Glutathione S-transferase

Overview
NameGlutathione S-transferase
Smed IDSMED30000428
Length (bp)770
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutathione S-transferase (SMED30000428) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutathione S-transferase (SMED30000428) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutathione S-transferase (SMED30000428) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutathione S-transferase (SMED30000428) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000428

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 28

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
lateral branchSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000428SMESG000016836.1 Contig47140uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000428SMESG000016836.1 Contig47140newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000428SMESG000016836.1 Contig35506uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000428SMESG000016836.1 Contig35506newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head marginSMED30000428SMESG000016836.1 EC385034.1ncbi_smed_estsPMID:19805089
Petersen et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30000428SMESG000016836.1 dd_Smed_v6_816_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000428SMESG000016836.1 OX_Smed_1.0.03703ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30000428SMESG000016836.1 dd_Smed_v6_816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000428SMESG000016836.1 dd_Smed_v6_816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30000428SMESG000016836.1 dd_Smed_v6_816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000428SMESG000016836.1 dd_Smed_v6_816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30000428SMESG000016836.1 dd_Smed_v6_816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30000428SMESG000016836.1 dd_Smed_v6_816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30000428SMESG000016836.1 dd_Smed_v6_816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000428SMESG000016836.1 dd_Smed_v4_816_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: HPGDS (hematopoietic prostaglandin D synthase [Source:HGNC Symbol;Acc:HGNC:17890])

HSP 1 Score: 100.908 bits (250), Expect = 1.395e-25
Identity = 65/206 (31.55%), Postives = 106/206 (51.46%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKK---KAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPAF----PKLENIYNKVMTSYPGIKKHVETRPQT 648
            MP  KLTYF+ RGR E+IR+I    + +++D R+    W   K ++ +G++P+L ++ G  L +S+AI+R+L +   L G  EME   +D  +DT++D       S F   EKK   K +M  +L     P    +L  Y+  G   +L G + + AD +  +   +L   KP      P+L  +  KV  + P +   ++ RPQT
Sbjct:    1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVD-GLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDF-----MSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYL--GGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQ-AIPAVANWIKRRPQT 197          
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: GSTP1 (glutathione S-transferase pi 1 [Source:HGNC Symbol;Acc:HGNC:4638])

HSP 1 Score: 79.7221 bits (195), Expect = 1.731e-17
Identity = 65/201 (32.34%), Postives = 95/201 (47.26%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLAD---LFLCVILDSL-PEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            MP   + YF  RGR   +R +L  Q + + +E +T E W  G+ K S  YGQLP    +    L +S  I R L R   LYGKD+ E   +D   D + DL  K +  I+   E  K +  K L  +  P  F  L+   ++G   F+ G   S AD   L L +I + L P    AFP L + Y   +++ P +K  + +
Sbjct:    1 MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQ-DGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKP--FETLLSQ-NQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLL-SAYVGRLSARPKLKAFLAS 196          
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: GSTA4 (glutathione S-transferase alpha 4 [Source:HGNC Symbol;Acc:HGNC:4629])

HSP 1 Score: 71.2478 bits (173), Expect = 3.489e-14
Identity = 59/197 (29.95%), Postives = 105/197 (53.30%), Query Frame = 1
Query:   64 KLTYFDGRGRGELIRFILHSQNEKFDDERL-TFEQWGARKP--SVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKP----AFPKLENIYNKVMTSYPGIKKHVE 633
            KL Y +GRGR E +R++L +   +FD+E L T EQ    +    + + Q+P++ ++ G +L ++ +I  ++A K  L+GK+  E   ID  ++   DL    +   F K + ++ E+  ++ +K + +YF    K +     +FL G   SLAD+ L   + +L E  P    AFP L+  Y   +++ P IK+ +E
Sbjct:    6 KLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEID-GMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEV-VNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQE-YTVKLSNIPTIKRFLE 199          
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: GSTA4 (glutathione S-transferase alpha 4 [Source:HGNC Symbol;Acc:HGNC:4629])

HSP 1 Score: 71.2478 bits (173), Expect = 3.489e-14
Identity = 59/197 (29.95%), Postives = 105/197 (53.30%), Query Frame = 1
Query:   64 KLTYFDGRGRGELIRFILHSQNEKFDDERL-TFEQWGARKP--SVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKP----AFPKLENIYNKVMTSYPGIKKHVE 633
            KL Y +GRGR E +R++L +   +FD+E L T EQ    +    + + Q+P++ ++ G +L ++ +I  ++A K  L+GK+  E   ID  ++   DL    +   F K + ++ E+  ++ +K + +YF    K +     +FL G   SLAD+ L   + +L E  P    AFP L+  Y   +++ P IK+ +E
Sbjct:    6 KLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEID-GMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEV-VNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQE-YTVKLSNIPTIKRFLE 199          
BLAST of Glutathione S-transferase vs. Ensembl Human
Match: GSTP1 (glutathione S-transferase pi 1 [Source:HGNC Symbol;Acc:HGNC:4638])

HSP 1 Score: 68.1662 bits (165), Expect = 1.738e-13
Identity = 40/110 (36.36%), Postives = 55/110 (50.00%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIF 375
            MP   + YF  RGR   +R +L  Q + + +E +T E W  G+ K S  YGQLP    +    L +S  I R L R   LYGKD+ E   +D   D + DL  K +  I+
Sbjct:    1 MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQ-DGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIY 109          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-36 (Probable glutathione S-transferase gst-36 [Source:UniProtKB/Swiss-Prot;Acc:Q09607])

HSP 1 Score: 107.071 bits (266), Expect = 3.647e-28
Identity = 67/211 (31.75%), Postives = 107/211 (50.71%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKD--LKEKFVP--QYFGNLVK--YIDEGKGAFLAGANASLADLFLCVILDSL-----PEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTP 651
            MP  K  YFD RGRGE IR + H  +EKFDDER   EQWG  K  +  GQ+PVL ++ G ++S++ AI+R+L  +    G + ++  R+D   + I +    +    F +      +  K+   KE  +P  + +  +V+   ++ G    L G   +  D+F       L     P+A  A+P +  + N+V  ++P IKK+V  R  TP
Sbjct:    1 MPHFKFYYFDVRGRGEAIRLLFHLADEKFDDERFGMEQWGVLKSEMPLGQVPVLEID-GVKISQTTAIARYLGHQFHRAGTNAVDCARLDMIAEVIQEFMSSSGMGKFSRVLLGMIQANKEQFFKENVLPDVEKYAPIVEKFLLENGNNGLLLGDRETWVDVFAAESFSKLIDYGSPDALDAYPHILALINRVF-NHPNIKKYVSQRKATP 209          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-19 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q93701])

HSP 1 Score: 105.145 bits (261), Expect = 2.134e-27
Identity = 72/209 (34.45%), Postives = 107/209 (51.20%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEK-DEKKKAEMQKDLKEKFVP---QYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPE----AKPAFPKLENIYNKVMTSYPGIKKHVETRPQTPF 654
            MP  K TYF  RG GE +R + H  +  F DER +FE+WGA K     GQLP+L ++ G ++ +S AI R+LA K    GK   +   +D  +D   D +++  + +  K   K + E+ K + E  VP    YF  L   ++  K  FL G + + ADL +   L++L           PKL  +  KV  S PGIK++V +R  + F
Sbjct:    1 MPSYKFTYFPFRGLGEPVRLLFHLADCPFKDERFSFEEWGAVKSKSPMGQLPILGVD-GLEIPQSAAILRYLALKFGFAGKTPEDRAWVDAVVDRFKDFFVEFKKFLVAKRGGKSEEEVAKVVSESVVPAMESYFKLLNGLLERSKSGFLIGNSITYADLVVVNNLETLRNFGFLNASEQPKLTALLEKVY-SQPGIKEYVSSRTASDF 207          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-20 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:G5EC71])

HSP 1 Score: 104.375 bits (259), Expect = 4.022e-27
Identity = 63/208 (30.29%), Postives = 104/208 (50.00%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVP---QYFGNLVKYIDEGKGAFLAGANASLADLFLC----VILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTPF 654
            M   K  YF+GRG G++ R +      K++D R+    W A+KP + +GQ+PVL L  G Q+ +SMAI+R+LA+K    GK + E    D  ID   D Y +     + K    + + +++ K+  +P   ++   + K++      FL     + ADL +C     ++   PE    +P ++  Y KV    P I+KH+E+ P   F
Sbjct:    1 MAEYKFYYFNGRGLGDVSRQLFALSGTKYEDIRIEHADWPAQKPKMPFGQMPVLELSSGLQIPQSMAIARYLAKKFGYAGKTDEEAALADALIDQFKDFYAEIKPYYYAKIGVLQNDTEEEKKKTLIPARDKFLTIIGKFLKLSISGFLFSGGLTYADLMICDNMRTLIAWWPEYLNEYPDIKAWYQKV-DGIPEIRKHLESSPDKGF 207          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-5 (Probable glutathione S-transferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q09596])

HSP 1 Score: 101.679 bits (252), Expect = 4.010e-26
Identity = 69/208 (33.17%), Postives = 109/208 (52.40%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVT--YGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVP---QYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPAFPKLENI--YNKVMTSYPGIKKHVETRPQTPF 654
            M   KLTYF+GRG GE+ R I     ++++D R+T EQW A K +    +GQLP L ++ G +L++S AI+RFLAR+ KL GK   E  +++   D   D   +A    +        +++   K+ F+P   +++G LV ++      FL G + +  DL +      L      F K   +  + + + + P IKK +ETRP TPF
Sbjct:    1 MVSYKLTYFNGRGAGEVSRQIFAYAGQQYEDNRVTQEQWPALKETCAAPFGQLPFLEVD-GKKLAQSHAIARFLAREFKLNGKTAWEEAQVNSLADQYKDYSSEARPYFYAVMGFGPGDVETLKKDIFLPAFEKFYGFLVNFLKASGSGFLVGDSLTWIDLAIAQHSADLIAKGGDFSKFPELKAHAEKIQAIPQIKKWIETRPVTPF 207          
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Match: gst-8 (Probable glutathione S-transferase 8 [Source:UniProtKB/Swiss-Prot;Acc:P91254])

HSP 1 Score: 99.7525 bits (247), Expect = 1.961e-25
Identity = 63/204 (30.88%), Postives = 107/204 (52.45%), Query Frame = 1
Query:   64 KLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVP---QYFGNLVKYIDEGKGAFLAGANASLADLFLCV----ILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTPF 654
            KL+YF  RG GE+IR I     + F+D R++ E+W A KP+  +GQLP+L ++ G  L +S +I+RFLAR+  + GK   E  +++   D   D   +    +  K    + ++    K+ F+P   +++G +  ++      +L G + +  DL +      IL + P     FP+ +    KV ++   IKK +ETRP+T F
Sbjct:    5 KLSYFPIRGAGEVIRQIFVYAGQSFEDHRISIEEWAAVKPTTPFGQLPLLEVD-GKVLPQSHSIARFLARQFGINGKCAWEEAQVNSIADQFKDYRNEVRPYVMVKMGFAEGDLDALSKDVFLPGFKKHYGFIYNFLKTAGSGYLVGDSLTFVDLLIAQHTADILSTDPALLEEFPQFKAHQEKVHSN-ANIKKWLETRPETQF 206          
BLAST of Glutathione S-transferase vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0087005)

HSP 1 Score: 94.3597 bits (233), Expect = 7.234e-23
Identity = 59/199 (29.65%), Postives = 105/199 (52.76%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLP-----EAKPAFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            L YF+ +   E +R++    N++++D R+T ++W A KP++  GQ+PVL ++ G ++ +S++++RFLA+   L G    E  +ID  +DTIND  LK     +E +++ K +    L  + +P Y   L + + +  G  LA    + AD++   I D +      +    +P L  + + V    P IK  +E RP T
Sbjct:   52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVD-GKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDG-HLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEP-IKAWIEKRPVT 247          
BLAST of Glutathione S-transferase vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0100258)

HSP 1 Score: 94.3597 bits (233), Expect = 7.234e-23
Identity = 59/199 (29.65%), Postives = 105/199 (52.76%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLP-----EAKPAFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            L YF+ +   E +R++    N++++D R+T ++W A KP++  GQ+PVL ++ G ++ +S++++RFLA+   L G    E  +ID  +DTIND  LK     +E +++ K +    L  + +P Y   L + + +  G  LA    + AD++   I D +      +    +P L  + + V    P IK  +E RP T
Sbjct:   52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVD-GKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDG-HLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEP-IKAWIEKRPVT 247          
BLAST of Glutathione S-transferase vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0087006)

HSP 1 Score: 94.3597 bits (233), Expect = 7.234e-23
Identity = 59/199 (29.65%), Postives = 105/199 (52.76%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLP-----EAKPAFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            L YF+ +   E +R++    N++++D R+T ++W A KP++  GQ+PVL ++ G ++ +S++++RFLA+   L G    E  +ID  +DTIND  LK     +E +++ K +    L  + +P Y   L + + +  G  LA    + AD++   I D +      +    +P L  + + V    P IK  +E RP T
Sbjct:   52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVD-GKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDG-HLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEP-IKAWIEKRPVT 247          
BLAST of Glutathione S-transferase vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0333551)

HSP 1 Score: 92.0485 bits (227), Expect = 5.317e-22
Identity = 59/200 (29.50%), Postives = 107/200 (53.50%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSI-FEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLP-----EAKPAFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            L YF+ +   E +R++    N++++D R+T ++W A KP++  GQ+PVL ++ G ++ +S++++RFLA+   L G    E  +ID  +DTIND  L + Q + +E +++ K +    L  + +P Y   L + + +  G  LA    + AD++   I D +      +    +P L  + + V    P IK  +E RP T
Sbjct:   52 LFYFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVD-GKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPFYLEKLEQTVKDNDG-HLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAVNALEP-IKAWIEKRPVT 248          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: gstp1 (glutathione S-transferase pi 1 [Source:ZFIN;Acc:ZDB-GENE-020806-4])

HSP 1 Score: 81.6481 bits (200), Expect = 2.316e-18
Identity = 60/196 (30.61%), Postives = 98/196 (50.00%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSL----PEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            LTYF  +GR   ++ +L  ++++  +  +TFE+W  G  K +  +GQLP    +    L +S A+ R L RK   YGK++ E   ID   D + DL LK ++ I+++ E  K    KDL     P +       + + K  FL G   S AD  L  +L +L    P    +FP L++  +K+ ++ P +K  +E 
Sbjct:    6 LTYFAVKGRCGALKIMLADKDQQLKENLVTFEEWMKGDLKATCVFGQLPKFE-DGDLVLFQSNAMLRHLGRKHAAYGKNDSEASLIDVMNDGVEDLRLKYIKLIYQEYETGKEAFIKDL-----PNHLKCFENVLAKNKTGFLVGDQISFADYNLFDLLLNLKVLSPSCLDSFPSLKSFVDKI-SARPKVKALLEC 194          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: gstp2 (glutathione S-transferase pi 2 [Source:ZFIN;Acc:ZDB-GENE-050601-1])

HSP 1 Score: 77.411 bits (189), Expect = 9.381e-17
Identity = 61/196 (31.12%), Postives = 98/196 (50.00%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSL----PEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            LTYF  +GR   ++ +L  + ++  +  +T + W  G  + +  +GQLP    +    L +S AI R L RK   YGK++ E   ID   D   DL  K ++ I+++ E  K    KDL  +F P  F N++    + K  FL G   SLAD  L  +L +L    P    +FP L++  +K+ ++ P +K  +E 
Sbjct:    6 LTYFAIKGRAGPLKILLADKEQQLKENVVTVQDWMKGDIRATCLFGQLPKFE-DGDLVLYQSNAILRHLGRKHGAYGKNDCEASLIDMMNDAAQDLRQKYIKLIYQEYETGKEAFIKDLPNEFKP--FENILA---KSKTGFLVGDQISLADYNLFDLLLNLKVLSPSCLDSFPSLKSFVDKI-SARPKVKALLEC 194          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: gsta.1 (glutathione S-transferase, alpha tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2720])

HSP 1 Score: 67.0106 bits (162), Expect = 7.352e-13
Identity = 60/199 (30.15%), Postives = 103/199 (51.76%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPS---VTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIF---EKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFL---CVILDSL-PEAKPAFPKLENIYNKVMTSYPGIKKHVE 633
            L YF+GRG+ E IR++L +   +F++  LT ++   +  S   +T+ Q+P++ ++ G +L +S AI  ++A K  LYGKD  E   ID   + + DL    + S F   E  EK  + +++  K +F+P +   L         +FL G   S AD+ L    ++L  L P     FPK++  + + M + P I K ++
Sbjct:    7 LHYFNGRGKMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGALTFQQVPLVEID-GMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMEMIMVSPFTPAENKEKVFSNIEEKAKVRFLPVFEKAL------ANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKIQA-FQEQMKALPAISKFLQ 197          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: gsta.1 (glutathione S-transferase, alpha tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2720])

HSP 1 Score: 67.0106 bits (162), Expect = 7.352e-13
Identity = 60/199 (30.15%), Postives = 103/199 (51.76%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPS---VTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIF---EKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFL---CVILDSL-PEAKPAFPKLENIYNKVMTSYPGIKKHVE 633
            L YF+GRG+ E IR++L +   +F++  LT ++   +  S   +T+ Q+P++ ++ G +L +S AI  ++A K  LYGKD  E   ID   + + DL    + S F   E  EK  + +++  K +F+P +   L         +FL G   S AD+ L    ++L  L P     FPK++  + + M + P I K ++
Sbjct:    7 LHYFNGRGKMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGALTFQQVPLVEID-GMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMEMIMVSPFTPAENKEKVFSNIEEKAKVRFLPVFEKAL------ANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKIQA-FQEQMKALPAISKFLQ 197          
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Match: AL929536.3 (pep chromosome:GRCz11:13:835390:840787:1 gene:ENSDARG00000113274.1 transcript:ENSDART00000171329.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929536.3)

HSP 1 Score: 66.6254 bits (161), Expect = 8.283e-13
Identity = 57/199 (28.64%), Postives = 101/199 (50.75%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPS---VTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKA---EMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFL----CVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVE 633
            L YF+GRGR E IR++L +   +F++  LT ++   +  S   +T+ Q+P++ ++ G +L +S AI  ++A K  LYGKD  E   ID   + + DL    + + F   E K+     +++  K +F+P +   L         +FL G   S AD+ L     ++ +  P     FPK++   ++ M + P I K ++
Sbjct:    7 LHYFNGRGRMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGVLTFQQVPLVEID-GMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMGMIIMAPFTPAENKEETFRNIEEKAKVRFLPVFEKAL------ANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKIQAFQDQ-MKALPAISKFLQ 197          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: hpgds (hematopoietic prostaglandin D synthase [Source:NCBI gene;Acc:448666])

HSP 1 Score: 113.235 bits (282), Expect = 2.751e-30
Identity = 68/202 (33.66%), Postives = 111/202 (54.95%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPAF----PKLENIYNKVMTSYPGIKKHVETRPQ 645
            MP   L YF+  GRGE++R++    +  F+D+R+ F  W A KP + YGQLPV+ ++ G   ++S+A+ R+LA+K  L GK++++  R+D  IDTI+D + K     F   + +KA  +K+  EK  PQ    L K +  G  ++  G + + AD +     DS     P F    PKL  + ++V  + P I   ++ RP+
Sbjct:    1 MPSYTLKYFNLEGRGEILRYLFSYSDIPFEDQRIEFADWPALKPKIPYGQLPVVEID-GVIYNQSLAVGRYLAKKGGLIGKNDLDEIRVDALIDTIDDFFSK-----FPWMDTEKA--KKEFMEKSGPQLLSYLEKTL--GNNSWFVGDSVTWADFYWDTCSDSFENYVPGFAKDYPKLLALKDRV-KAIPAIAAWIKKRPK 191          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 68.5514 bits (166), Expect = 2.166e-13
Identity = 66/208 (31.73%), Postives = 97/208 (46.63%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGA----RKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADL----FLCVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVET-----RPQTP 651
            LTYF  RGR E IR +L  Q   F DE      W A    RK    +GQLP         L +S +I R+L RK  L G ++ E   ID   D + DL  K V+ IF + +  K +  + L ++   ++F  ++     G   F+ G   S AD      L   LD  P++  AFP L + Y + + S P + +++++     RP TP
Sbjct:    6 LTYFPVRGRAEAIRLLLADQGVAFKDEEAQIPLWFAGKDDRKKHAVFGQLPQFK-NGDYTLYQSNSILRYLGRKHGLNGSNDEELGHIDMVNDGVEDLRQKYVRLIFTEYDTGKDKYLEALPQQL--EFFERILSKNHNG-SKFIVGQKISYADYNLLDLLHCHLDLSPKSLSAFPLL-SAYVERLNSRPKLNEYLKSEARNRRPITP 208          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 67.3958 bits (163), Expect = 5.927e-13
Identity = 60/200 (30.00%), Postives = 100/200 (50.00%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGA-----RKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSI-FEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGK----GAFLAGANASLADLFLCVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            LTYF  RGR E IR +L  Q+  ++++ + ++ W +     RK +V +G+LP         L +S +I R+LA K  L G ++ E+  ID   D++ DL  K  + I F   EK K +  + L ++   ++F  ++     G     G  ++ A+ +L DL  C  LD  PE   AFP L   Y + + S P +  ++ +
Sbjct:    6 LTYFPVRGRAEAIRLLLADQDIPWEEDEVQWQDWCSGNHDERKKAV-FGRLPQFQ-NGDFVLCQSNSILRYLAHKHGLTGDNDEESAHIDMVNDSVEDLRKKYGRFIYFTCQEKGKGKYLEGLPQQL--EFFERVLSKNHNGSKFVVGQKISYADYNLVDLLQCH-LDLSPECLSAFPLLR-AYLERLVSQPTLSDYLNS 199          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 66.2402 bits (160), Expect = 2.053e-12
Identity = 59/200 (29.50%), Postives = 100/200 (50.00%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGA-----RKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSI-FEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGK----GAFLAGANASLADLFLCVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            LTY+  RGR E IR +L  Q+  ++++ + ++ W +     RK +V +G+LP         L +S +I R+LA K  L G ++ E+  ID   D++ DL  K  + I F   EK K +  + L ++   ++F  ++     G     G  ++ A+ +L DL  C  LD  PE   AFP L   Y + + S P +  ++ +
Sbjct:   22 LTYYPVRGRAEAIRLLLADQDIPWEEDEVQWQDWCSGNHDERKKAV-FGRLPQFQ-NGDFVLCQSNSILRYLAHKHGLTGDNDEESAHIDMVNDSVEDLRKKYGRFIYFTCQEKGKGKYLEGLPQQL--EFFERVLSKNHNGSKFVVGQKISYADYNLVDLLQCH-LDLSPECLSAFPLLR-AYLERLVSQPTLSDYLNS 215          
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Match: ENSXETT00000044740.1 (glutathione S-transferase 3-like [Source:NCBI gene;Acc:100496158])

HSP 1 Score: 65.4698 bits (158), Expect = 2.737e-12
Identity = 56/202 (27.72%), Postives = 97/202 (48.02%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDD----ERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKD---EKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTP 651
            L YF+GRGR E IR++L +   +F++    +R  +EQ   ++  + +GQ+P++ ++ G  L+++  I  ++A K  LYGKD  E Y IDR  D   DL    +   F  D   EK+K  +++    K+ P Y   L          +L G   S AD+ L            A   +E  ++ +++ +P ++   E   + P
Sbjct:    7 LYYFNGRGRMESIRWLLGAAGIEFEEVYLEKREQYEQL-IKEGRLMFGQVPLVEMD-GMNLTQTHPILSYIAAKYNLYGKDPKERYEIDRYADGTIDLMGLGLAYPFLDDAGKEKQKGLIKERATNKYFPVYETAL------KDKDYLVGNKFSWADIQLM----------EAILMVEEFHSDILSCFPQLQAFKERTKKMP 190          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Hpgds (hematopoietic prostaglandin D synthase [Source:MGI Symbol;Acc:MGI:1859384])

HSP 1 Score: 106.686 bits (265), Expect = 6.383e-28
Identity = 68/206 (33.01%), Postives = 108/206 (52.43%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIF---EKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPA----FPKLENIYNKVMTSYPGIKKHVETRPQT 648
            MP  KL YF+ RGR E+IR+I    + K++D R+    W   KP++ +G++PVL +E G  + +S+AI+R+L +   L GK  +E  + D  +DT++D       S+F   EKD+  K  M  +L     P+   +L  Y+  G   +  G   + AD +  +   +L   KP     +PKL ++ NKV  + P I   +  RPQT
Sbjct:    1 MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVE-GLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDF-----MSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYL--GDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQ-AIPAISAWILKRPQT 197          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Gstp1 (glutathione S-transferase, pi 1 [Source:MGI Symbol;Acc:MGI:95865])

HSP 1 Score: 81.6481 bits (200), Expect = 2.793e-18
Identity = 67/201 (33.33%), Postives = 96/201 (47.76%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLAD---LFLCVILDSL-PEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            MP   + YF  RGR E +R +L  Q + + +E +T + W  G  KP+  YGQLP    +    L +S AI R L R   LYGK++ E  ++D   D + DL  K V  I+   E  K +  K L     P  F  L+   ++G  AF+ G   S AD   L L +I   L P     FP L + Y   +++ P IK  + +
Sbjct:    1 MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFE-DGDLTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYVKALPGHLKP--FETLLSQ-NQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLL-SAYVARLSARPKIKAFLSS 196          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Gstp1 (glutathione S-transferase, pi 1 [Source:MGI Symbol;Acc:MGI:95865])

HSP 1 Score: 81.6481 bits (200), Expect = 2.793e-18
Identity = 67/201 (33.33%), Postives = 96/201 (47.76%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLAD---LFLCVILDSL-PEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            MP   + YF  RGR E +R +L  Q + + +E +T + W  G  KP+  YGQLP    +    L +S AI R L R   LYGK++ E  ++D   D + DL  K V  I+   E  K +  K L     P  F  L+   ++G  AF+ G   S AD   L L +I   L P     FP L + Y   +++ P IK  + +
Sbjct:    1 MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFE-DGDLTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYVKALPGHLKP--FETLLSQ-NQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLL-SAYVARLSARPKIKAFLSS 196          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Gstp2 (glutathione S-transferase, pi 2 [Source:MGI Symbol;Acc:MGI:95864])

HSP 1 Score: 78.1814 bits (191), Expect = 5.691e-17
Identity = 65/201 (32.34%), Postives = 94/201 (46.77%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLAD---LFLCVILDSL-PEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            MP   + YF   GR E +R +L  Q + + +E +T + W  G  KP+  YGQLP    +    L +S AI R L R   LYGK++ E  ++D   D + DL  K    I+   E  K +  K L     P  F  L+   ++G  AF+ G   S AD   L L +I   L P     FP L + Y   +++ P IK  + +
Sbjct:    1 MPPYTIVYFPSPGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFE-DGDLTLYQSNAILRHLGRSLGLYGKNQREAAQVDMVNDGVEDLRGKYGTMIYRNYENGKNDYVKALPGHLKP--FETLLSQ-NQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLL-SAYVARLSARPKIKAFLSS 196          
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Match: Gstp2 (glutathione S-transferase, pi 2 [Source:MGI Symbol;Acc:MGI:95864])

HSP 1 Score: 78.1814 bits (191), Expect = 5.691e-17
Identity = 65/201 (32.34%), Postives = 94/201 (46.77%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLAD---LFLCVILDSL-PEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            MP   + YF   GR E +R +L  Q + + +E +T + W  G  KP+  YGQLP    +    L +S AI R L R   LYGK++ E  ++D   D + DL  K    I+   E  K +  K L     P  F  L+   ++G  AF+ G   S AD   L L +I   L P     FP L + Y   +++ P IK  + +
Sbjct:    1 MPPYTIVYFPSPGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFE-DGDLTLYQSNAILRHLGRSLGLYGKNQREAAQVDMVNDGVEDLRGKYGTMIYRNYENGKNDYVKALPGHLKP--FETLLSQ-NQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLL-SAYVARLSARPKIKAFLSS 196          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|P46428|GST_ANOGA (Glutathione S-transferase OS=Anopheles gambiae OX=7165 GN=GstS1 PE=2 SV=4)

HSP 1 Score: 117.087 bits (292), Expect = 6.573e-31
Identity = 70/204 (34.31%), Postives = 108/204 (52.94%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPA-----FPKLENIYNKVMTSYPGIKKHVETRPQT 648
            MP  K+ YF+ +  GE +RF+L   N  FDD R+T E+W A KP++  GQ+PVL ++ G ++ +S+A+SR+LA +  L G D+ E   ID  +DT+ND  LK     +E D+  K +    L  + +P Y   L     E  G  + G   + AD++   ILD L           FP L+ +  KV+ +   +K ++  RP T
Sbjct:    1 MPDYKVYYFNVKALGEPLRFLLSYGNLPFDDVRITREEWPALKPTMPMGQMPVLEVD-GKKVHQSVAMSRYLANQVGLAGADDWENLMIDTVVDTVNDFRLKIAIVAYEPDDMVKEKKMVTLNNEVIPFYLTKLNVIAKENNGHLVLGK-PTWADVYFAGILDYLNYLTKTNLLENFPNLQEVVQKVLDN-ENVKAYIAKRPIT 201          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|P46436|GST1_ASCSU (Glutathione S-transferase 1 OS=Ascaris suum OX=6253 GN=GST1 PE=1 SV=3)

HSP 1 Score: 107.842 bits (268), Expect = 1.984e-27
Identity = 77/215 (35.81%), Postives = 109/215 (50.70%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKA-----VQSIFEKDEKKKAEMQKDLKEKFVP---QYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPAFPKLEN------IYNKVMTSYPGIKKHVETRPQTPF 654
            MP  KLTYFD RG GE  R I H    KF+D RL  E W A KP   +GQLP+L ++ G  L++S AI R+L R+  L GK  ME  ++D   D   D   +      V + FE+ +K+K      LKE  VP   ++   L K++ +    ++ G + + ADL   VI DSL   +   P   +       Y + +   P IKK +  RP+TP+
Sbjct:    1 MPQYKLTYFDIRGLGEGARLIFHQAGVKFEDNRLKREDWPALKPKTPFGQLPLLEVD-GEVLAQSAAIYRYLGRQFGLAGKTPMEEAQVDSIFDQFKDFMAELRPCFRVLAGFEEGDKEKV-----LKEVAVPARDKHLPLLEKFLAKSGSEYMVGKSVTWADL---VITDSLASWESLIPDFLSGHLQLKKYIEHVRELPNIKKWIAERPKTPY 206          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|O35543|HPGDS_RAT (Hematopoietic prostaglandin D synthase OS=Rattus norvegicus OX=10116 GN=Hpgds PE=1 SV=3)

HSP 1 Score: 107.457 bits (267), Expect = 2.629e-27
Identity = 67/206 (32.52%), Postives = 109/206 (52.91%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIF---EKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKP----AFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            MP  KL YF+ RGR E+IR+I    + K++D R+    W   KP++ +G++PVL +E G  L +S+AI+R+L +   L GK E+E  ++D  +DT++D       S+F   E+++  K     DL  +  P    +L  Y+  G   +  G   + AD +  +   +L   KP     +P+L ++ NKV  + P I   +  RPQT
Sbjct:    1 MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVE-GLTLHQSLAIARYLTKNTDLAGKTELEQCQVDAVVDTLDDF-----MSLFPWAEENQDLKERTFNDLLTRQAPHLLKDLDTYL--GDKEWFIGNYVTWADFYWDICSTTLLVLKPDLLGIYPRLVSLRNKVQ-AIPAISAWILKRPQT 197          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|Q9JHF7|HPGDS_MOUSE (Hematopoietic prostaglandin D synthase OS=Mus musculus OX=10090 GN=Hpgds PE=1 SV=3)

HSP 1 Score: 106.686 bits (265), Expect = 4.465e-27
Identity = 68/206 (33.01%), Postives = 108/206 (52.43%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIF---EKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPA----FPKLENIYNKVMTSYPGIKKHVETRPQT 648
            MP  KL YF+ RGR E+IR+I    + K++D R+    W   KP++ +G++PVL +E G  + +S+AI+R+L +   L GK  +E  + D  +DT++D       S+F   EKD+  K  M  +L     P+   +L  Y+  G   +  G   + AD +  +   +L   KP     +PKL ++ NKV  + P I   +  RPQT
Sbjct:    1 MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVE-GLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDF-----MSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYL--GDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQ-AIPAISAWILKRPQT 197          
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Match: sp|Q09607|GST36_CAEEL (Probable glutathione S-transferase gst-36 OS=Caenorhabditis elegans OX=6239 GN=gst-36 PE=3 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 4.639e-27
Identity = 67/211 (31.75%), Postives = 107/211 (50.71%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKD--LKEKFVP--QYFGNLVK--YIDEGKGAFLAGANASLADLFLCVILDSL-----PEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTP 651
            MP  K  YFD RGRGE IR + H  +EKFDDER   EQWG  K  +  GQ+PVL ++ G ++S++ AI+R+L  +    G + ++  R+D   + I +    +    F +      +  K+   KE  +P  + +  +V+   ++ G    L G   +  D+F       L     P+A  A+P +  + N+V  ++P IKK+V  R  TP
Sbjct:    1 MPHFKFYYFDVRGRGEAIRLLFHLADEKFDDERFGMEQWGVLKSEMPLGQVPVLEID-GVKISQTTAIARYLGHQFHRAGTNAVDCARLDMIAEVIQEFMSSSGMGKFSRVLLGMIQANKEQFFKENVLPDVEKYAPIVEKFLLENGNNGLLLGDRETWVDVFAAESFSKLIDYGSPDALDAYPHILALINRVF-NHPNIKKYVSQRKATP 209          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: J7IB22 (Glutathione S-transferase sigma 3 OS=Mytilus galloprovincialis OX=29158 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 8.271e-45
Identity = 87/203 (42.86%), Postives = 128/203 (63.05%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPAFPKLENIYNKV------MTSYPGIKKHVETRP 642
            MP  KL+YF G+GRGEL R +  +  ++F+DERL  E+W A KP   YGQ+PVLT++ G  +++S AISRFLAR+  LYGKD ME  R D  ++TIND+    ++  FEKDE KKAE  K LKE  +P++   L   ++     +L G++ ++AD+ +  IL+   +A  AF  + N Y+ +      + S P IKK++E+RP
Sbjct:    1 MPSYKLSYFKGKGRGELARLMFAAAGKEFEDERLAGEEWLAFKPKTPYGQMPVLTVD-GKMINQSGAISRFLARELGLYGKDNMENTRCDVILETINDIATDMIKYFFEKDETKKAEALKTLKENSLPKFLKFLTTVLEGNGNKYLVGSDLTVADIAVFDILEWFNDA--AFSGVFNDYSAIQNLVDRVKSIPNIKKYLESRP 200          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: A0A3S1BMW4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_007733 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 4.966e-40
Identity = 79/203 (38.92%), Postives = 123/203 (60.59%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKP----AFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            MP  KL YFD RGR E+ R I     +KF+D R+  E W A KP+  +GQ+PVL ++ G ++ +S+AI+ +LAR+  LYGK  ME  RID+ +  + DL    ++++FEKDE KKAE+ K   E+ +P++FG     + +    F  G + +LADLF+  +  ++ +A P    +FP L+  +N++  S P IK +V+ R  T
Sbjct:    1 MPSYKLFYFDVRGRAEIARLIFTYAGKKFEDNRVGREDWPALKPNTPFGQMPVLEVD-GEKIGQSVAIANYLAREFGLYGKTNMEGCRIDQVVCLVQDLISAFIKAMFEKDEAKKAELTKANNEEVIPRFFGFFESLLKKNGTGFFVGKDVTLADLFVYDVTWNMVKASPTALDSFPLLKANHNRI-ASVPQIKAYVDARKPT 201          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: K1RA71 (Glutathione-requiring prostaglandin D synthase OS=Crassostrea gigas OX=29159 GN=CGI_10022749 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.741e-37
Identity = 75/196 (38.27%), Postives = 119/196 (60.71%), Query Frame = 1
Query:   73 YFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKP----AFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            YF+ +GRGE++R +L +    F+D R+  E+W   K S+  GQ+PVL ++ G + S+S+AI+R+LAR+  + GK   +   +D+ +DT+NDL  + ++ +FEKDE +KAEM+K LKE+ +P+ FG L  +++   G +  G   SLAD+F   I+  + E  P     FPKL     K   S P I  ++  RP+T
Sbjct:    8 YFNIKGRGEIVRLMLTAAGVDFEDHRVQGEEWPKLKSSMPTGQMPVLEID-GKKYSQSLAIARYLAREYGMAGKTNTDQLLMDQIVDTVNDLINEMIKPVFEKDEARKAEMEKKLKEETMPRIFGTLNNFLEGNGGDYFVGTKLSLADVFFMDIVSRVVEKDPKALEKFPKLAANLKKTQ-SEPKIAAYLAKRPKT 201          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: A0A194AP16 (Putative sigma class glutathione-s-transferase 2 OS=Pinctada fucata OX=50426 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 5.737e-37
Identity = 80/208 (38.46%), Postives = 120/208 (57.69%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIF-EKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDE--GKGAFLAGANASLADLFL----CVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTPF 654
            MP  KL YF  RGRGE+IR +L    + F+D R+T E+W   K  +  GQ+P+L ++ G  ++ES+AI+R+LAR+  L GK   E Y +DR +  ++D + KAVQ +F EKDEKKKAE+QK L ++  P++     KY++E  G G F  G + +LADL +       L    +    +PKL+    K   + P +  ++  RP  P 
Sbjct:    1 MPKYKLHYFGVRGRGEIIRLVLTVAGQDFEDRRITQEEWPKVKSEIPSGQVPLLEVD-GKHMNESLAIARYLAREYDLGGKTNHEQYLVDRVVGAVDDYFTKAVQILFLEKDEKKKAELQKALDDEHTPRFLKMFTKYLEESGGDGDFFVGNSGTLADLAVHDCFTTFLKQNDKLLDKYPKLQ-ANRKATEALPHMADYLAKRPDVPI 206          
BLAST of Glutathione S-transferase vs. TrEMBL
Match: A0A194APU9 (Putative sigma class glutathione-s-transferase 2 OS=Pinctada fucata OX=50426 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 8.359e-37
Identity = 80/208 (38.46%), Postives = 120/208 (57.69%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIF-EKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDE--GKGAFLAGANASLADLFL----CVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTPF 654
            MP  KL YF  RGRGE+IR +L    + F+D R+T E+W   K  +  GQ+P+L ++ G  ++ES+AI+R+LAR+  L GK   E Y +DR +  ++D + KAVQ +F EKDEKKKAE+QK L ++  P++     KY++E  G G F  G + +LADL +       L    +    +PKL+    K   + P +  ++  RP  P 
Sbjct:    1 MPKYKLHYFGVRGRGEIIRLVLTVAGQDFEDRRITQEEWPKVKSEIPSGQVPLLEVD-GKHMNESLAIARYLAREYDLGGKTNHEQYLVDRVVGAVDDYFTKAVQILFLEKDEKKKAELQKALDDEHTPRFLKLFTKYLEESGGDGDFFVGNSGTLADLAVHDCFTTFLKQNDKLLDKYPKLQ-ANRKATEALPHMADYLAKRPDVPI 206          
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Match: GSTP1 (glutathione S-transferase pi 1 [Source:NCBI gene;Acc:103038276])

HSP 1 Score: 77.411 bits (189), Expect = 9.721e-17
Identity = 60/213 (28.17%), Postives = 104/213 (48.83%), Query Frame = 1
Query:   16 FISIHSVIIDSTMPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLC-VILDSL---PEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            +++  ++ + +  P   +TYF  RGR    R +L  Q +++ +  ++FE W  G  K +  +GQLP    + G  L +S    R L RK   YGK++ E  +ID   D + DL  K ++ I+++ E  K    KDL     P +       + + K  FL G + S AD  L  V+L+ L   P    + P L++  +  +++ P IK  +++
Sbjct:   10 YLTCFALSLSAVAPYT-ITYFAVRGRCGATRIMLADQGQEWKEIVVSFEDWMKGDLKKTCVFGQLPKFE-DGGLTLFQSNTFLRHLGRKHGAYGKNDCEAAQIDMFNDGVEDLRTKYLKMIYQEYETGKDAYIKDL-----PNHLCKFEAVLAKNKSGFLVGDSISFADYSLFEVLLNHLVLSPTCLDSLPALKSFVD-TLSARPKIKAFLDS 214          
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Match: GSTP1 (glutathione S-transferase pi 1 [Source:NCBI gene;Acc:103038276])

HSP 1 Score: 77.0258 bits (188), Expect = 1.102e-16
Identity = 59/196 (30.10%), Postives = 96/196 (48.98%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFEQW--GARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLC-VILDSL---PEAKPAFPKLENIYNKVMTSYPGIKKHVET 636
            +TYF  RGR    R +L  Q +++ +  ++FE W  G  K +  +GQLP    + G  L +S    R L RK   YGK++ E  +ID   D + DL  K ++ I+++ E  K    KDL     P +       + + K  FL G + S AD  L  V+L+ L   P    + P L++  +  +++ P IK  +++
Sbjct:    6 ITYFAVRGRCGATRIMLADQGQEWKEIVVSFEDWMKGDLKKTCVFGQLPKFE-DGGLTLFQSNTFLRHLGRKHGAYGKNDCEAAQIDMFNDGVEDLRTKYLKMIYQEYETGKDAYIKDL-----PNHLCKFEAVLAKNKSGFLVGDSISFADYSLFEVLLNHLVLSPTCLDSLPALKSFVD-TLSARPKIKAFLDS 194          
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Match: gsta.1 (glutathione S-transferase A4-like [Source:NCBI gene;Acc:103033890])

HSP 1 Score: 54.6842 bits (130), Expect = 1.187e-8
Identity = 53/203 (26.11%), Postives = 95/203 (46.80%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLTFE---QWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKA---EMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFL---CVILDSL-PEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQ 645
            L YF GRG+ E IR++L     +F+++  + +   Q       + + Q+P++ ++ G ++ ++ AI  ++A K  LYGKD  E   ID   +   D+    +   F   EKK++    ++   K + +P Y   L          +L G   S AD+ L    ++L+ L P     FP ++  + K M + P I K ++   Q
Sbjct:    7 LHYFIGRGKMESIRWLLTVAGVEFEEKFFSTKEEFQKLVESGDLLFHQVPLIEMD-GMKMVQTKAILNYIAGKYNLYGKDLKERLMIDTYAEGARDIMDLIMGVPFTPPEKKQSTLNNLETKAKVRSLPAYEKAL------SSSQYLVGNQLSCADVSLFEVALMLEELFPTILSTFPNIQA-FQKRMKAIPAINKFLQPGSQ 201          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO45159 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW9])

HSP 1 Score: 119.013 bits (297), Expect = 4.082e-33
Identity = 68/206 (33.01%), Postives = 112/206 (54.37%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVT--YGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFL---CVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTPF 654
            MP  KL YF+ RGR E  R +  +   +F+D R+   +W   K  +   +GQ+P+L ++   +L++S+AI  F+AR+  L   + ++  + D  +    D   K +Q  FEKDE KK E+ + ++   +P + G L K ++E    FL     + AD+ +   C  LDS   A   FPKL+  ++++  S PGIK ++E RP+T F
Sbjct:    1 MPSYKLYYFNARGRAEPARLVFAAAGIEFEDNRMAMGEWPKVKKELHAPFGQVPLLVIDDKIKLAQSLAIMTFIAREGGLAPSNSLDIAKCDMIVGAEEDFLTKKIQCHFEKDEAKKKELDEAIQNTHLPAFMGALTKILEENGTGFLVTDKMTYADIIVFNACNNLDS--GALDKFPKLKQHHDRI-ASNPGIKAYLEKRPKTDF 203          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO33767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR87])

HSP 1 Score: 107.457 bits (267), Expect = 1.765e-28
Identity = 68/196 (34.69%), Postives = 100/196 (51.02%), Query Frame = 1
Query:   55 PVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPS--VTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKG--AFLAGANASLADL-FLCVI--------LDSLPEAKPAFPKLENIYNKVMT 603
            P  ++ YFD R R E IR +LH  +  F DER+    W A K S    +G+LP+L +  G +L++S AI RFLA++  L   D     R D  +D   D+  K   + +EKDEK K +  K+  E+ +P+    + K   E KG   +L G   + AD+ F C          LD +PE    +P L ++YN+VM 
Sbjct:    3 PTYRVVYFDARARAECIRVLLHLADVPFTDERVAPPDWAAMKTSGRCPFGELPLLEISDGRKLAQSHAIFRFLAKEHGLAPSDSYSQARCDMFLDNTKDMIEKVGTAFWEKDEKLKEQKSKEFHEETLPKRLEFINKLFQENKGGKGYLVGDKITYADIDFFCFFNGFINSGKLD-VPEQLSKYPLLVDLYNRVMN 197          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO45327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT47])

HSP 1 Score: 105.916 bits (263), Expect = 4.894e-28
Identity = 68/209 (32.54%), Postives = 107/209 (51.20%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPS--VTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYID-----EGKGAFLAGANASLADLFLCVILDSLPEAKPA----FPKLENIYNKVMTSYPGIKKHVETRPQ 645
            MP  KL YF+ RGR E  R    +    ++D RLT E+W   K       G LPVL ++ G Q  ESMAI R  A+ A L      E  R D  +D  +DL+ KA++  FEKD+++K ++Q++ KE+ + +++  + + +      +G   +  G   + AD+ L    D+     P     FP L +++ +V  + PGIK  +E RP 
Sbjct:    1 MPNYKLIYFNTRGRAEPTRLCFAAGGIPYEDVRLTGEEWTKMKAENKTIMGYLPVLEVD-GIQYCESMAIFRLAAKLAGLCPTCPYEQARCDMVVDCSSDLFAKAMKFFFEKDQEQKKKLQEEFKEQHLNKFWDIMERLLTAKCNLDGSAQYFVGNKLTYADIILFSTSDTFESMFPGMLENFPGLRDLFKRVGEN-PGIKAWIEKRPN 207          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO38608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCI4])

HSP 1 Score: 99.7525 bits (247), Expect = 9.679e-26
Identity = 60/204 (29.41%), Postives = 112/204 (54.90%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTF-EQWGARKPSV--TYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKA-EMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLP-EAKPAFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            MP  KL YF+ RGR E  R    +   +++D+R    E+W   KP +   +GQ+P+L ++   +L++SMAI  ++AR+  L   + ++    D  +    DL  K ++   EKDEKKK  +++++L    +P +   + K++++    FL     + AD+ +  + D+ P E     PK++  +++++ + PGIK  +E RP+T
Sbjct:    1 MPSYKLHYFNARGRAEPARLAFAAAGIEYEDKRFEGREEWLRVKPELDPPFGQVPLLVIDDKIKLAQSMAILAYVAREGGLAPTNSLDIAMCDMIVGVEGDLNSKGMKWFMEKDEKKKVLKLREELDTTHIPAFLEAMSKFLEKNGTGFLVTDKLTYADILVFNVCDNAPAEVLKKCPKMKE-FHELIAAIPGIKAWLEKRPKT 203          
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Match: EDO47468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA1])

HSP 1 Score: 99.3673 bits (246), Expect = 1.469e-25
Identity = 60/209 (28.71%), Postives = 111/209 (53.11%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVT--YGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYI--DEGKGAFLAGANASLADLFLCVILDSLPEAK----PAFPKLENIYNKVMTSYPGIKKHVETRPQTPF 654
            MP  KL YFDGRGR E  R    +   +++D+R+ FE+W   K  +   +GQ+P+L ++   +L++S+AI  ++AR+  L   + ++    D  +    D   K  +  FEKDE KK E+ + L++  +P +   L + +  ++ K  FL     + AD+ +  + ++L          FP+++  ++ ++ +  GIK  +E RP+T F
Sbjct:    1 MPSYKLYYFDGRGRAEPARLAFAAAGIEYEDKRMQFEEWPKIKKEIDAPFGQVPLLVIDDKIKLAQSLAIMTYIAREGGLAPVNSLDIAMCDMIVGAEEDFVQKQYKWHFEKDEAKKTELGEALEKTHLPAFVEALTRILKKNDNKTGFLVTDKMTYADIVVFNVFNNLSSTDGFSLDKFPEIK-AHHDLVAANEGIKAWLEKRPKTSF 208          
BLAST of Glutathione S-transferase vs. Ensembl Medaka
Match: ENSORLT00000012133.2 (glutathione S-transferase alpha 4 [Source:NCBI gene;Acc:101174370])

HSP 1 Score: 59.3066 bits (142), Expect = 3.033e-10
Identity = 51/192 (26.56%), Postives = 92/192 (47.92%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDDERLT----FEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAE-MQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFL--CVILDSLPEAKPAFPKLENIYNKVMTSYPGIK 621
            L YF+GRG+ E IR++L     +FD+  LT    +E+      S+ + Q+P++ ++ G +L ++ AI  ++A K  L+GKD  E   ++   + + DL    +   F  D K K + +Q   KE+++P +   L          +L G   S AD+ L  C ++            LE  +  ++  +P +K
Sbjct:    7 LHYFNGRGKMESIRWLLTVVEAEFDEMYLTSRDQYEKL-LNDGSLMFQQVPLVEID-GMKLVQTKAILHYIAEKYNLHGKDIKERAMVNMYAEGLIDLMEMMMMLPFVADPKPKLDNIQSKAKERYLPVFEKAL------SGPVYLVGGKLSYADVLLLECTLM------------LEEKFTGILGDFPSVK 178          
BLAST of Glutathione S-transferase vs. Ensembl Medaka
Match: GSTM4 (glutathione S-transferase Mu 5 [Source:NCBI gene;Acc:101157858])

HSP 1 Score: 47.3654 bits (111), Expect = 3.270e-6
Identity = 48/190 (25.26%), Postives = 84/190 (44.21%), Query Frame = 1
Query:   67 LTYFDGRGRGELIRFILHSQNEKFDD------ERLTFEQWG----ARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDS----LPEAKPAFPKLENIYNK 594
            L Y+D RG     R +L     K+++      E   +++ G      K  + +  LP L ++   ++ +S AI R+LARK KL G+ E E  R+D   + + D  +  ++  +   E  K E  K L +  V + F + +     G   + AG   +  D  +  +LD     LP    AF  L++  ++
Sbjct:    5 LGYWDIRGLAHPTRLLLEYTGAKYEEKTYVCGEAPNYDKSGWFSVKFKLGLDFPNLPYL-VDGDKKIVQSNAIQRYLARKNKLCGETEEEKIRLDILENVVMDFRMSFIRMCYTDYENLKPEYLKTLPD--VLKQFSDFL-----GNRKWFAGDRLTFGDFIMYDVLDQQRIFLPTCLDAFKNLKDFLDR 186          
BLAST of Glutathione S-transferase vs. Planmine SMEST
Match: SMESG000016836.1 (SMESG000016836.1)

HSP 1 Score: 414.075 bits (1063), Expect = 7.259e-149
Identity = 200/201 (99.50%), Postives = 201/201 (100.00%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTPF 654
            MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQL+ESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTPF
Sbjct:    1 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLNESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTPF 201          
BLAST of Glutathione S-transferase vs. Planmine SMEST
Match: SMESG000016846.1 (SMESG000016846.1)

HSP 1 Score: 154.451 bits (389), Expect = 1.591e-46
Identity = 78/196 (39.80%), Postives = 118/196 (60.20%), Query Frame = 1
Query:   64 KLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAK-PAFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            K+TYF+ + + ELIR IL + N  F+D+R+ FE W   KPS+  GQLPV+ L CGT L+ES+AI+R+ A+K  L G  E+E Y+ DRA+ T++DL+ K V    EKD +K   ++ +L E  +  +   +  Y  E  G F  G+  S ADL L  I+D   E++   +PK+   Y +V+  +P +K++  TR  T
Sbjct:    6 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFTKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTEHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKVKEYKATRVAT 201          
BLAST of Glutathione S-transferase vs. Planmine SMEST
Match: SMESG000003087.1 (SMESG000003087.1)

HSP 1 Score: 122.479 bits (306), Expect = 4.152e-34
Identity = 74/202 (36.63%), Postives = 116/202 (57.43%), Query Frame = 1
Query:   52 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILD---SLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQT 648
            M   K+TYFD RGR ELIR +L +   +F+D R+T ++W   KP+   G+LPV+  E G QL++SMAI+R +ARK    G+D+ E Y ++RAI  + D+ L+ +  I+   E+KK E++ +            L  +I E    F AG   +LA+LF  V+ D    LP+    FPKL+ +  +++ +   +++ V TRP T
Sbjct:    1 MSTVKVTYFDARGRAELIRLVLKASKIEFEDVRITKDKWPEVKPTTPTGKLPVVEYE-GKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDV-LEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVT 198          
BLAST of Glutathione S-transferase vs. Planmine SMEST
Match: SMESG000032177.1 (SMESG000032177.1)

HSP 1 Score: 90.5077 bits (223), Expect = 5.690e-22
Identity = 64/209 (30.62%), Postives = 100/209 (47.85%), Query Frame = 1
Query:   64 KLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAID-------TINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAKPA------FPKLENIYNKVMTSYPGIKKHVET-RPQT 648
            +L Y+D RG  E++R +  + N KF+D+R T E+W   K +    +LP++    G  L+E  AI RF +    L G  + E Y I++ I+        +ND+  K +      D+  +  +   LK          L K  +  K  FL G  ASLAD++L V+LD   E + A      F KL  +  K++ ++P I   + T RP T
Sbjct:    6 RLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITL----DDHHEHALSSSLK---------TLNKVAEVNKNGFLVGKTASLADIYLLVLLD-FAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPIT 200          
The following BLAST results are available for this feature:
BLAST of Glutathione S-transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HPGDS1.395e-2531.55hematopoietic prostaglandin D synthase [Source:HGN... [more]
GSTP11.731e-1732.34glutathione S-transferase pi 1 [Source:HGNC Symbol... [more]
GSTA43.489e-1429.95glutathione S-transferase alpha 4 [Source:HGNC Sym... [more]
GSTA43.489e-1429.95glutathione S-transferase alpha 4 [Source:HGNC Sym... [more]
GSTP11.738e-1336.36glutathione S-transferase pi 1 [Source:HGNC Symbol... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gst-363.647e-2831.75Probable glutathione S-transferase gst-36 [Source... [more]
gst-192.134e-2734.45Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-204.022e-2730.29Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-54.010e-2633.17Probable glutathione S-transferase 5 [Source:UniP... [more]
gst-81.961e-2530.88Probable glutathione S-transferase 8 [Source:UniP... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GstS17.234e-2329.65gene:FBgn0010226 transcript:FBtr0087005[more]
GstS17.234e-2329.65gene:FBgn0010226 transcript:FBtr0100258[more]
GstS17.234e-2329.65gene:FBgn0010226 transcript:FBtr0087006[more]
GstS15.317e-2229.50gene:FBgn0010226 transcript:FBtr0333551[more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gstp12.316e-1830.61glutathione S-transferase pi 1 [Source:ZFIN;Acc:ZD... [more]
gstp29.381e-1731.12glutathione S-transferase pi 2 [Source:ZFIN;Acc:ZD... [more]
gsta.17.352e-1330.15glutathione S-transferase, alpha tandem duplicate ... [more]
gsta.17.352e-1330.15glutathione S-transferase, alpha tandem duplicate ... [more]
AL929536.38.283e-1328.64pep chromosome:GRCz11:13:835390:840787:1 gene:ENSD... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpgds2.751e-3033.66hematopoietic prostaglandin D synthase [Source:NCB... [more]
gnrhr2.166e-1331.73gonadotropin releasing hormone receptor [Source:Xe... [more]
gnrhr5.927e-1330.00gonadotropin releasing hormone receptor [Source:Xe... [more]
gnrhr2.053e-1229.50gonadotropin releasing hormone receptor [Source:Xe... [more]
ENSXETT00000044740.12.737e-1227.72glutathione S-transferase 3-like [Source:NCBI gene... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hpgds6.383e-2833.01hematopoietic prostaglandin D synthase [Source:MGI... [more]
Gstp12.793e-1833.33glutathione S-transferase, pi 1 [Source:MGI Symbol... [more]
Gstp12.793e-1833.33glutathione S-transferase, pi 1 [Source:MGI Symbol... [more]
Gstp25.691e-1732.34glutathione S-transferase, pi 2 [Source:MGI Symbol... [more]
Gstp25.691e-1732.34glutathione S-transferase, pi 2 [Source:MGI Symbol... [more]
back to top
BLAST of Glutathione S-transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P46428|GST_ANOGA6.573e-3134.31Glutathione S-transferase OS=Anopheles gambiae OX=... [more]
sp|P46436|GST1_ASCSU1.984e-2735.81Glutathione S-transferase 1 OS=Ascaris suum OX=625... [more]
sp|O35543|HPGDS_RAT2.629e-2732.52Hematopoietic prostaglandin D synthase OS=Rattus n... [more]
sp|Q9JHF7|HPGDS_MOUSE4.465e-2733.01Hematopoietic prostaglandin D synthase OS=Mus musc... [more]
sp|Q09607|GST36_CAEEL4.639e-2731.75Probable glutathione S-transferase gst-36 OS=Caeno... [more]
back to top
BLAST of Glutathione S-transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J7IB228.271e-4542.86Glutathione S-transferase sigma 3 OS=Mytilus gallo... [more]
A0A3S1BMW44.966e-4038.92Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
K1RA711.741e-3738.27Glutathione-requiring prostaglandin D synthase OS=... [more]
A0A194AP165.737e-3738.46Putative sigma class glutathione-s-transferase 2 O... [more]
A0A194APU98.359e-3738.46Putative sigma class glutathione-s-transferase 2 O... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GSTP19.721e-1728.17glutathione S-transferase pi 1 [Source:NCBI gene;A... [more]
GSTP11.102e-1630.10glutathione S-transferase pi 1 [Source:NCBI gene;A... [more]
gsta.11.187e-826.11glutathione S-transferase A4-like [Source:NCBI gen... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione S-transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione S-transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451594.082e-3333.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337671.765e-2834.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453274.894e-2832.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386089.679e-2629.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474681.469e-2528.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutathione S-transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000012133.23.033e-1026.56glutathione S-transferase alpha 4 [Source:NCBI gen... [more]
GSTM43.270e-625.26glutathione S-transferase Mu 5 [Source:NCBI gene;A... [more]
back to top
BLAST of Glutathione S-transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000016836.17.259e-14999.50SMESG000016836.1[more]
SMESG000016846.11.591e-4639.80SMESG000016846.1[more]
SMESG000003087.14.152e-3436.63SMESG000003087.1[more]
SMESG000032177.15.690e-2230.62SMESG000032177.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000428 ID=SMED30000428|Name=Glutathione S-transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=770bp
AAATTCCGATGAAATTTCATTTCAATTCATTCTGTCATTATCGACTCAAC
TATGCCCGTTAAGAAACTAACGTATTTCGATGGTAGAGGACGAGGTGAAC
TAATTAGGTTTATTTTACATTCACAAAACGAGAAATTCGATGATGAGAGA
TTGACATTTGAGCAATGGGGAGCTCGAAAACCTTCCGTAACATACGGCCA
ACTTCCGGTTCTTACATTAGAATGTGGAACTCAACTGAGTGAAAGTATGG
CTATTTCTCGATTTTTGGCAAGGAAAGCAAAACTCTATGGAAAAGATGAG
ATGGAAACCTATCGAATTGATCGGGCAATTGATACTATAAATGATTTGTA
TTTGAAAGCCGTTCAATCTATATTTGAAAAGGATGAAAAAAAGAAAGCAG
AAATGCAGAAAGATTTGAAAGAAAAGTTTGTTCCTCAATATTTTGGAAAT
CTTGTGAAATATATCGATGAGGGAAAAGGCGCATTTTTGGCCGGGGCAAA
TGCCAGTTTGGCCGATTTGTTTTTGTGTGTTATTCTCGACTCGCTTCCCG
AAGCTAAGCCTGCGTTTCCGAAACTGGAAAATATCTATAACAAAGTCATG
ACAAGTTATCCAGGAATTAAAAAGCATGTCGAAACGCGACCGCAGACTCC
ATTTTAAATCTGGTGCCTTAATTGATTGTAGTTTGTGCACAAAAGTACAA
TAGACGATTTTAATATGACTATTATCCATTGTGTTAGTTTTTAGTGGTTA
AAGTTTCAATAAATTTACAA
back to top

protein sequence of SMED30000428-orf-1

>SMED30000428-orf-1 ID=SMED30000428-orf-1|Name=SMED30000428-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQ
LPVLTLECGTQLSESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLY
LKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGAN
ASLADLFLCVILDSLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQTP
F*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000461lateral branch
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR040079Glutathione_S-Trfase
IPR036282Glutathione-S-Trfase_C_sf
IPR010987Glutathione-S-Trfase_C-like
IPR004045Glutathione_S-Trfase_N
IPR004046GST_C
IPR012336Thioredoxin-like_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 5..196
e-value: 1.4E-55
score: 190.4
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 4..75
IPR004046Glutathione S-transferase, C-terminalPFAMPF14497GST_C_3coord: 98..196
e-value: 1.1E-15
score: 57.6
IPR004045Glutathione S-transferase, N-terminalPFAMPF02798GST_Ncoord: 5..74
e-value: 2.4E-4
score: 21.4
IPR004045Glutathione S-transferase, N-terminalPROSITEPS50404GST_NTERcoord: 2..80
score: 20.792
NoneNo IPR availableGENE3DG3DSA:1.20.1050.10coord: 77..185
e-value: 1.4E-55
score: 190.4
NoneNo IPR availableSFLDSFLDG01205AMPS.1coord: 1..200
e-value: 0.0
score: 186.8
NoneNo IPR availablePANTHERPTHR11571GLUTATHIONE S-TRANSFERASEcoord: 1..197
NoneNo IPR availablePANTHERPTHR11571:SF206HEMATOPOIETIC PROSTAGLANDIN D SYNTHASEcoord: 1..197
NoneNo IPR availableCDDcd03192GST_C_Sigma_likecoord: 84..182
e-value: 4.50953E-17
score: 71.1146
NoneNo IPR availableCDDcd03039GST_N_Sigma_likecoord: 5..74
e-value: 2.86144E-22
score: 83.7524
IPR040079Glutathione Transferase familySFLDSFLDS00019Glutathione_Transferase_(cytocoord: 1..200
e-value: 0.0
score: 186.8
IPR010987Glutathione S-transferase, C-terminal-likePROSITEPS50405GST_CTERcoord: 82..201
score: 14.51
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 78..201