFLTAVDG--GNPVKSGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVISTRAADVDEGPNGEIEYSLGVHTHPSVLELFYVD-------AASGDIYLKRQLDHET-QSSYRIDISAKDKGFPKMEGHCTVQVDVIDVNDNAPEIILTSKST------SVPEDSSSGTVVALLSVRDLDS-------GDYGKVTLQLLKTSSFALKPSFSNNYALITNGPLDRES----ISDYSIEVTAK---DSGTPPLLSTKTIPVSITDVNDNPPVFTQRSYNVYLKENGVPGSILF--SVSASDLDSGENAKISYSILDSKVQDVSVSSYVYMNSENGSIYSMHSFDYEKLKVFEIHVQAKDQGSPS-LSSNATVHVFILDQNDNAPAVIYPSSAALGSLSHQRMPRSAKAGHLVTKVTAVDADS--GHNAL--ISYRLAEATDASLFTVSLYTGEVRTKRAVSEQDDSSQRLILEIKDD----GEPLQSATVTVSI 663          

HSP 2 Score: 89.3521 bits (220), Expect = 1.247e-17
Identity = 94/366 (25.68%), Postives = 161/366 (43.99%), Query Frame = 3
Query: 1119 LRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNAS-IFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTG---QIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTF 2204
            + ++I +VND +P   F+++   I     I E  ++          D D   N L+   L+      +   + +   N  K   L  T+++DRE         K + ++     D   P+ +  S I I + D+NDN P+F    Y   ++ENI N    ++    AAD D   NG++ Y +    + S    F +D+ +G IY  +  D E +S Y   + A D+G P ++    T+ V + D NDNAP+   +  +  V E+   G ++  ++  D DS    K    ++K+ S         L P       + T  P+DRE  S  +  V +K+       L+    I +++ D+ND+PP F
Sbjct:  117 MEVEIKDVNDNAPT--FLKSDHVI----EIAESRVAGVRFPLEMAEDPDVGSNGLKTYTLSKDECFTL---KVKEIENGRKIPELVLTKSLDRE--------KKAVHSLFLTAVDGGNPVKSGTSKITINVLDINDNVPQFENAFYKVDVKENIANGSFVIST--RAADVDEGPNGEIEYSLGVHTHPSVLELFYVDAASGDIYLKRQLDHETQSSYRIDISAKDKGFP-KMEGHCTVQVDVIDVNDNAPEIILTSKSTSVPEDSSSGTVVALLSVRDLDSGDYGKVTLQLLKTSS-------FALKPSFSNNYALITNGPLDRESISDYSIEVTAKDSGT--PPLLSTKTIPVSITDVNDNPPVF 453          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Planmine SMEST
Match: SMESG000053174.1 (SMESG000053174.1)

HSP 1 Score: 2029.22 bits (5256), Expect = 0.000e+0
Identity = 1052/1052 (100.00%), Postives = 1052/1052 (100.00%), Query Frame = 3
Query:   51 MKIISTLLFSLIIAYTKCQFIHEFHITENSKIYKTIFNXXXXXXXXXXXXXXXXXXXXXFMSTVINNGLFILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFXXXXXXXXXXXXXXXXXRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPNVATQSKNQPPSSRNQKPEQAKDEIRQITMIIILASLAGLFXXXXXXXXXXXXRKCDRLNINNDGSGSDKNNQYDSQAMLDRNCIIQKNDLEASSFADIMTTSPMNFYNGLQVIPSNKSLHSTTNFKYPVEMEFTSKDDYLPPPYTKYHLIDKSDETYQILKSNPKQMETYDSIIRAIPIKASSQANQMTNNETFPNSKPSLTSQINLVTISDKPTHSTIRSNQTSFV 3206
            MKIISTLLFSLIIAYTKCQFIHEFHITENSKIYKTIFNLKTLLISKSKIDSSKAKDCKIFMSTVINNGLFILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFEVEDADDNNNVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPNVATQSKNQPPSSRNQKPEQAKDEIRQITMIIILASLAGLFIIVILMVLIITIRKCDRLNINNDGSGSDKNNQYDSQAMLDRNCIIQKNDLEASSFADIMTTSPMNFYNGLQVIPSNKSLHSTTNFKYPVEMEFTSKDDYLPPPYTKYHLIDKSDETYQILKSNPKQMETYDSIIRAIPIKASSQANQMTNNETFPNSKPSLTSQINLVTISDKPTHSTIRSNQTSFV
Sbjct:    1 MKIISTLLFSLIIAYTKCQFIHEFHITENSKIYKTIFNLKTLLISKSKIDSSKAKDCKIFMSTVINNGLFILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFEVEDADDNNNVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPNVATQSKNQPPSSRNQKPEQAKDEIRQITMIIILASLAGLFIIVILMVLIITIRKCDRLNINNDGSGSDKNNQYDSQAMLDRNCIIQKNDLEASSFADIMTTSPMNFYNGLQVIPSNKSLHSTTNFKYPVEMEFTSKDDYLPPPYTKYHLIDKSDETYQILKSNPKQMETYDSIIRAIPIKASSQANQMTNNETFPNSKPSLTSQINLVTISDKPTHSTIRSNQTSFV 1052          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Planmine SMEST
Match: SMESG000053174.1 (SMESG000053174.1)

HSP 1 Score: 1956.8 bits (5068), Expect = 0.000e+0
Identity = 992/992 (100.00%), Postives = 992/992 (100.00%), Query Frame = 3
Query:  231 MSTVINNGLFILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFXXXXXXXXXXXXXXXXXRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPNVATQSKNQPPSSRNQKPEQAKDEIRQITMIIILASLAGLFXXXXXXXXXXXXRKCDRLNINNDGSGSDKNNQYDSQAMLDRNCIIQKNDLEASSFADIMTTSPMNFYNGLQVIPSNKSLHSTTNFKYPVEMEFTSKDDYLPPPYTKYHLIDKSDETYQILKSNPKQMETYDSIIRAIPIKASSQANQMTNNETFPNSKPSLTSQINLVTISDKPTHSTIRSNQTSFV 3206
            MSTVINNGLFILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFEVEDADDNNNVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPNVATQSKNQPPSSRNQKPEQAKDEIRQITMIIILASLAGLFIIVILMVLIITIRKCDRLNINNDGSGSDKNNQYDSQAMLDRNCIIQKNDLEASSFADIMTTSPMNFYNGLQVIPSNKSLHSTTNFKYPVEMEFTSKDDYLPPPYTKYHLIDKSDETYQILKSNPKQMETYDSIIRAIPIKASSQANQMTNNETFPNSKPSLTSQINLVTISDKPTHSTIRSNQTSFV
Sbjct:    1 MSTVINNGLFILDSDSNLKVSKQIDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFEVEDADDNNNVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPNVATQSKNQPPSSRNQKPEQAKDEIRQITMIIILASLAGLFIIVILMVLIITIRKCDRLNINNDGSGSDKNNQYDSQAMLDRNCIIQKNDLEASSFADIMTTSPMNFYNGLQVIPSNKSLHSTTNFKYPVEMEFTSKDDYLPPPYTKYHLIDKSDETYQILKSNPKQMETYDSIIRAIPIKASSQANQMTNNETFPNSKPSLTSQINLVTISDKPTHSTIRSNQTSFV 992          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Planmine SMEST
Match: SMESG000042045.1 (SMESG000042045.1)

HSP 1 Score: 412.535 bits (1059), Expect = 1.646e-126
Identity = 275/790 (34.81%), Postives = 435/790 (55.06%), Query Frame = 3
Query:  273 DSNLKVSKQIDREELCPPQMML------------QLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGV-EGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSG---QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFND--LIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFXXXXXXXXX-XXXXXXXXRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHG--NDSIETEITFKILF---INDPNVATQSKNQPPSSRNQ 2570
            D+ L V   IDRE +CP +  L            Q +        CC +  FQ+  +  ++ S +I + V DENDN+P F     PY T+ EN  +   I LP A DLD+  F +  YK+  PF +GN S F L      G P L++ S LDRE  S Y F L A+D   + +R+    E+ IK+ DINDN P F++  Y   I E+  +  +    VTD DE +N ++ + +       ++ I + F +D    S   +   +R I+ +DYE   + + F ++A D G   LSSTA + I ++N ND +P I+ +R G+ ++   ++ E   +  I+A +QVSD DS++  ++CSL        I      HP+  YK+F + T + +DRE ++    +  + + + C D D   PL TN +I I + D+NDNPP FT++ Y G++ ENI    V M   I   DKD   N  VTY I   KNS++  YF ID+ +GKI + QS D+EK  ++SF ++A D+   N LSS++ IIV + D NDNAP F + H++F V ENV +   IGQI  TD D+ PE+K +++  KS + N   ++I +D  +G+++T  PIDREK  +IT  + ++N +   N   +  E M++IT+ D+ND+PP F L +P+KS LI ++    + + C+ IP+ V DAD +  N + CC+++L ++ NG+L L  +T N +C+           V+L A+D     N S++ +++F I     ++D   + +S N+  +++NQ
Sbjct:   51 DNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVD-SGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDF---SPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDK----NQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAPVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSN-LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNY--QVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQ 829          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Planmine SMEST
Match: SMESG000042045.1 (SMESG000042045.1)

HSP 1 Score: 412.535 bits (1059), Expect = 2.538e-126
Identity = 275/790 (34.81%), Postives = 435/790 (55.06%), Query Frame = 3
Query:  273 DSNLKVSKQIDREELCPPQMML------------QLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGV-EGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSG---QEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFND--LIQEAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFXXXXXXXXX-XXXXXXXXRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHG--NDSIETEITFKILF---INDPNVATQSKNQPPSSRNQ 2570
            D+ L V   IDRE +CP +  L            Q +        CC +  FQ+  +  ++ S +I + V DENDN+P F     PY T+ EN  +   I LP A DLD+  F +  YK+  PF +GN S F L      G P L++ S LDRE  S Y F L A+D   + +R+    E+ IK+ DINDN P F++  Y   I E+  +  +    VTD DE +N ++ + +       ++ I + F +D    S   +   +R I+ +DYE   + + F ++A D G   LSSTA + I ++N ND +P I+ +R G+ ++   ++ E   +  I+A +QVSD DS++  ++CSL        I      HP+  YK+F + T + +DRE ++    +  + + + C D D   PL TN +I I + D+NDNPP FT++ Y G++ ENI    V M   I   DKD   N  VTY I   KNS++  YF ID+ +GKI + QS D+EK  ++SF ++A D+   N LSS++ IIV + D NDNAP F + H++F V ENV +   IGQI  TD D+ PE+K +++  KS + N   ++I +D  +G+++T  PIDREK  +IT  + ++N +   N   +  E M++IT+ D+ND+PP F L +P+KS LI ++    + + C+ IP+ V DAD +  N + CC+++L ++ NG+L L  +T N +C+           V+L A+D     N S++ +++F I     ++D   + +S N+  +++NQ
Sbjct:   73 DNRLSVVSNIDRESICPIKNSLNDYDQSAETYNSQQSSHSCKYDECCTVFSFQVD-SGIKISSFYILIKVLDENDNSPKFLPFLNPYQTLPENSQINTVILLPSAIDLDSEAFGIKYYKISKPFLIGNDSHFTLLDKIASGRPQLLLISPLDREVISEYRFILKAVDRENDDHRDISGVEVEIKVGDINDNPPVFDKTFYTANIVEHSKLVNVISFYVTDLDEGQNKQVSITIETENDYKKDQIKRFFQIDF---SPSLMTGSIRLIDEIDYETNPYKYSFNLIATDNGLPRLSSTAKVNIILINKNDQAPVIKVIRKGEIVSRSITMFENEPARTIVASLQVSDRDSLVTDIECSLDDYHLNFEITAINEIHPLGHYKEFIINTLKPLDREDDK----NQYLKINIYCSDQDKLTPLTTNLTIHINLFDINDNPPVFTRSKYQGELIENIPQAPVKMIEPILTLDKDHGKNAYVTYKIDSSKNSTDWEYFTIDADSGKISSRQSIDYEKNKLFSFNIIAIDKDQSN-LSSTALIIVHVIDANDNAPIFPKPHYSFTVRENVPVNTEIGQIETTDLDTRPENKIVKYFHKSYTNNY--QVIHVDQNSGKLKTIGPIDREKVRSITILITARNEASYQNKNLMDSECMVIITIEDVNDNPPIFSLINPAKSSLIFTINKGFRHENCQMIPYAVSDADHDEPNSDSCCILQLDNDQNGMLYLLSNTPNFLCLQNTMNTPGIYRVSLTATDNKNNPNKSLKAKVSFNIDVRHEVSDNPFSEKSDNKVHTTKNQ 851          
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Planmine SMEST
Match: SMESG000048159.1 (SMESG000048159.1)

HSP 1 Score: 399.053 bits (1024), Expect = 6.366e-121
Identity = 276/782 (35.29%), Postives = 431/782 (55.12%), Query Frame = 3
Query:  300 IDREELCPPQMMLQLNKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFEL-AKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGN-RNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQEWIN--KIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEE-SRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSDSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQ----EAMIVITVRDLNDSPPTF--RLKDPSKSQLIISLETLQQGQICESIPFXXXXXXXXXXXXXXXXXR-LKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGN--DSIETEITFKILFINDPN--VATQSKNQPPSSRNQKPEQAKDEI 2597
            ++RE +C      ++ K C +   CC ++ FQ      +  + FI + + D+ND  P F  ++ P+  I EN  +G  I LP A D D+  +SV  Y L   + L  + DF L   +     P LI+ S LD EK + Y F L A D  E +  N+  T I I+I D+NDN PKF +  Y   I EN   D + +  V+D D   NG + + + +   E     KIF        I + +  +  IN+LDYE   H FEF ++A D G  SLSS+A ++I + N+ND  P+I+F + G  ++   SI EG  ++ ++  V+V+DAD+  N + C L+   ++  ++  S+F   +N YK F+L+T   IDRE+N      S + +T+ C D +    + TN S+ I I DVNDN P F+Q +Y G ++EN  N  V     I   D+D  LNGK  ++++DF+N S++  F ID  +GKI+  +S D+E ++ + F ++A D+G+   L+SSSTI + + D NDNAP+FS+SH+ F V ENV +G  IG + ATD D+  ++KDI + ++    +  S    +D  TG +RTR P+DRE   +I+  V +KNP++  +  ++    E  ++I V D+ND+ P F  RL    K + I+  E    G  C  +P+ V+D DD       C    L+++YN L SL  DT + IC+ + P+K +S  VTLIA D+  N    + ++I+F +L INDP+  ++T   +  P SR   P ++K+ I
Sbjct:   85 VNREAVCRDNPGEKVRKFCKA-DLCCKLIGFQY-LTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSYIYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDDKLIKFTVSDPDSGRNGIVTVNIVDKTDELSKRFKIF-------EIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSIIEGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLN-YKPFNLKTINKIDRESNH----GSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGNVDENQVNVVVNFPKPIIVTDRDSGLNGKFEFYLEDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGY-QPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQATDDDTDRKNKDIFYSIEPKGDH--SSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPNKYSSHFVRNTDSEVDVMIKVMDVNDNAPKFIPRLNMKQKVEFIV--EQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSYICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHSKISTSGFSNHPDSRFPNPSESKNLI 847          
The following BLAST results are available for this feature:
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH171.474e-5830.06protocadherin 17 [Source:HGNC Symbol;Acc:HGNC:1426... [more]
PCDH179.291e-5830.29protocadherin 17 [Source:HGNC Symbol;Acc:HGNC:1426... [more]
PCDHGC42.202e-5631.28protocadherin gamma subfamily C, 4 [Source:HGNC Sy... [more]
PCDHGC43.106e-5630.77protocadherin gamma subfamily C, 4 [Source:HGNC Sy... [more]
PCDHGA51.731e-5130.45protocadherin gamma subfamily A, 5 [Source:HGNC Sy... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.318e-3327.78FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-13.202e-3327.78FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.951e-2926.59CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-14.978e-2925.12Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-14.978e-2925.12Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds4.054e-4730.17gene:FBgn0284247 transcript:FBtr0078045[more]
ds4.054e-4730.17gene:FBgn0284247 transcript:FBtr0343249[more]
ft2.581e-3726.67gene:FBgn0001075 transcript:FBtr0077478[more]
stan8.767e-3527.15gene:FBgn0024836 transcript:FBtr0304899[more]
stan8.767e-3527.15gene:FBgn0024836 transcript:FBtr0300578[more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1gc61.332e-6031.44protocadherin 1 gamma c 6 [Source:ZFIN;Acc:ZDB-GEN... [more]
pcdh1g265.147e-6031.44protocadherin 1 gamma 26 [Source:ZFIN;Acc:ZDB-GENE... [more]
pcdh2ab91.021e-5530.36protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GEN... [more]
pcdh171.521e-5530.91protocadherin 17 [Source:ZFIN;Acc:ZDB-GENE-090608-... [more]
CR774179.72.756e-5529.14protocadherin gamma-C5-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh107.057e-5530.79protocadherin 10 [Source:NCBI gene;Acc:779938][more]
pcdh108.647e-5530.43protocadherin 10 [Source:NCBI gene;Acc:779938][more]
PCDH177.579e-5330.25protocadherin 17 [Source:NCBI gene;Acc:100485388][more]
PCDH179.335e-5330.25protocadherin 17 [Source:NCBI gene;Acc:100485388][more]
ENSXETT00000027853.16.667e-5129.87pep primary_assembly:Xenopus_tropicalis_v9.1:3:180... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh176.467e-5930.12protocadherin 17 [Source:MGI Symbol;Acc:MGI:268492... [more]
Pcdhgc49.839e-5731.11protocadherin gamma subfamily C, 4 [Source:MGI Sym... [more]
Pcdh105.372e-5128.46protocadherin 10 [Source:MGI Symbol;Acc:MGI:133804... [more]
Pcdh91.849e-5029.19protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh102.316e-5028.46protocadherin 10 [Source:MGI Symbol;Acc:MGI:133804... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14917|PCD17_HUMAN4.462e-5730.29Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17... [more]
sp|Q5DRA3|PCDGL_PANTR1.492e-5530.77Protocadherin gamma-C4 OS=Pan troglodytes OX=9598 ... [more]
sp|Q9Y5F7|PCDGL_HUMAN1.492e-5530.77Protocadherin gamma-C4 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9Y5G8|PCDG5_HUMAN1.924e-5030.45Protocadherin gamma-A5 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q8TAB3|PCD19_HUMAN2.672e-5028.70Protocadherin-19 OS=Homo sapiens OX=9606 GN=PCDH19... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087VWC54.528e-11230.26Uncharacterized protein OS=Echinococcus multilocul... [more]
A0A068WEQ79.895e-11130.51Protocadherin 2 gamma c6 sCP1 OS=Echinococcus gran... [more]
A0A158QES71.614e-11031.08Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
G4VRE56.601e-10932.37Putative cadherin OS=Schistosoma mansoni OX=6183 G... [more]
A0A5K3F6N92.266e-10330.56Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh179.241e-5731.08protocadherin 17 [Source:NCBI gene;Acc:103025306][more]
ENSAMXT00000016369.22.428e-5631.60pep primary_assembly:Astyanax_mexicanus-2.0:8:8904... [more]
pcdh1gc57.419e-5631.15protocadherin 1 gamma c 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSAMXT00000035285.12.518e-5431.11pep primary_assembly:Astyanax_mexicanus-2.0:8:8923... [more]
pcdh1g221.474e-5329.31protocadherin 1 gamma 22 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.492e-4828.42protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000006996.11.352e-4127.98pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
si:ch211-199f5.12.607e-4126.42protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.13.179e-4126.85pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.19.941e-3926.23pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354121.185e-4729.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461893.905e-4728.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348153.113e-3727.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482375.039e-3526.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464845.366e-3523.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH177.800e-5932.13protocadherin-17 [Source:NCBI gene;Acc:101168002][more]
ENSORLT00000041785.19.719e-5829.83protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000042182.12.137e-5629.15protocadherin gamma-C5 [Source:NCBI gene;Acc:10116... [more]
pcdh173.602e-5631.78protocadherin 17 [Source:NCBI gene;Acc:101155999][more]
ENSORLT00000037422.13.213e-5528.99pep primary_assembly:ASM223467v1:10:14795752:14799... [more]
back to top
BLAST of Protocadherin 2 gamma c6 sCP1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053174.10.000e+0100.00SMESG000053174.1[more]
SMESG000053174.10.000e+0100.00SMESG000053174.1[more]
SMESG000042045.11.646e-12634.81SMESG000042045.1[more]
SMESG000042045.12.538e-12634.81SMESG000042045.1[more]
SMESG000048159.16.366e-12135.29SMESG000048159.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000445 ID=SMED30000445|Name=Protocadherin 2 gamma c6 sCP1|organism=Schmidtea mediterranea sexual|type=transcript|length=3287bp
GAATTTTGTCGTGATTTTTCTCGGTGGTGATTTTTATTTTTCCTTTGGAA
ATGAAGATAATTAGCACACTTTTATTTTCCCTGATTATAGCGTATACAAA
ATGTCAGTTCATTCATGAGTTTCATATTACTGAAAATTCAAAGATCTATA
AAACAATTTTCAATTTGAAAACTCTATTAATTTCTAAAAGTAAAATTGAC
TCGAGCAAGGCAAAAGATTGCAAAATATTCATGAGCACTGTCATCAACAA
TGGATTATTTATTTTAGATTCAGATTCGAACCTGAAGGTGTCTAAACAAA
TTGACCGTGAAGAACTCTGTCCACCTCAAATGATGTTGCAGTTGAATAAA
GTATGCGGATCTATTCATACTTGCTGTCACATATTAGACTTCCAAATTTC
ATGCAACAACGAAGAGATGCAGTCGAACTTTATTCGTGTTTTTGTCGACG
ATGAAAATGATAACAATCCGGTTTTTCCGATCGTTCAAACCCCATATTGC
ACAATTGAAGAGAATAAACCGCTCGGTTATCGGATCCCACTTCCAAAAGC
ACAAGATCTTGATAACGCAACATTTAGCGTTTCAAGCTACAAGCTAGAGC
TACCTTTTAAGTTAGGAAACTCGAGTGACTTCGAATTGGCAAAACATTTC
AAAGACGGCGTTCCGTATCTTATTATTACATCGACTTTAGATAGAGAAAA
GACTTCAATGTATACTTTTACTTTAATAGCAATAGATGGGGTTGAAGGCA
ACCGAAATACCGGGAAAACAGAAATTACAATTAAAATTAGAGATATAAAT
GATAACGCACCGAAATTTGAAAGACCAATTTACATTAGAACAATCAAAGA
AAATGTTATCGTTGATCCAATCTTTCAGATATTAGTAACTGATGAGGACG
AGGATGAAAACGGAAGAATTGACTTGAAAATGCACAATTCCGGACAAGAG
TGGATAAACAAAATATTCACTCTCGATATTCTGGACCAGTCCATCGGAAA
GGTCCAAGCACAAGTTCGAGCTATTAATAACCTCGATTACGAACAACTTT
ATCATTCATTCGAATTCAAAATTGTTGCTCAAGATGGAGGCCGAAATTCA
CTTTCGTCTACGGCAACATTGAGGATACAAATATTAAATGTCAACGACAT
GAGTCCGGAGATAAGATTCGTTAGGAATGGTCAACAGATTACAGGAGGAT
TTTCAATAGACGAAGGAACGTTGAGTAATAAAATATTGGCTTACGTTCAA
GTTAGTGACGCCGACTCCATGATAAACCAGCTCCAGTGCTCATTGTTAAC
ACCAAGAAATATTCTCATGATCGAAGAATCAAGATTTCGGCATCCGGTTA
ATATTTACAAACAATTTTCTTTGAGAACCACCCAAAATATTGATAGAGAA
GCTAATGAGCCGTTTCTAATTGACTCAAAAATCATCGTCACGGTTCAGTG
CGATGATTACGACAATGAAATACCTTTGAATACAAATGCTAGCATTTTCA
TCATTATAAATGATGTTAATGATAATCCACCGAAATTTACTCAAAATGTT
TATTATGGACAAATTGAAGAAAATATTAATAATCACGAAGTATTTATGAA
TGCCGCTATTCATGCAGCAGACAAAGATCTTCATCTCAATGGAAAGGTGA
CATACCATATCCAGGATTTCAAAAACAGTTCCAATGCAATGTATTTTCGA
ATTGATTCTCAAAATGGAAAGATATACAACTCTCAGTCTTTTGATTTTGA
AAAGGAGTCCATTTATTCATTCATTGTAGTTGCGACTGATCAAGGACACC
CTAATCGTTTAAGTAGTTCATCAACAATAATAGTAAGAATCAAGGATCAA
AATGACAATGCCCCTCAATTTTCTCAAAGTCATTTTGCATTCTTTGTCGA
TGAAAATGTTGAAATAGGACATTTAATTGGACAAATAAATGCAACAGATC
GGGATTCATTGCCAGAGCATAAGGATATAAGATTTATAGTTAAATCCGAC
TCTCAAAATCGAGCGTCTAAACTCATTACCCTAGACCCTTTAACTGGTCA
GATTAGGACTCGTTACCCAATCGACAGAGAGAAAACCTCTACTATCACAT
TTTTTGTTGAATCAAAAAATCCGAGTCGAATTTTCAATGATCTTATCCAA
GAAGCAATGATCGTCATAACTGTTCGTGATTTGAACGATAGTCCACCAAC
TTTCCGATTAAAGGATCCAAGCAAATCGCAGTTGATAATTTCACTGGAAA
CCCTACAGCAAGGACAAATATGTGAGTCAATTCCATTCGAAGTTGAAGAT
GCTGATGATAACAACAATGTCAACCCATGCTGCGTTGTGAGACTGAAACA
TAACTATAACGGATTGCTGAGCCTTGCGGACGACACTCAGAATATAATAT
GCATTAATCAAGTACCCAAAAAGGTAAAAAGTTTACCTGTAACATTGATT
GCATCGGATAAACATGGAAATGATAGTATTGAAACTGAGATTACTTTTAA
AATTTTATTCATTAATGATCCGAACGTTGCTACTCAGTCGAAAAATCAGC
CTCCGAGTAGCCGGAACCAGAAACCAGAACAAGCAAAGGATGAAATTCGA
CAAATAACCATGATTATTATTTTAGCATCATTAGCTGGATTATTTATAAT
TGTTATTTTAATGGTATTAATAATAACAATAAGAAAATGTGATAGGCTTA
ATATTAATAATGATGGGTCGGGTTCGGACAAAAATAATCAGTACGATTCA
CAAGCGATGCTCGACCGCAATTGTATAATTCAAAAAAATGATTTGGAGGC
ATCATCGTTCGCCGACATAATGACAACGTCACCGATGAACTTTTACAATG
GACTTCAGGTAATTCCTTCAAACAAATCTCTTCATTCCACAACAAATTTT
AAATACCCAGTCGAAATGGAGTTCACTTCAAAAGACGATTATTTACCCCC
ACCGTACACAAAATATCATCTGATCGACAAATCGGATGAAACATATCAAA
TCCTCAAATCTAATCCCAAACAAATGGAAACTTACGACAGCATTATTCGT
GCTATACCAATCAAAGCTTCATCTCAAGCTAATCAAATGACCAATAATGA
AACGTTTCCCAATTCTAAACCCTCCTTAACTTCACAGATAAACTTGGTAA
CAATAAGTGACAAACCAACTCATTCCACTATTAGAAGCAATCAGACAAGT
TTCGTGTAAATTATCACAAAAATTATATTGAAACATGAATTTTCATTAAA
TTTTATCGTAAATATATGTATTACATTTGTAAAAAAA
back to top

protein sequence of SMED30000445-orf-1

>SMED30000445-orf-1 ID=SMED30000445-orf-1|Name=SMED30000445-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1053bp
MKIISTLLFSLIIAYTKCQFIHEFHITENSKIYKTIFNLKTLLISKSKID
SSKAKDCKIFMSTVINNGLFILDSDSNLKVSKQIDREELCPPQMMLQLNK
VCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYC
TIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELPFKLGNSSDFELAKHF
KDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDIN
DNAPKFERPIYIRTIKENVIVDPIFQILVTDEDEDENGRIDLKMHNSGQE
WINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNS
LSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFSIDEGTLSNKILAYVQ
VSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDRE
ANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNV
YYGQIEENINNHEVFMNAAIHAADKDLHLNGKVTYHIQDFKNSSNAMYFR
IDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQ
NDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKSD
SQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPSRIFNDLIQ
EAMIVITVRDLNDSPPTFRLKDPSKSQLIISLETLQQGQICESIPFEVED
ADDNNNVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLI
ASDKHGNDSIETEITFKILFINDPNVATQSKNQPPSSRNQKPEQAKDEIR
QITMIIILASLAGLFIIVILMVLIITIRKCDRLNINNDGSGSDKNNQYDS
QAMLDRNCIIQKNDLEASSFADIMTTSPMNFYNGLQVIPSNKSLHSTTNF
KYPVEMEFTSKDDYLPPPYTKYHLIDKSDETYQILKSNPKQMETYDSIIR
AIPIKASSQANQMTNNETFPNSKPSLTSQINLVTISDKPTHSTIRSNQTS
FV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000299FERM_domain
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 475..494
score: 42.63
coord: 494..507
score: 37.53
coord: 554..580
score: 31.06
coord: 589..606
score: 42.01
coord: 256..285
score: 17.4
coord: 67..86
score: 23.24
coord: 336..348
score: 33.43
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 399..494
e-value: 0.011
score: 23.9
coord: 629..716
e-value: 2.7E-9
score: 46.9
coord: 165..254
e-value: 3.4E-9
score: 46.5
coord: 277..369
e-value: 2.1E-12
score: 57.2
coord: 520..605
e-value: 1.3E-25
score: 101.1
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 501..597
e-value: 2.3E-11
score: 44.0
coord: 613..708
e-value: 1.2E-8
score: 35.3
coord: 264..362
e-value: 1.2E-8
score: 35.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 23..134
e-value: 1.6E-5
score: 27.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 492..602
e-value: 2.8E-28
score: 100.7
coord: 603..721
e-value: 1.7E-21
score: 78.8
coord: 252..368
e-value: 3.5E-20
score: 74.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 136..251
e-value: 1.1E-17
score: 66.5
coord: 369..491
e-value: 2.7E-10
score: 42.6
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 54..602
coord: 587..941
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 378..496
score: 13.553
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 608..718
score: 21.117
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 18..142
score: 10.572
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 257..371
score: 18.069
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 497..607
score: 25.172
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 151..256
score: 17.74
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 500..603
e-value: 4.91341E-24
score: 95.4581
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 151..252
e-value: 2.04514E-14
score: 67.7237
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 260..366
e-value: 2.28828E-15
score: 70.4201
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 611..713
e-value: 8.9889E-16
score: 71.5757
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 384..492
e-value: 3.82261E-6
score: 44.2266
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.708
NoneNo IPR availableTMHMMTMhelixcoord: 855..877
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 595..605
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 244..254
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 490..607
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 136..248
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 244..374
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 595..723