TPR_REGION domain-containing protein

Overview
NameTPR_REGION domain-containing protein
Smed IDSMED30000421
Length (bp)4485
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TPR_REGION domain-containing protein (SMED30000421) t-SNE clustered cells

Violin plots show distribution of expression levels for TPR_REGION domain-containing protein (SMED30000421) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TPR_REGION domain-containing protein (SMED30000421) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TPR_REGION domain-containing protein (SMED30000421) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000421

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000421SMESG000071973.1 SmedASXL_017565SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000421SMESG000071973.1 dd_Smed_v4_11462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000421SMESG000071973.1 dd_Smed_v4_11462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000421SMESG000071973.1 dd_Smed_v4_11462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000421SMESG000071973.1 dd_Smed_v4_11462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000421SMESG000071973.1 dd_Smed_v6_11462_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000421SMESG000071973.1 dd_Smed_v4_11462_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TPR_REGION domain-containing protein vs. Ensembl Human
Match: TTC6 (tetratricopeptide repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:19739])

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 391/1014 (38.56%), Postives = 607/1014 (59.86%), Query Frame = 2
Query: 1364 DLPENIE--PVL---DEVDEEFRGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGD-FEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQ-SPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            D PE ++  P L   D V+ +    + +    EVK +++++ +  +  AF   RRGA+YRK+G L +A  D+   I +EP  + AYW RHL++L  +KI  A++DLN I K +KN   AY S+A IY    DI+LAI N +QAI+ +P D++ Y +R E+YE   +  LA++D+++ I   P    A++K GL+Y   E W  A +DF+++L     N++A  +RG AY K + +++A  DFSA IHLDPNN+LA + RGCL RK+ P+ A++D+S+S L+    EN+  +++RGI+YA  K +  AI DFE VI   + +  A+VN+GLI+    D + +++   +  +  DP  I++Y CRAE YF+++K + A+ +++RAIHL PD    Y+ RG + L M   ++A   + Q AE+   L + SP+QQAL++SF +++D+AI+ L   +  +  + +  LL   QMKAKR K+A+      L+ +   ++       +A+  + +  CY+E  N + +  +F+  VK NP+ AE++Y +G C+++L K    ILD NRA+ +NP+ YQAYL+R   +G K +Y+KAILNCN+ + I P  +RAYLYRGVLKY  K Y LAI D T AI +D N   AF+NRA+C+  + +  + A+ DY IVLL+     +    ++NRGL+Y+ELG    AL DF +A  I   +  + +   +CHH++   +EA+  FT  L  +P F+ A V RGN +M+Y    +   A KD+   L I+  ++ A ++ G+  QAQGKF+KAW+ FT+AI+  P +    +GRA+VC+QM +   A++D+N A++I   +  L  NRGV+++ M  K  AMKDY  AI +   K  +AYFNAG +Y H+ Q  QA + F K ++ DP +E   +N A+      K EE+ E     I   P  A +YFNRA+  + L++Y+ AE D    L + P+D  V   R   R K G    A+ DY  ++
Sbjct:  869 DPPERVKEPPKLKLNDYVESDLPQEVIKYYESEVKILTEEINDKTKYPAFAYCRRGAIYRKLGKLQSAMNDLQRVILLEPLFLNAYWHRHLIYLFQDKINEALDDLNYIHKYNKNNTEAYLSKAEIYRGKKDITLAILNYTQAIKSTPTDADIYFRRGEMYEITNKV-LAIDDFSKCIFYDPKRTDALLKRGLFYCENENWFAAIEDFTALLNIDHQNSQARTYRGIAYVKWKFYKEATQDFSAAIHLDPNNWLALYYRGCLFRKSNPFRALQDYSVSALINDGYENLGCFLHRGIVYAHLKLWLLAICDFETVISLERTITLAYVNIGLIHLLHLDNYTEAIWQFSEAIRIDPLCIQSYLCRAETYFKLHKLKKAVNELSRAIHLQPDGIQLYIRRGQYLLMMKYYDLAKFTIYQIAEMDKGLSELSPMQQALIYSFCENHDKAIEVLDGISWNRAEMTMCALLAKVQMKAKRTKEAVEVLKKALDAISHSDKGPDATAISADCLYNLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYT-KIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFL-TNRGVIHEFMGHKQNAMKDYQDAITLNP-KYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQAL 1877          

HSP 2 Score: 124.02 bits (310), Expect = 1.340e-27
Identity = 202/892 (22.65%), Postives = 348/892 (39.01%), Query Frame = 2
Query: 1508 RRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYN--QIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSV------------------LRHYPSNTEA-----------------WLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSI-XXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVV--ICFNK---DMC--FAHV---------------------------------------NLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVA-TRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVAR--CYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLF---GFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKA---YSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPK--FILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSML 3898
            RRG +Y ++   V A  D +  I  +P    A  +R L +        AIED   +L  D     A   R   Y        A  + S AI L P++  A   R  L+ ++   R AL+DY+   +I     N    +  G+ Y +++ W LA  DF +V                  L H  + TEA                 +L R   Y KL + + A+ + S  IHL P+    Y +RG  L   + Y  +  F+I  +       + +S M + ++Y+  +   +AI   EV+  I +N+    MC   A V                                       NLGL Y E+G+ + +    T  + A+P +  ++  R     +++K + +I D NRAI L P     Y+ R  FY   G+   A +   +A +I     ++ + + ++  + + Y  AI  L  A +  K S            K +  + A+T +   L  L      K        LN  + R   Y+EL  Y  +   F     I+  +    +    C  R+ + ++ +     AL INP    AY+ R   +   G      +A  +  + L I P  ++A +  G   Y ++A   +  A   FT AI  D    LA+  RAV       N+  A+QD +  + IS           NRG+++  +G  QNA+ D+  A  + P      +  G  +   +   +A   F++ L  DP+  ++L   +  N  +        + A +D+ +V+E   +      N         +++ A +    A+   PN     + RA V  ++  +  A+ D N+A+ ++  +S++
Sbjct: 1024 RRGEMY-EITNKVLAIDDFSKCIFYDPKRTDALLKRGLFYCENENWFAAIEDFTALLNIDHQNSQARTYRGIAYVKWKFYKEATQDFSAAIHLDPNNWLALYYRGCLFRKSNPFR-ALQDYSVSALINDGYENLGCFLHRGIVYAHLKLWLLAICDFETVISLERTITLAYVNIGLIHLLHLDNYTEAIWQFSEAIRIDPLCIQSYLCRAETYFKLHKLKKAVNELSRAIHLQPDGIQLYIRRGQYLLMMK-YYDLAKFTIYQIAEMDKGLSELSPMQQALIYSFCENHDKAI---EVLDGISWNRAEMTMCALLAKVQMKAKRTKEAVEVLKKALDAISHSDKGPDATAISADCLYNLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVL-LLDATETVK--------LNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFG---YNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNF-AAMQDINAAMKISTTAEF----LTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTIL-----KKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDLEDYASVI 1886          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Human
Match: TTC6 (tetratricopeptide repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:19739])

HSP 1 Score: 416.387 bits (1069), Expect = 1.744e-129
Identity = 226/587 (38.50%), Postives = 345/587 (58.77%), Query Frame = 2
Query: 2624 SPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            SP+QQAL++SF +++D+AI+ L   +  +  + +  LL   QMKAKR K+A+      L+ +   ++       +A+  + +  CY+E  N + +  +F+  VK NP+ AE++Y +G C+++L K    ILD NRA+ +NP+ YQAYL+R   +G K +Y+KAILNCN+ + I P  +RAYLYRGVLKY  K Y LAI D T AI +D N   AF+NRA+C+  + +  + A+ DY IVLL+     +    ++NRGL+Y+ELG    AL DF +A  I   +  + +   +CHH++   +EA+  FT  L  +P F+ A V RGN +M+Y    +   A KD+   L I+  ++ A ++ G+  QAQGKF+KAW+ FT+AI+  P +    +GRA+VC+QM +   A++D+N A++I   +  L  NRGV+++ M  K  AMKDY  AI +   K  +AYFNAG +Y H+ Q  QA + F K ++ DP +E   +N A+      K EE+ E     I   P  A +YFNRA+  + L++Y+ AE D    L + P+D  V   R   R K G    A+ DY  ++
Sbjct:    9 SPMQQALIYSFCENHDKAIEVLDGISWNRAEMTMCALLAKVQMKAKRTKEAVEVLKKALDAISHSDKGPDATAISADCLYNLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYT-KIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFL-TNRGVIHEFMGHKQNAMKDYQDAITLNP-KYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQAL 591          

HSP 2 Score: 115.546 bits (288), Expect = 1.406e-25
Identity = 130/516 (25.19%), Postives = 216/516 (41.86%), Query Frame = 2
Query: 1514 GALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNT---EAWLHRGTAYAKLQQWQDALTDF-SAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRG---ILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKP--SVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRAL 3034
            G  Y + G L  A      A+   PD   ++++R L  +  +K   +I D N  +  +  +  AY SR   Y   G  S AI N ++AI++ P+   AY  R  L   N   +LA+ D    I +  N+  A     L Y  I + Q+A  D+  VL    + T     +L+RG  Y +L Q+  AL DF  A +    N  L +    C  R  E   A+  F+ +L +     +  +Y+ RG   + Y   +   +A  DF   +  N     A ++ G     +G F+K+  + T  +  DP    AY  RA    QM     A++DIN A+ +    + F   RG  +  MG  + A    + A  ++     +      ++   + + QA D    A +  P     L+N    T    K++++A   F   +E            P  A + F  A  Y  LK Y+ ++   +  + + PN A  Y  +   R ++G +++ + D N+AL
Sbjct:   91 GLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLD--AYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKI-STTAEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMN-RAITNTILKKYEEAKEDFANVIESC----------PFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQAL 591          

HSP 3 Score: 100.523 bits (249), Expect = 7.532e-21
Identity = 98/406 (24.14%), Postives = 176/406 (43.35%), Query Frame = 2
Query: 1511 RGAL-YRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVL---AYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNI---EQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMA------AICVRQAAEISHNL-GQSPVQQALVHSFLQHYDQAID 2683
            RG L Y    Y +A + D+  AIS++ +   A++ R L +    ++QMA+ D  ++L  D    +    + +R  IY   G    A+ +  QA  +S  +       A  + +  E   A+  +   +++ P    A +  G  Y+     E  + A KDF   L   P+  +A +  G       ++Q A   F+  I  DP NYLAY  R  + L+    + A++D + ++ + ++ E + +   RG+++        A+ D++  I  N     A+ N G IYF    F ++  Y +  L  DP        RA     + KYE+A +D    I   P  +  Y  R  FY  + + E+A      A+ ++    + +N   +   +  L+   +  Y+QA+D
Sbjct:  191 RGVLKYYNKTYKLAIT-DLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFLTN---RGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALD 592          

HSP 4 Score: 98.2117 bits (243), Expect = 4.089e-20
Identity = 119/574 (20.73%), Postives = 233/574 (40.59%), Query Frame = 2
Query: 1568 DAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFE---VVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYE---DAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMA------AICVRQAAEISHNLGQSPVQQALVHSF--LQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKID 3247
            DA +I  D +   +   L ++    +QMA +     +K + ++  ++  R G+         +I + ++AI L+P   +AY  R   Y   G    A+ + N+ I++ P +  A +  G+     + ++LA  D ++ +    ++  A+ +R   Y K+++ Q ALTD+  V+ LD    +                                 + +++ RG++Y    Q+  A+ DF+   ++   N  +C A     + +    +FE++V + T  L  +P ++ AY  R  +Y +    E    A KD  +A+H+ P      +  G    A GK + A      AI       +++  G++ V   + ++F  +Q  + A+     A        +   +G  Q   K ++DAIT        L PK     +  G           Y   + + ++   FS  +K +P +     ++      L K ++   D    +   P     Y  RA  +    QY  A  + N+ LS++P     Y +R  ++ KI     A+ D+ +A+ ++
Sbjct:   78 DATAISADCL---YNLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQR-GLCKVKLHKDSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETV--------------------------------KLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHA---TAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYE-GRAVVCLQMGNNFAAMQDINAAMKISTTAEFLTNRGVIHEFMGHKQNAMKDYQDAIT--------LNPKYSLAYFNAG---------NIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDLE 594          

HSP 5 Score: 95.5153 bits (236), Expect = 2.704e-19
Identity = 121/535 (22.62%), Postives = 221/535 (41.31%), Query Frame = 2
Query: 2327 NLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVA-TRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVAR--CYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLF---GFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKA---YSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPK--FILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSML 3898
            NLGL Y E+G+ + +    T  + A+P +  ++  R     +++K + +I D NRAI L P     Y+ R  FY   G+   A +   +A +I     ++ + + ++  + + Y  AI  L  A +  K S            K +  + A+T +   L  L      K        LN  + R   Y+EL  Y  +   F     I+  +    +    C  R+ + ++ +     AL INP    AY+ R   +   G      +A  +  + L I P  ++A +  G   Y ++A   +  A   FT AI  D    LA+  RAV       N+  A+QD +  + IS           NRG+++  +G  QNA+ D+  A  + P      +  G  +   +   +A   F++ L  DP+  ++L   +  N  +        + A +D+ +V+E   +      N         +++ A +    A+   PN     + RA V  ++  +  A+ D N+A+ ++  +S++
Sbjct:   89 NLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVL-LLDATETVK--------LNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFG---YNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFA-AMQDINAAMKISTTAEF----LTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTIL-----KKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDLEDYASVI 600          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Human
Match: TTC6 (tetratricopeptide repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:19739])

HSP 1 Score: 371.318 bits (952), Expect = 1.429e-113
Identity = 196/500 (39.20%), Postives = 302/500 (60.40%), Query Frame = 2
Query: 2555 MGKMEMAAICVRQAAEISHNLGQ-SPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQ 4051
            M   ++A   + Q AE+   L + SP+QQAL++SF +++D+AI+ L   +  +  + +  LL   QMKAKR K+A+      L+ +   ++       +A+  + +  CY+E  N + +  +F+  VK NP+ AE++Y +G C+++L K    ILD NRA+ +NP+ YQAYL+R   +G K +Y+KAILNCN+ + I P  +RAYLYRGVLKY  K Y LAI D T AI +D N   AF+NRA+C+  + +  + A+ DY IVLL+     +    ++NRGL+Y+ELG    AL DF +A  I   +  + +   +CHH++   +EA+  FT  L  +P F+ A V RGN +M+Y    +   A KD+   L I+  ++ A ++ G+  QAQGKF+KAW+ FT+AI+  P +    +GRA+VC+QM +   A++D+N A++I   +  L  NRGV+++ M  K  AMKDY  AI +   K  +AYFNAG +Y H+ Q  Q
Sbjct:    2 MKYYDLAKFTIYQIAEMDKGLSELSPMQQALIYSFCENHDKAIEVLDGISWNRAEMTMCALLAKVQMKAKRTKEAVEVLKKALDAISHSDKGPDATAISADCLYNLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYT-KIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFL-TNRGVIHEFMGHKQNAMKDYQDAITLNP-KYSLAYFNAGNIYFHHRQFSQ 497          

HSP 2 Score: 98.5969 bits (244), Expect = 2.297e-20
Identity = 99/361 (27.42%), Postives = 155/361 (42.94%), Query Frame = 2
Query: 1514 GALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNT---EAWLHRGTAYAKLQQWQDALTDF-SAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRG---ILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMA 2575
            G  Y + G L  A      A+   PD   ++++R L  +  +K   +I D N  +  +  +  AY SR   Y   G  S AI N ++AI++ P+   AY  R  L   N   +LA+ D    I +  N+  A     L Y  I + Q+A  D+  VL    + T     +L+RG  Y +L Q+  AL DF  A +    N  L +    C  R  E   A+  F+ +L +     +  +Y+ RG   + Y   +   +A  DF   +  N     A ++ G     +G F+K+  + T  +  DP    AY  RA    QM     A++DIN A+ +    + F   RG  +  MG  + A
Sbjct:  108 GLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLD--AYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKI-STTAEFLTNRGVIHEFMGHKQNA 464          

HSP 3 Score: 80.8777 bits (198), Expect = 1.001e-14
Identity = 96/389 (24.68%), Postives = 162/389 (41.65%), Query Frame = 2
Query: 2327 NLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVA-TRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVAR--CYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATL---FGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKA---YSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQP 3466
            NLGL Y E+G+ + +    T  + A+P +  ++  R     +++K + +I D NRAI L P     Y+ R  FY   G+   A +   +A +I     ++ + + ++  + + Y  AI  L  A +  K S            K +  + A+T +   L  L      K        LN  + R   Y+EL  Y  +   F     I+  +    +    C  R+ + ++ +     AL INP    AY+ R      +G      +A  +  + L I P  ++A +  G   Y ++A   +  A   FT AI  D    LA+  RAV       N+  A+QD +  + IS           NRG+++  +G  QNA+ D+  A  + P
Sbjct:  106 NLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQRGLCKVKLHK-DSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVL-LLDATETVK--------LNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFG---YNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFA-AMQDINAAMKISTTAEF----LTNRGVIHEFMGHKQNAMKDYQDAITLNP 476          

HSP 4 Score: 78.9518 bits (193), Expect = 3.669e-14
Identity = 70/326 (21.47%), Postives = 137/326 (42.02%), Query Frame = 2
Query: 1568 DAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVV---------ICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYE---DAIKDINRAIHLFP 2509
            DA +I  D +   +   L ++    +QMA +     +K + ++  ++  R G+         +I + ++AI L+P   +AY  R   Y   G    A+ + N+ I++ P +  A +  G+     + ++LA  D ++ +    ++  A+ +R   Y K+++ Q ALTD+  V+ LD    +                                 + +++ RG++Y    Q+  A+ DF+           +C    MC   +N         +FE++V + T  L  +P ++ AY  R  +Y +    E    A KD  +A+H+ P
Sbjct:   95 DATAISADCL---YNLGLCYMEEGNLQMAFDSFTKAVKANPDFAESFYQR-GLCKVKLHKDSSILDFNRAITLNPKHYQAYLSRVAFYGLKGRYSKAILNCNKAIKIYPESVRAYLYRGVLKYYNKTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETV--------------------------------KLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRIN---------EFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINP 375          

HSP 5 Score: 77.411 bits (189), Expect = 1.101e-13
Identity = 72/294 (24.49%), Postives = 130/294 (44.22%), Query Frame = 2
Query: 1511 RGAL-YRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVL---AYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNI---EQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEK 2368
            RG L Y    Y +A + D+  AIS++ +   A++ R L +    ++QMA+ D  ++L  D    +    + +R  IY   G    A+ +  QA  +S  +       A  + +  E   A+  +   +++ P    A +  G  Y+     E  + A KDF   L   P+  +A +  G       ++Q A   F+  I  DP NYLAY  R  + L+    + A++D + ++ + ++ E + +   RG+++        A+ D++  I  N     A+ N G IYF    F +
Sbjct:  208 RGVLKYYNKTYKLAIT-DLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFLTN---RGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQ 497          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Human
Match: TTC6 (tetratricopeptide repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:19739])

HSP 1 Score: 266.159 bits (679), Expect = 1.132e-76
Identity = 154/423 (36.41%), Postives = 233/423 (55.08%), Query Frame = 2
Query: 3128 EVLSIEPRCLR----AYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +  +I   CL      Y+  G L+     Y LAI D T AI +D N   AF+NRA+C+  + +  + A+ DY IVLL+     +    ++NRGL+Y+ELG    AL DF +A  I   +  + +   +CHH++   +EA+  FT  L  +P F+ A V RGN +M+Y    +   A KD+   L I+  ++ A ++ G+  QAQGKF+KAW+ FT+AI+  P +    +GRA+VC+QM +   A++D+N A++I   +  L  NRGV+++ M  K  AMKDY  AI +   K  +AYFNAG +Y H+ Q  QA + F K ++ DP +E   +N A+      K EE+ E     I   P  A +YFNRA+  + L++Y+ AE D    L + P+D  V   R   R K G    A+ DY  ++
Sbjct:   95 DATAISADCLYNLGLCYMEEGNLQ---MTYKLAITDLTTAISMDKNSYTAFYNRALCYT-KIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFL-TNRGVIHEFMGHKQNAMKDYQDAITLNP-KYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQAL 511          

HSP 2 Score: 127.487 bits (319), Expect = 8.745e-30
Identity = 138/586 (23.55%), Postives = 236/586 (40.27%), Query Frame = 2
Query: 2555 MGKMEMAAICVRQAAEISHNLGQ-SPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKN----YKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGD---VQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRI 4288
            M   ++A   + Q AE+   L + SP+QQAL++SF +++D+AI+ L   +  +  + +  LL   QMKAKR K+A+      L+ +   ++       +A+  + +  CY+E  N    YK +    +  + ++ N   A+Y++  C  ++ +++  + D    L                          +L+  E +      L  +L RG++  ++  Y  A++DF +A  I           A+C +     +E+A+  ++  L I+        AY+ RG  Y+E G     + A  DF++A  I P  +      G         ++A   FT  +D DPK  LA   R  V                                    C Q    F    DI   A  K   +   L  R ++   M     A+KD  +AI + P+ S+ Y N G +Y   R    A   ++KA+     +      N         + E+A E F   +ES P   A + N A  Y    + E + E +N+++SL PN A +Y  RA V   +   +EA  D+   L +
Sbjct:    2 MKYYDLAKFTIYQIAEMDKGLSELSPMQQALIYSFCENHDKAIEVLDGISWNRAEMTMCALLAKVQMKAKRTKEAVEVLKKALDAISHSDKGPDATAISADCLYNLGLCYMEEGNLQMTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVL--------------------------LLDATETVK-----LNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHH-RINEFEEAVNFFTWALKINPCF---LDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVV------------------------------------CLQMGNNFAAMQDI--NAAMKISTTAEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDP-ENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL 513          

HSP 3 Score: 99.7525 bits (247), Expect = 8.802e-21
Identity = 95/399 (23.81%), Postives = 174/399 (43.61%), Query Frame = 2
Query: 1529 KMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVL---AYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNI---EQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMA------AICVRQAAEISHNL-GQSPVQQALVHSFLQHYDQAID 2683
            +M Y +A + D+  AIS++ +   A++ R L +    ++QMA+ D  ++L  D    +    + +R  IY   G    A+ +  QA  +S  +       A  + +  E   A+  +   +++ P    A +  G  Y+     E  + A KDF   L   P+  +A +  G       ++Q A   F+  I  DP NYLAY  R  + L+    + A++D + ++ + ++ E + +   RG+++        A+ D++  I  N     A+ N G IYF    F ++  Y +  L  DP        RA     + KYE+A +D    I   P  +  Y  R  FY  + + E+A      A+ ++    + +N   +   +  L+   +  Y+QA+D
Sbjct:  118 QMTYKLAIT-DLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFLTN---RGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALD 512          

HSP 4 Score: 80.4925 bits (197), Expect = 9.988e-15
Identity = 101/435 (23.22%), Postives = 177/435 (40.69%), Query Frame = 2
Query: 1751 LAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAM---MKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTA--YAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPS--VALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRAL 3034
            LAI++L+ AI +  +   A+  RA  Y +  E ++AL DY  ++ L     + +   +  GL Y+ + Q+  A +DF        S T   L   TA  + ++ ++++A+  F+  + ++P    AY  RG                             SYM  G   AT     +A  DF   +  N     A ++ G     +G F+K+  + T  +  DP    AY  RA    QM     A++DIN A+ +    + F   RG  +  MG  + A    + A  ++     +      ++   + + QA D    A +  P     L+N    T    K++++A   F   +E            P  A + F  A  Y  LK Y+ ++   +  + + PN A  Y  +   R ++G +++ + D N+AL
Sbjct:  123 LAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAA--LISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRG----------------------------NSYMEYGHDEAT----KQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKI-STTAEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNR-AITNTILKKYEEAKEDFANVIESC----------PFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQAL 511          

HSP 5 Score: 58.151 bits (139), Expect = 1.162e-7
Identity = 59/239 (24.69%), Postives = 94/239 (39.33%), Query Frame = 2
Query: 1511 RGALYRKMGYLVA---ASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIH----------------------------------LDPNNYLAY 2116
            RG  Y + G+  A   A KD   A+ I P  I A            K Q A     + +  D    LAY+ RA +    G+   A+ +++ A+++S   +E  + R  ++E  G  + A++DY   I L P   LA    G  Y +  Q+  A+  FS  L+  P N    ++R      L+++++A  DF+ VI                                   L PN+ L Y
Sbjct:  250 RGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTT-AEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVY 487          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Human
Match: TTC6 (tetratricopeptide repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:19739])

HSP 1 Score: 266.159 bits (679), Expect = 1.132e-76
Identity = 154/423 (36.41%), Postives = 233/423 (55.08%), Query Frame = 2
Query: 3128 EVLSIEPRCLR----AYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +  +I   CL      Y+  G L+     Y LAI D T AI +D N   AF+NRA+C+  + +  + A+ DY IVLL+     +    ++NRGL+Y+ELG    AL DF +A  I   +  + +   +CHH++   +EA+  FT  L  +P F+ A V RGN +M+Y    +   A KD+   L I+  ++ A ++ G+  QAQGKF+KAW+ FT+AI+  P +    +GRA+VC+QM +   A++D+N A++I   +  L  NRGV+++ M  K  AMKDY  AI +   K  +AYFNAG +Y H+ Q  QA + F K ++ DP +E   +N A+      K EE+ E     I   P  A +YFNRA+  + L++Y+ AE D    L + P+D  V   R   R K G    A+ DY  ++
Sbjct:   95 DATAISADCLYNLGLCYMEEGNLQ---MTYKLAITDLTTAISMDKNSYTAFYNRALCYT-KIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFL-TNRGVIHEFMGHKQNAMKDYQDAITLNP-KYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQAL 511          

HSP 2 Score: 127.487 bits (319), Expect = 8.745e-30
Identity = 138/586 (23.55%), Postives = 236/586 (40.27%), Query Frame = 2
Query: 2555 MGKMEMAAICVRQAAEISHNLGQ-SPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKN----YKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGD---VQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRI 4288
            M   ++A   + Q AE+   L + SP+QQAL++SF +++D+AI+ L   +  +  + +  LL   QMKAKR K+A+      L+ +   ++       +A+  + +  CY+E  N    YK +    +  + ++ N   A+Y++  C  ++ +++  + D    L                          +L+  E +      L  +L RG++  ++  Y  A++DF +A  I           A+C +     +E+A+  ++  L I+        AY+ RG  Y+E G     + A  DF++A  I P  +      G         ++A   FT  +D DPK  LA   R  V                                    C Q    F    DI   A  K   +   L  R ++   M     A+KD  +AI + P+ S+ Y N G +Y   R    A   ++KA+     +      N         + E+A E F   +ES P   A + N A  Y    + E + E +N+++SL PN A +Y  RA V   +   +EA  D+   L +
Sbjct:    2 MKYYDLAKFTIYQIAEMDKGLSELSPMQQALIYSFCENHDKAIEVLDGISWNRAEMTMCALLAKVQMKAKRTKEAVEVLKKALDAISHSDKGPDATAISADCLYNLGLCYMEEGNLQMTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVL--------------------------LLDATETVK-----LNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHH-RINEFEEAVNFFTWALKINPCF---LDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVV------------------------------------CLQMGNNFAAMQDI--NAAMKISTTAEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDP-ENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL 513          

HSP 3 Score: 99.7525 bits (247), Expect = 8.802e-21
Identity = 95/399 (23.81%), Postives = 174/399 (43.61%), Query Frame = 2
Query: 1529 KMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVL---AYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNI---EQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMA------AICVRQAAEISHNL-GQSPVQQALVHSFLQHYDQAID 2683
            +M Y +A + D+  AIS++ +   A++ R L +    ++QMA+ D  ++L  D    +    + +R  IY   G    A+ +  QA  +S  +       A  + +  E   A+  +   +++ P    A +  G  Y+     E  + A KDF   L   P+  +A +  G       ++Q A   F+  I  DP NYLAY  R  + L+    + A++D + ++ + ++ E + +   RG+++        A+ D++  I  N     A+ N G IYF    F ++  Y +  L  DP        RA     + KYE+A +D    I   P  +  Y  R  FY  + + E+A      A+ ++    + +N   +   +  L+   +  Y+QA+D
Sbjct:  118 QMTYKLAIT-DLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFLTN---RGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALD 512          

HSP 4 Score: 80.4925 bits (197), Expect = 9.988e-15
Identity = 101/435 (23.22%), Postives = 177/435 (40.69%), Query Frame = 2
Query: 1751 LAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAM---MKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTA--YAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPS--VALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRAL 3034
            LAI++L+ AI +  +   A+  RA  Y +  E ++AL DY  ++ L     + +   +  GL Y+ + Q+  A +DF        S T   L   TA  + ++ ++++A+  F+  + ++P    AY  RG                             SYM  G   AT     +A  DF   +  N     A ++ G     +G F+K+  + T  +  DP    AY  RA    QM     A++DIN A+ +    + F   RG  +  MG  + A    + A  ++     +      ++   + + QA D    A +  P     L+N    T    K++++A   F   +E            P  A + F  A  Y  LK Y+ ++   +  + + PN A  Y  +   R ++G +++ + D N+AL
Sbjct:  123 LAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAA--LISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRG----------------------------NSYMEYGHDEAT----KQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKI-STTAEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNR-AITNTILKKYEEAKEDFANVIESC----------PFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQAL 511          

HSP 5 Score: 58.151 bits (139), Expect = 1.162e-7
Identity = 59/239 (24.69%), Postives = 94/239 (39.33%), Query Frame = 2
Query: 1511 RGALYRKMGYLVA---ASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIH----------------------------------LDPNNYLAY 2116
            RG  Y + G+  A   A KD   A+ I P  I A            K Q A     + +  D    LAY+ RA +    G+   A+ +++ A+++S   +E  + R  ++E  G  + A++DY   I L P   LA    G  Y +  Q+  A+  FS  L+  P N    ++R      L+++++A  DF+ VI                                   L PN+ L Y
Sbjct:  250 RGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTT-AEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVY 487          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 84.3445 bits (207), Expect = 6.281e-16
Identity = 99/415 (23.86%), Postives = 170/415 (40.96%), Query Frame = 2
Query: 2882 LELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA 4120
             + KN +KS       +K+N   AEAY + G      G+++  + +   A+ + P    AY+  A          +A+      L I P   C+R+ L  G L   +     A   + +AI+      +A+ N    FN++ + +  AI  +   + +         AYIN G V  E      A+  ++RA  +  N   V   +   +++   +  AI  + + +D  P F  A  +  N   +  S      A + Y   LE+   H D+  NL   ++ QGK + A  ++  A+E +P         A +  Q   LN A+    EAIRI P  +  Y N G   + M D   A+  YN+AI I       A+ N   ++     + +A++ +   ++  P     + NLA
Sbjct:  170 FQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDL--GNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVE---AEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFAD-AHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLA 574          

HSP 2 Score: 74.7146 bits (182), Expect = 5.087e-13
Identity = 98/430 (22.79%), Postives = 178/430 (41.40%), Query Frame = 2
Query: 3101 YTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            Y +A   CN V   +P  L   L    + ++ K    +++    AIK++  C  A+ N    +  EK   + A+++Y + + +         AYIN     +  GD++ A+  +  A  I P+   V   +G     +  L+EA   + + ++  P+F +A  + G VF   NS     LA   +   + +D   LDA +NL       G   K   IF  A+  +              ++  +L+G     N A+ +    + +Y  +G++        +A+  Y KAI +     P AY N          + +A + + K +E  P       NLA +   Q K+E++     +++ + P  A  + N A++L    +  +A L +   +RIAP         G+   + GDS  A+  Y  ++ I
Sbjct:  141 YVEAEKYCNLVFQSDPNNLPTLLLLSAINFQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYK-EKGQLQDALENYKLAVKLKPEF---IDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVF---NSQGEIWLAIHHFEKAVTLDPNFLDAYINL-------GNVLKEARIFDRAVSAY--------------LRALNLSG-----NHAV-VHGNLACVYYEQGLID-------LAIDTYKKAIDLQP-HFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQI 528          

HSP 3 Score: 60.8474 bits (146), Expect = 8.255e-9
Identity = 77/364 (21.15%), Postives = 148/364 (40.66%), Query Frame = 2
Query: 1637 NKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNI-MSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHV----NLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKP 2713
             ++Q A+E+  L +K    ++ AY + A    S GD+  A++    A++++PD     S    L +  G    A   Y + I  QP   +A    G  + +  +  LA   F   +   P+  +A+++ G    + + +  A++ +   ++L  N+ + +    C+  +      + D +I    ++ +        Y  +  A  ++ S  +V+ E +     ++C  H     NL  I  E+G  E + +     L   P +  A+   A    Q  K  DAI     AI + P  ++ Y   G+    MG    A  C  +A +I+     +    A +H    +  +AI +   A + KP
Sbjct:  207 GQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQ----GLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGS--VVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKP 564          

HSP 4 Score: 60.8474 bits (146), Expect = 9.531e-9
Identity = 92/455 (20.22%), Postives = 188/455 (41.32%), Query Frame = 2
Query: 1667 NLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI------SH-NLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCR 2983
            NL+ + D N +      + I   T ++  ++     AI+++   +EAYS     Y++ G+ + ALE+Y   ++L+P    A       Y+N+    ++  D    +  Y +    N + +  R   G     + + ++A   +   I   P   +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +   +A+ L P  ++      +     GK+E A     +A EI      +H NL     QQ  ++  + HY +AI       R  P+ A   + +G T  +      AI  +   ++            P  A+ +  +A  + +  N  ++  ++S  +K+ P+  +AY +   C 
Sbjct:  149 NLVFQSDPNNLPTLLLLSAINFQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDA-------YINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAI-------RIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQ----------INPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCH 577          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 84.3445 bits (207), Expect = 6.281e-16
Identity = 99/415 (23.86%), Postives = 170/415 (40.96%), Query Frame = 2
Query: 2882 LELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA 4120
             + KN +KS       +K+N   AEAY + G      G+++  + +   A+ + P    AY+  A          +A+      L I P   C+R+ L  G L   +     A   + +AI+      +A+ N    FN++ + +  AI  +   + +         AYIN G V  E      A+  ++RA  +  N   V   +   +++   +  AI  + + +D  P F  A  +  N   +  S      A + Y   LE+   H D+  NL   ++ QGK + A  ++  A+E +P         A +  Q   LN A+    EAIRI P  +  Y N G   + M D   A+  YN+AI I       A+ N   ++     + +A++ +   ++  P     + NLA
Sbjct:  170 FQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDL--GNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVE---AEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFAD-AHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLA 574          

HSP 2 Score: 74.7146 bits (182), Expect = 5.087e-13
Identity = 98/430 (22.79%), Postives = 178/430 (41.40%), Query Frame = 2
Query: 3101 YTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            Y +A   CN V   +P  L   L    + ++ K    +++    AIK++  C  A+ N    +  EK   + A+++Y + + +         AYIN     +  GD++ A+  +  A  I P+   V   +G     +  L+EA   + + ++  P+F +A  + G VF   NS     LA   +   + +D   LDA +NL       G   K   IF  A+  +              ++  +L+G     N A+ +    + +Y  +G++        +A+  Y KAI +     P AY N          + +A + + K +E  P       NLA +   Q K+E++     +++ + P  A  + N A++L    +  +A L +   +RIAP         G+   + GDS  A+  Y  ++ I
Sbjct:  141 YVEAEKYCNLVFQSDPNNLPTLLLLSAINFQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYK-EKGQLQDALENYKLAVKLKPEF---IDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVF---NSQGEIWLAIHHFEKAVTLDPNFLDAYINL-------GNVLKEARIFDRAVSAY--------------LRALNLSG-----NHAV-VHGNLACVYYEQGLID-------LAIDTYKKAIDLQP-HFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQI 528          

HSP 3 Score: 60.8474 bits (146), Expect = 8.255e-9
Identity = 77/364 (21.15%), Postives = 148/364 (40.66%), Query Frame = 2
Query: 1637 NKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNI-MSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHV----NLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKP 2713
             ++Q A+E+  L +K    ++ AY + A    S GD+  A++    A++++PD     S    L +  G    A   Y + I  QP   +A    G  + +  +  LA   F   +   P+  +A+++ G    + + +  A++ +   ++L  N+ + +    C+  +      + D +I    ++ +        Y  +  A  ++ S  +V+ E +     ++C  H     NL  I  E+G  E + +     L   P +  A+   A    Q  K  DAI     AI + P  ++ Y   G+    MG    A  C  +A +I+     +    A +H    +  +AI +   A + KP
Sbjct:  207 GQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQ----GLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGS--VVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKP 564          

HSP 4 Score: 60.8474 bits (146), Expect = 9.531e-9
Identity = 92/455 (20.22%), Postives = 188/455 (41.32%), Query Frame = 2
Query: 1667 NLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI------SH-NLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCR 2983
            NL+ + D N +      + I   T ++  ++     AI+++   +EAYS     Y++ G+ + ALE+Y   ++L+P    A       Y+N+    ++  D    +  Y +    N + +  R   G     + + ++A   +   I   P   +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +   +A+ L P  ++      +     GK+E A     +A EI      +H NL     QQ  ++  + HY +AI       R  P+ A   + +G T  +      AI  +   ++            P  A+ +  +A  + +  N  ++  ++S  +K+ P+  +AY +   C 
Sbjct:  149 NLVFQSDPNNLPTLLLLSAINFQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDA-------YINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAI-------RIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQ----------INPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCH 577          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Celegans
Match: ogt-1 (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:O18158])

HSP 1 Score: 82.0333 bits (201), Expect = 2.990e-15
Identity = 104/434 (23.96%), Postives = 172/434 (39.63%), Query Frame = 2
Query: 2846 AANLNFLVARCYLELKNY--KKSQLA-----FSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPN--DLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA 4120
            A  +N   A  Y  L NY  +K QL      +   VK+ P   +AY +     +  G ++Q +     AL INP LY        L     +  +A +   + +  +P+   A+   G +        LAI  F +A+ +D N + A+ N       E + +++A+  Y   L +S     H   + N   VY E G +  A+  + +A  +QP+  D Y             NL  A++                  +G+V            A + Y   LE+   H D+  NL   ++ QGK + A  ++  A+E +P         A +  Q   LN A+    EAIRI P  +  Y N G   + M D   A+  YN+AI I       A+ N   ++     + +A++ +   ++  P     + NLA
Sbjct:    7 AIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLK-EARIFDRAVSAYLRALNLSGN---HAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYC------------NLANALK-----------------EKGSVVE----------AEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFAD-AHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLA 396          

HSP 2 Score: 73.1738 bits (178), Expect = 1.323e-12
Identity = 89/386 (23.06%), Postives = 161/386 (41.71%), Query Frame = 2
Query: 3233 AIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            AIK++  C  A+ N    +  EK   + A+++Y + + +         AYIN     +  GD++ A+  +  A  I P+   V   +G     +  L+EA   + + ++  P+F +A  + G VF   NS     LA   +   + +D   LDA +NL       G   K   IF  A+  +              ++  +L+G     N A+ +    + +Y  +G++        +A+  Y KAI +     P AY N          + +A + + K +E  P       NLA +   Q K+E++     +++ + P  A  + N A++L    +  +A L +   +RIAP         G+   + GDS  A+  Y  ++ I
Sbjct:    7 AIKVNNQCAEAYSNLGNYYK-EKGQLQDALENYKLAVKLKPEF---IDAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVF---NSQGEIWLAIHHFEKAVTLDPNFLDAYINL-------GNVLKEARIFDRAVSAY--------------LRALNLSG-----NHAV-VHGNLACVYYEQGLID-------LAIDTYKKAIDLQP-HFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQI 350          

HSP 3 Score: 61.2326 bits (147), Expect = 5.733e-9
Identity = 97/398 (24.37%), Postives = 154/398 (38.69%), Query Frame = 2
Query: 2285 VVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLR---GDFYLAMGKMEMAAICVRQAAEIS-------HNLG-----QSPVQQALVH---------SFLQHY-------------DQAIDALLVATR--GKPSVALLNLL------GTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVL 3343
            + I  N     A+ NLG  Y EKG  + +++     +   P +I AY   A A       E A+     A+ + PD    Y +R   G+   AMG++E A +C  +A E          NLG     Q  +  A+ H         +FL  Y             D+A+ A L A    G  +V   NL       G   +    +K AI         L+P      +P    NL    A    E  +  +++  +   +++ P HA++  +    +   GK++       +AL I P    A+   A++   + +   AIL+  E + I P    AY   G    ++   S AI  +  AI+I+     A  N A   + +  N  +AIQ YS  L
Sbjct:    6 LAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDLEQAVTAYFNALQINPD---LYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAI--------DLQPH-----FPDAYCNL----ANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLA-SIHKDAGNMAEAIQSYSTAL 382          

HSP 4 Score: 58.9214 bits (141), Expect = 3.396e-8
Identity = 86/419 (20.53%), Postives = 174/419 (41.53%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI------SH-NLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCR 2983
            AI+++   +EAYS     Y++ G+ + ALE+Y   ++L+P    A       Y+N+    ++  D    +  Y +    N + +  R   G     + + ++A   +   I   P   +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +   +A+ L P  ++      +     GK+E A     +A EI      +H NL     QQ  ++  + HY +AI       R  P+ A   + +G T  +      AI  +   ++            P  A+ +  +A  + +  N  ++  ++S  +K+ P+  +AY +   C 
Sbjct:    7 AIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDA-------YINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVSAYLRALNLSGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPTHADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAI-------RIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQ----------INPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAYCNLAHCH 399          

HSP 5 Score: 51.2174 bits (121), Expect = 6.470e-6
Identity = 83/400 (20.75%), Postives = 153/400 (38.25%), Query Frame = 2
Query: 2006 EAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYR---GILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDF---YLAMGKMEMAAICVRQAAEISH-------NLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAY 3166
            EA+ + G  Y +  Q QDAL ++   + L P    AY      L          + +++    + + N   Y  R   G L     +  EA V +   I        A  NLG ++  +G+   ++ +    +  DP ++ AY        +   ++ A+    RA++L     N  ++ G+    Y   G +++A    ++A ++         NL  +  ++  V    Q Y +A++  L  T         N L   + +  + +DA   +   LE       Y  +    +NL    A    +      + L +   ++I P  A+AY + G     +G     I   NRA+ INP    A+   A++        +AI + +  L ++P    AY
Sbjct:   16 EAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFIDAYINLAAALVSGGDL----EQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKAIETQPQFAVAWSNLGCVFNSQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVSAYLRALNL---SGNHAVVHGNLACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALE--LCPTHADSQ----NNLANIKREQGKIEDATRLYLKALEI------YPEFAAAHSNL----ASILQQQGKLNDAILHYKEAIRIAPTFADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSYSTALKLKPDFPDAY 392          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Celegans
Match: F38B6.6 (Protein O-mannosyl-transferase TMTC1 [Source:UniProtKB/Swiss-Prot;Acc:Q20144])

HSP 1 Score: 53.9138 bits (128), Expect = 1.028e-6
Identity = 49/207 (23.67%), Postives = 86/207 (41.55%), Query Frame = 2
Query: 3641 AAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAE 4261
            A K+Y + +++D  +  AL NLG   +  G  K A  +   A+   P+         I  M +     A K L  ++ I+P S+    N GV+YQ      MAM  +  A  I       ++ N   V  H  Q  Q ++   + + S P +    + +   +   +    +  +I  +I L+P S   + N   +   + R++EAE
Sbjct:  451 AEKNYWNAIKLDPSYEQALNNLGNLLEKSGDSKTAESLLARAVTLRPSFAVAWMNLGISQMNLKKYYEAEKSLKNSLLIRPNSAHCLFNLGVLYQRTNRDEMAMSAWKNATRIDPSHSQ-SWTNLFVVLDHLSQCSQVIDLSYQALSSVPNESRVHMQIGSCHAKHSNFTAAENHIKSAIDLNPTSVLFHANLGILYQRMSRHKEAE 656          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Fly
Match: sxc (gene:FBgn0261403 transcript:FBtr0086085)

HSP 1 Score: 93.9745 bits (232), Expect = 8.011e-19
Identity = 112/470 (23.83%), Postives = 194/470 (41.28%), Query Frame = 2
Query: 2861 FLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
             L++  + + +   KS    +  +K NP  AEAY + G      G++++ + +  RA+ + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+      +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA  + PN+  V   +   +++   +  AI  + R ++  P F  A  +  N   +         A   YN+ L + S H D+L NL   ++ QG  ++A  ++  A+E  P+        A V  Q   L  AL    EAIRIQP  +  Y N G   + ++D   A++ Y +AI I       A+ N   ++  +  + +A++ +R  ++  P     + NLA                  LV I   +LE+     NR  S+ P+ + LY
Sbjct:   88 LLLSSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKE---AEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDIRMKKLVSIVTEQLEK-----NRLPSVHPHHSMLY 542          

HSP 2 Score: 67.0106 bits (162), Expect = 1.435e-10
Identity = 77/341 (22.58%), Postives = 143/341 (41.94%), Query Frame = 2
Query: 3374 KAYINRGLVYLELGDVQNALHDFIRAQAIQPN--DLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +AY N G V+ E G +Q AL ++ RA  ++P+  D Y+     +     ++++ A++ +   L ++P     +   GN+     +    + A   Y   +E       A  NLG    AQG+   A   F  A+   PN          V  +    + A+     A+ + P +++++ N   VY       +A+  Y +AI +     P AY N         Q+++A +C+   +           NLA +   Q  +EE+     +++ + P+ A  + N A+VL    + +EA + +   +RI P         G+   +  D  GAL+ Y  ++ I
Sbjct:  119 EAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALV--AARDMESAVQAYITALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP-NFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQI 453          

HSP 3 Score: 61.6178 bits (148), Expect = 5.752e-9
Identity = 67/299 (22.41%), Postives = 125/299 (41.81%), Query Frame = 2
Query: 3479 VLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLN----------EAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTG 4345
            VL ++   H + + L ++ +  T  +  +P    A  + GNVF +         A  +Y   + +    +D  +NL     A    + A   +  A++ +P+         + C++ SDL   LK L           +AI   P  ++ + N G V+    +  +A+  + KA+ +       AY N G V       ++A+  + + +   P +     NLA VY  Q  ++ +I+   R+I L PN    Y N AN L +  + +EAE  + + LR+  +    L    + + + G
Sbjct:   86 VLLLLSSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQE---ALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPD---------LYCVR-SDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDP-NFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQG 370          

HSP 4 Score: 58.5362 bits (140), Expect = 5.651e-8
Identity = 84/461 (18.22%), Postives = 172/461 (37.31%), Query Frame = 2
Query: 1622 LHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI------SH-NLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            +H  C ++  + +   L +K++     AY +   ++   G +  A+ N  +A+RL PD  + Y   A       +   A++ Y   ++  P+        G     + + + A   +   +   P    AW + G  +    +   A+  F   + LDPN   AY   G +L++A                                   + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +  + ++A    N A+ L  + ++      +     G +E A     +A E+      +H NL     QQ  +   L HY +AI       R +P+ A   + +G T  + +    A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   93 IHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEA-----------------------------------RIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAI-------RIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDAYCNLAHC 501          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Fly
Match: sxc (gene:FBgn0261403 transcript:FBtr0086084)

HSP 1 Score: 93.9745 bits (232), Expect = 8.011e-19
Identity = 112/470 (23.83%), Postives = 194/470 (41.28%), Query Frame = 2
Query: 2861 FLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
             L++  + + +   KS    +  +K NP  AEAY + G      G++++ + +  RA+ + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+      +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA  + PN+  V   +   +++   +  AI  + R ++  P F  A  +  N   +         A   YN+ L + S H D+L NL   ++ QG  ++A  ++  A+E  P+        A V  Q   L  AL    EAIRIQP  +  Y N G   + ++D   A++ Y +AI I       A+ N   ++  +  + +A++ +R  ++  P     + NLA                  LV I   +LE+     NR  S+ P+ + LY
Sbjct:   88 LLLSSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKE---AEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDIRMKKLVSIVTEQLEK-----NRLPSVHPHHSMLY 542          

HSP 2 Score: 67.0106 bits (162), Expect = 1.435e-10
Identity = 77/341 (22.58%), Postives = 143/341 (41.94%), Query Frame = 2
Query: 3374 KAYINRGLVYLELGDVQNALHDFIRAQAIQPN--DLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +AY N G V+ E G +Q AL ++ RA  ++P+  D Y+     +     ++++ A++ +   L ++P     +   GN+     +    + A   Y   +E       A  NLG    AQG+   A   F  A+   PN          V  +    + A+     A+ + P +++++ N   VY       +A+  Y +AI +     P AY N         Q+++A +C+   +           NLA +   Q  +EE+     +++ + P+ A  + N A+VL    + +EA + +   +RI P         G+   +  D  GAL+ Y  ++ I
Sbjct:  119 EAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALV--AARDMESAVQAYITALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP-NFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQI 453          

HSP 3 Score: 61.6178 bits (148), Expect = 5.752e-9
Identity = 67/299 (22.41%), Postives = 125/299 (41.81%), Query Frame = 2
Query: 3479 VLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLN----------EAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTG 4345
            VL ++   H + + L ++ +  T  +  +P    A  + GNVF +         A  +Y   + +    +D  +NL     A    + A   +  A++ +P+         + C++ SDL   LK L           +AI   P  ++ + N G V+    +  +A+  + KA+ +       AY N G V       ++A+  + + +   P +     NLA VY  Q  ++ +I+   R+I L PN    Y N AN L +  + +EAE  + + LR+  +    L    + + + G
Sbjct:   86 VLLLLSSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQE---ALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPD---------LYCVR-SDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDP-NFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQG 370          

HSP 4 Score: 58.5362 bits (140), Expect = 5.651e-8
Identity = 84/461 (18.22%), Postives = 172/461 (37.31%), Query Frame = 2
Query: 1622 LHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI------SH-NLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            +H  C ++  + +   L +K++     AY +   ++   G +  A+ N  +A+RL PD  + Y   A       +   A++ Y   ++  P+        G     + + + A   +   +   P    AW + G  +    +   A+  F   + LDPN   AY   G +L++A                                   + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +  + ++A    N A+ L  + ++      +     G +E A     +A E+      +H NL     QQ  +   L HY +AI       R +P+ A   + +G T  + +    A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   93 IHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEA-----------------------------------RIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAI-------RIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDAYCNLAHC 501          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Fly
Match: sxc (gene:FBgn0261403 transcript:FBtr0086086)

HSP 1 Score: 93.9745 bits (232), Expect = 8.011e-19
Identity = 112/470 (23.83%), Postives = 194/470 (41.28%), Query Frame = 2
Query: 2861 FLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
             L++  + + +   KS    +  +K NP  AEAY + G      G++++ + +  RA+ + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+      +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA  + PN+  V   +   +++   +  AI  + R ++  P F  A  +  N   +         A   YN+ L + S H D+L NL   ++ QG  ++A  ++  A+E  P+        A V  Q   L  AL    EAIRIQP  +  Y N G   + ++D   A++ Y +AI I       A+ N   ++  +  + +A++ +R  ++  P     + NLA                  LV I   +LE+     NR  S+ P+ + LY
Sbjct:   88 LLLSSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKE---AEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDIRMKKLVSIVTEQLEK-----NRLPSVHPHHSMLY 542          

HSP 2 Score: 67.0106 bits (162), Expect = 1.435e-10
Identity = 77/341 (22.58%), Postives = 143/341 (41.94%), Query Frame = 2
Query: 3374 KAYINRGLVYLELGDVQNALHDFIRAQAIQPN--DLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +AY N G V+ E G +Q AL ++ RA  ++P+  D Y+     +     ++++ A++ +   L ++P     +   GN+     +    + A   Y   +E       A  NLG    AQG+   A   F  A+   PN          V  +    + A+     A+ + P +++++ N   VY       +A+  Y +AI +     P AY N         Q+++A +C+   +           NLA +   Q  +EE+     +++ + P+ A  + N A+VL    + +EA + +   +RI P         G+   +  D  GAL+ Y  ++ I
Sbjct:  119 EAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALV--AARDMESAVQAYITALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP-NFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQI 453          

HSP 3 Score: 61.6178 bits (148), Expect = 5.752e-9
Identity = 67/299 (22.41%), Postives = 125/299 (41.81%), Query Frame = 2
Query: 3479 VLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLN----------EAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTG 4345
            VL ++   H + + L ++ +  T  +  +P    A  + GNVF +         A  +Y   + +    +D  +NL     A    + A   +  A++ +P+         + C++ SDL   LK L           +AI   P  ++ + N G V+    +  +A+  + KA+ +       AY N G V       ++A+  + + +   P +     NLA VY  Q  ++ +I+   R+I L PN    Y N AN L +  + +EAE  + + LR+  +    L    + + + G
Sbjct:   86 VLLLLSSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQE---ALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPD---------LYCVR-SDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDP-NFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQG 370          

HSP 4 Score: 58.5362 bits (140), Expect = 5.651e-8
Identity = 84/461 (18.22%), Postives = 172/461 (37.31%), Query Frame = 2
Query: 1622 LHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI------SH-NLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            +H  C ++  + +   L +K++     AY +   ++   G +  A+ N  +A+RL PD  + Y   A       +   A++ Y   ++  P+        G     + + + A   +   +   P    AW + G  +    +   A+  F   + LDPN   AY   G +L++A                                   + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +  + ++A    N A+ L  + ++      +     G +E A     +A E+      +H NL     QQ  +   L HY +AI       R +P+ A   + +G T  + +    A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   93 IHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEA-----------------------------------RIFDRAVAAYLRALNLSPNNAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAI-------RIQPTFADAYSNMGNTLKELQDVSGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIQSYRTALKLKPDFPDAYCNLAHC 501          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Fly
Match: CG5038 (gene:FBgn0038324 transcript:FBtr0083089)

HSP 1 Score: 66.6254 bits (161), Expect = 1.513e-10
Identity = 52/221 (23.53%), Postives = 98/221 (44.34%), Query Frame = 2
Query: 3728 GKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            G   KA+  +  AIE +PN E  L     +  +   L+ A + +  A++  P     ++N G+V         A+  Y KA+        + Y+N G +Y+   +  +AL  ++  V  +P     W N+  +   +   ++++   N+++   PN   + F RANVL  L+ Y EAE  +   + + P +       G    +   +  A+E Y+T++ I
Sbjct:  458 GNNTKAFQHYHRAIELYPNYESALMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRA-NFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDALRISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGVLYHRWDKTQEAIEAYRTAISI 677          

HSP 2 Score: 51.2174 bits (121), Expect = 7.657e-6
Identity = 36/147 (24.49%), Postives = 70/147 (47.62%), Query Frame = 2
Query: 3863 EAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDP 4303
             A+++ P ++ ++ N   +   M +   A + Y++AI +       A  N G +Y  + QL  A E  R  +++ P   A W+NL +V   Q K ++++    +++    N A  Y+N  N+  + +RY EA   +   + + P  P
Sbjct:  435 SALQVCPDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYP-NYESALMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALKYRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQP 580          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Fly
Match: P58IPK (gene:FBgn0037718 transcript:FBtr0082074)

HSP 1 Score: 59.6918 bits (143), Expect = 1.753e-8
Identity = 34/108 (31.48%), Postives = 54/108 (50.00%), Query Frame = 2
Query: 1787 SPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYL 2110
            SP D E + +  + +   G+   AL  Y+  +    NN L + K G  YL + + + A +DFS VL   P    A + RG  + K  +++ A+ DF  V+  +PNN L
Sbjct:   39 SPADIENHLELGKEFLARGQLSDALTHYHAAVEGDANNYLTLFKRGTVYLALGKTRFAVQDFSRVLELKPDFMAARIQRGVVHMKSGEYEQAIQDFDQVLQEEPNNGL 146          

HSP 2 Score: 56.9954 bits (136), Expect = 9.478e-8
Identity = 49/219 (22.37%), Postives = 86/219 (39.27%), Query Frame = 2
Query: 1994 PSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPT-------YIRAYPCR-----AEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHN 2614
            P++ E  L  G  +    Q  DALT + A +  D NNYL  FKRG +      YLA+                                  A+ DF  V+    D   A +  G+++ + G++E++++     L  +P        Y R  P +      +   Q + +++AI  I + + + P    F   R D Y+A+    +A   +RQ   ++ +
Sbjct:   40 PADIENHLELGKEFLARGQLSDALTHYHAAVEGDANNYLTLFKRGTV------YLALGKTRF-----------------------------AVQDFSRVLELKPDFMAARIQRGVVHMKSGEYEQAIQDFDQVLQEEPNNGLVLEHYSRLAPAQEQWVLVQQLIQYSDHQNAIPMITQLLEISPWAVPFRQARSDAYIAINDPLLAIADLRQVNRLTQD 223          

HSP 3 Score: 56.9954 bits (136), Expect = 1.126e-7
Identity = 52/227 (22.91%), Postives = 94/227 (41.41%), Query Frame = 2
Query: 1370 PENIEPVLDEVDEEF--RGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAY----------------------------------------------KSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCL 1906
            P +IE  L E+ +EF  RG L + L      +  D  NY       L +RG +Y  +G    A +D +  + ++PD + A  +R ++H+   + + AI+D + +L+++ N  L                                                ++R+  Y +  D  LAI++L Q  RL+ D +E + K A+L    G    AL++  + ++  P + L
Sbjct:   40 PADIENHL-ELGKEFLARGQLSDALTHYHAAVEGDANNY-----LTLFKRGTVYLALGKTRFAVQDFSRVLELKPDFMAARIQRGVVHMKSGEYEQAIQDFDQVLQEEPNNGLVLEHYSRLAPAQEQWVLVQQLIQYSDHQNAIPMITQLLEISPWAVPFRQARSDAYIAINDPLLAIADLRQVNRLTQDSTEGHYKIAQLLYTIGHATNALKEIRECLKFDPEHKL 260          

HSP 4 Score: 52.373 bits (124), Expect = 2.927e-6
Identity = 28/110 (25.45%), Postives = 55/110 (50.00%), Query Frame = 2
Query: 1628 LVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL 1957
            L   ++  A+   +  ++ D N  L    R  +Y + G    A+ + S+ + L PD   A  +R  ++ ++GE   A++D++Q+++ +PNN L +  +       EQW L
Sbjct:   54 LARGQLSDALTHYHAAVEGDANNYLTLFKRGTVYLALGKTRFAVQDFSRVLELKPDFMAARIQRGVVHMKSGEYEQAIQDFDQVLQEEPNNGLVLEHYSRLAPAQEQWVL 163          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ttc6 (tetratricopeptide repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-090429-2])

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 433/1138 (38.05%), Postives = 669/1138 (58.79%), Query Frame = 2
Query: 1004 LGQPPNKLDKTKSFENIRIELKRIRSCXXXXXXXXXXXXXXXXADIHNFEDWSKNRGYKKESNA-RDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFE-KSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCY----LELKNYKKSQL-----AFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            L +PP  L ++KS   +  E K  +           +    SL  + +FE +  + G   ++   R+W+  IWD WFDE++PP+ +    + S  P     +   L+++         + LD+ E ++  L   D E           EV  +++ +      NAF   RRGALY K+GYL  A +D++ AIS+EP L+ AYW RH ++L+ N    A++DLN+I+  +K +  A+ SRA IY   G+ +LA+ + +QAI++ PDD+E Y KRA++Y++ GE  LA+EDY +   + P    AMM HG+++ N  +W ++ +DFS +L+  P N  A  +RG  Y+KL  ++ ++ D S  +HL+P ++LA++ RGCLLR+  P+LA+RDFS S+L+  S EN  ++++RG++Y T + + +AI DFE VI  ++    AHVNLG+I   K D   ++++   + L ADPTY++AY CRA A++ +N    A+KD+ RAIHL PD  + Y++RG F+  M   ++AA+C++ AAE+   LG S VQQA++ SFL +   AI  L  A   +PS   L LLG T MK  R+ +A+ +F   L  L             A + +L+  CY    L  +    S L     AF++TV +NP+HAEA++ +G CR+ L +   G+ D NRAL INP+ YQ +L+RA L+G + ++ KAIL+CNE + I+P+ LRA+LY+G LK+ +KAY  A++D T A++ID  C  A++NR +CF  E ++YE A++DYS+ LL+     L  K  INRGL+Y+EL D  +AL D   A   +P D+ + + +GV HH+L  L+EA+  ++     DP      V RGNVFMDY  + +R  A +D+ S L ++   L A ++L +  Q  G F++AW+ FT+A+E +P       GRA   +QM +   AL+D+N AI   P +  L+ NRG++ QL  DK  AMKDY  AI +      +AYFNA  ++ +N Q EQA E + +  E DP DE+  +N A+ +    K+ ES++  N ++ L+P SA+ YFNRAN+   L+++Q AE D    L + P D  + K R D R   G    A+EDY+T++
Sbjct:  360 LREPPRTLTRSKSLCQLPWEHKTSKG----------RFSHLSLPVLLDFESFVTDHGGIPDTTPPREWVRNIWDTWFDEVFPPLEN----IQSSDPLPAALEENQLSQD--------EDKLDMCEVVDEGLSTADLE----------HEVAKLTQALTEGGNRNAFDRCRRGALYIKLGYLEQALEDLSAAISLEPHLLDAYWHRHSIYLLRNDPVRALDDLNVIVTNNKKHADAFMSRAEIYKQRGETTLALFSYTQAIKVKPDDAEIYFKRAKMYDKMGEILLAMEDYAKTFTIDPTRTDAMMLHGMHHFNSSKWTVSLEDFSLLLKQEPDNAIARTYRGRIYSKLGHFEKSVEDLSLAVHLNPADWLAFYHRGCLLREIMPHLALRDFSTSVLINDSAENWRAFLHRGMVYVTLQHWQQAIADFEAVIKLDRSAAVAHVNLGMICMLKMDRHYEAIRRFNNALKADPTYVKAYVCRARAFYNVNNLSKAVKDLTRAIHLKPDAYDLYIMRGKFFYEMKCFDLAALCIQYAAEMKTALGLSAVQQAVIQSFLGNDANAIVCLEQAVDTQPSPPHLILLGRTLMKEHRFTEAVETFKKALSFLGSTKAKLSPAKETAEVFYLIGVCYVTQRLLFQESGDSLLLQALDAFNSTVSLNPDHAEAHHQRGLCRIHL-QDSTGVQDFNRALKINPKFYQVHLSRAALYGAEGRHAKAILDCNEAIRIQPKSLRAHLYKGALKFYLKAYKSAVEDLTMAVQIDPACSFAYYNRGICFQ-ELQHYEMALRDYSVTLLLGCKTELELKVLINRGLLYVELNDYSSALQDLKAAAQKRPADVLIYHALGVIHHRLGQLQEAVDAYSEAARLDPFLQDCLVGRGNVFMDYGHNQARKKAQRDFLSALHLNPLCLSARISLAYNLQVLGFFQRAWNQFTVAVEVNPKCWAAYQGRAATSLQMGNKFAALQDINTAIEYNPFTEQLFTNRGLIQQLRGDKSSAMKDYQTAISLNPAYA-LAYFNAANLFFYNGQFEQACEYYSRAFELDPSDESAILNRAITHALLRKVPESLQDFNEALCLNPLSAHAYFNRANLHCSLRQFQSAERDLTQALVLEPGDALLYKLRADVRGCLGWMEEAMEDYRTAL 1462          

HSP 2 Score: 55.8398 bits (133), Expect = 5.271e-7
Identity = 75/341 (21.99%), Postives = 127/341 (37.24%), Query Frame = 2
Query: 1613 RHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAEL---YEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNI-----EQWQ------------------------------LAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLL------RKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHL 2503
            R LL++  N    A++DL    +K    VL Y +   I+   G +  A+   S+A RL P   +    R  +   Y  N   + A  D+   + L P  CL+      Y L +       W                                A +D ++ + + P   + + +RG           A+ D+   I L+P   LAYF    L        +A  Y + R F +    ES+  N      R I +A  ++  E++ DF   +C N     A+ N   ++     F+ + + +T  L  +P     Y  RA+    +   E+A++D   A+ L
Sbjct: 1132 RGLLYVELNDYSSALQDLKAAAQKRPADVLIYHALGVIHHRLGQLQEAVDAYSEAARLDPFLQDCLVGRGNVFMDYGHNQARKKAQRDFLSALHLNPL-CLSARISLAYNLQVLGFFQRAWNQFTVAVEVNPKCWAAYQGRAATSLQMGNKFAALQDINTAIEYNPFTEQLFTNRGLIQQLRGDKSSAMKDYQTAISLNPAYALAYFNAANLFFYNGQFEQACEYYS-RAFELDPSDESAILN------RAITHALLRKVPESLQDFNEALCLNPLSAHAYFNRANLHCSLRQFQSAERDLTQALVLEPGDALLYKLRADVRGCLGWMEEAMEDYRTALKL 1464          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 98.5969 bits (244), Expect = 3.886e-20
Identity = 122/536 (22.76%), Postives = 218/536 (40.67%), Query Frame = 2
Query: 2669 DQAIDALLVATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            D A     VA   +P+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  + +    A + YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++LE+     NR  S+ P+ + LY
Sbjct:   57 DMASSVGNVADSTEPTKRVLSFQGLAELAHREYQSGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSE---AEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEK-----NRLPSVHPHHSMLY 570          

HSP 2 Score: 88.5817 bits (218), Expect = 4.396e-17
Identity = 98/425 (23.06%), Postives = 173/425 (40.71%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +   +   A + YN A+ +    CP    +  N   +      +E+A++ +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:  100 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRL----CPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 513          

HSP 3 Score: 77.0258 bits (188), Expect = 1.659e-13
Identity = 90/418 (21.53%), Postives = 176/418 (42.11%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +  N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:  138 AIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 529          

HSP 4 Score: 59.3066 bits (142), Expect = 4.380e-8
Identity = 94/492 (19.11%), Postives = 191/492 (38.82%), Query Frame = 2
Query: 1733 STGDISLAISNLSQAIRLSPDDSEAYSKR-------AELYE---QNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYR---GILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAY 3166
            S GD++ ++ N++        DS   +KR       AEL     Q+G+   A     Q+ R +P+N   ++     +    +   +A   +  ++  P   EA+ + G  Y +  Q Q+A+  +   + L P+    Y      L  A       + ++   + + + N   Y  R   G L     +  EA   +   I    +   A  NLG ++  +G+   ++ +    +  DP ++ AY        +   ++ A+    RA+ L P+ +  +      Y   G +++A    R+A E+  +   +    A       +  +A +    A R  P+ A  LN L   + +    ++A+  +   LE            P  A  +  +A    +    +++ + +   ++I+P  A+AY + G     +  ++  +    RA+ INP    A+   A++        +AI +    L ++P    AY
Sbjct:   54 SEGDMASSVGNVA--------DSTEPTKRVLSFQGLAELAHREYQSGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAA----GDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVF----------PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 523          

HSP 5 Score: 53.9138 bits (128), Expect = 1.648e-6
Identity = 80/377 (21.22%), Postives = 140/377 (37.14%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            +PN A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A E YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++      ++D                   +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K +          NR   + P  S  Y L   F  A+ +
Sbjct:  244 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSL--NNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE------MQDV------------------QGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAE 582          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 98.2117 bits (243), Expect = 4.523e-20
Identity = 120/528 (22.73%), Postives = 216/528 (40.91%), Query Frame = 2
Query: 2693 VATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            VA   +P+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  + +    A + YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++LE+     NR  S+ P+ + LY
Sbjct:    8 VADSTEPTKRVLSFQGLAELAHREYQSGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSE---AEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEK-----NRLPSVHPHHSMLY 513          

HSP 2 Score: 88.1965 bits (217), Expect = 5.278e-17
Identity = 98/425 (23.06%), Postives = 173/425 (40.71%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +   +   A + YN A+ +    CP    +  N   +      +E+A++ +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   43 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRL----CPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 456          

HSP 3 Score: 77.0258 bits (188), Expect = 1.663e-13
Identity = 91/418 (21.77%), Postives = 178/418 (42.58%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI------SH-NLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +  N A+ L P  ++      +     G +E A    R+A E+      +H NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   81 AIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 472          

HSP 4 Score: 56.225 bits (134), Expect = 3.670e-7
Identity = 83/448 (18.53%), Postives = 173/448 (38.62%), Query Frame = 2
Query: 1835 QNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYR---GILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAY 3166
            Q+G+   A     Q+ R +P+N   ++     +    +   +A   +  ++  P   EA+ + G  Y +  Q Q+A+  +   + L P+    Y      L  A       + ++   + + + N   Y  R   G L     +  EA   +   I    +   A  NLG ++  +G+   ++ +    +  DP ++ AY        +   ++ A+    RA+ L P+ +  +      Y   G +++A    R+A E+  +   +    A       +  +A +    A R  P+ A  LN L   + +    ++A+  +   LE            P  A  +  +A    +    +++ + +   ++I+P  A+AY + G     +  ++  +    RA+ INP    A+   A++        +AI +    L ++P    AY
Sbjct:   33 QSGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAA----GDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVF----------PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 466          

HSP 5 Score: 53.9138 bits (128), Expect = 1.726e-6
Identity = 80/377 (21.22%), Postives = 140/377 (37.14%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            +PN A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A E YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++      ++D                   +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K +          NR   + P  S  Y L   F  A+ +
Sbjct:  187 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSL--NNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE------MQDV------------------QGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAE 525          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 98.2117 bits (243), Expect = 5.600e-20
Identity = 122/536 (22.76%), Postives = 218/536 (40.67%), Query Frame = 2
Query: 2669 DQAIDALLVATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            D A     VA   +P+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  + +    A + YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++LE+     NR  S+ P+ + LY
Sbjct:   57 DMASSVGNVADSTEPTKRVLSFQGLAELAHREYQSGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSE---AEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEK-----NRLPSVHPHHSMLY 570          

HSP 2 Score: 88.1965 bits (217), Expect = 6.540e-17
Identity = 98/425 (23.06%), Postives = 173/425 (40.71%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +   +   A + YN A+ +    CP    +  N   +      +E+A++ +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:  100 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRL----CPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 513          

HSP 3 Score: 76.6406 bits (187), Expect = 2.062e-13
Identity = 90/418 (21.53%), Postives = 176/418 (42.11%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +  N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:  138 AIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 529          

HSP 4 Score: 58.5362 bits (140), Expect = 6.711e-8
Identity = 94/492 (19.11%), Postives = 191/492 (38.82%), Query Frame = 2
Query: 1733 STGDISLAISNLSQAIRLSPDDSEAYSKR-------AELYE---QNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYR---GILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAY 3166
            S GD++ ++ N++        DS   +KR       AEL     Q+G+   A     Q+ R +P+N   ++     +    +   +A   +  ++  P   EA+ + G  Y +  Q Q+A+  +   + L P+    Y      L  A       + ++   + + + N   Y  R   G L     +  EA   +   I    +   A  NLG ++  +G+   ++ +    +  DP ++ AY        +   ++ A+    RA+ L P+ +  +      Y   G +++A    R+A E+  +   +    A       +  +A +    A R  P+ A  LN L   + +    ++A+  +   LE            P  A  +  +A    +    +++ + +   ++I+P  A+AY + G     +  ++  +    RA+ INP    A+   A++        +AI +    L ++P    AY
Sbjct:   54 SEGDMASSVGNVA--------DSTEPTKRVLSFQGLAELAHREYQSGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAA----GDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVF----------PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 523          

HSP 5 Score: 53.9138 bits (128), Expect = 1.862e-6
Identity = 80/377 (21.22%), Postives = 140/377 (37.14%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            +PN A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A E YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++      ++D                   +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K +          NR   + P  S  Y L   F  A+ +
Sbjct:  244 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSL--NNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE------MQDV------------------QGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAE 582          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 97.8265 bits (242), Expect = 6.986e-20
Identity = 120/528 (22.73%), Postives = 216/528 (40.91%), Query Frame = 2
Query: 2693 VATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            VA   +P+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  + +    A + YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++LE+     NR  S+ P+ + LY
Sbjct:    8 VADSTEPTKRVLSFQGLAELAHREYQSGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSE---AEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEK-----NRLPSVHPHHSMLY 513          

HSP 2 Score: 87.8113 bits (216), Expect = 8.067e-17
Identity = 98/425 (23.06%), Postives = 173/425 (40.71%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +   +   A + YN A+ +    CP    +  N   +      +E+A++ +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   43 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRL----CPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 456          

HSP 3 Score: 76.6406 bits (187), Expect = 2.105e-13
Identity = 91/418 (21.77%), Postives = 178/418 (42.58%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI------SH-NLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +  N A+ L P  ++      +     G +E A    R+A E+      +H NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   81 AIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 472          

HSP 4 Score: 55.8398 bits (133), Expect = 5.302e-7
Identity = 83/448 (18.53%), Postives = 173/448 (38.62%), Query Frame = 2
Query: 1835 QNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYR---GILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAY 3166
            Q+G+   A     Q+ R +P+N   ++     +    +   +A   +  ++  P   EA+ + G  Y +  Q Q+A+  +   + L P+    Y      L  A       + ++   + + + N   Y  R   G L     +  EA   +   I    +   A  NLG ++  +G+   ++ +    +  DP ++ AY        +   ++ A+    RA+ L P+ +  +      Y   G +++A    R+A E+  +   +    A       +  +A +    A R  P+ A  LN L   + +    ++A+  +   LE            P  A  +  +A    +    +++ + +   ++I+P  A+AY + G     +  ++  +    RA+ INP    A+   A++        +AI +    L ++P    AY
Sbjct:   33 QSGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAA----GDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVF----------PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 466          

HSP 5 Score: 53.5286 bits (127), Expect = 2.215e-6
Identity = 80/377 (21.22%), Postives = 140/377 (37.14%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            +PN A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A E YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++      ++D                   +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K +          NR   + P  S  Y L   F  A+ +
Sbjct:  187 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSL--NNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE------MQDV------------------QGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAE 525          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Xenopus
Match: tbx2 (T-box 2 [Source:Xenbase;Acc:XB-GENE-1018115])

HSP 1 Score: 340.502 bits (872), Expect = 1.490e-97
Identity = 283/1005 (28.16%), Postives = 473/1005 (47.06%), Query Frame = 2
Query: 1163 KNRGYKKESNARDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAW-LHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLI-YFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM-------------------------------------------NKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEM-AAICV---RQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKP-SVALLNLLGTTQ--MKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGA---ANLNFLVAR--CYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATL---FGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSL---AIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKD-YNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGG 3985
            K  G + +   R+W+  IW+ WFDE++PP        +SD   E PY     + +  +  A +  IL L ++++PVL E      GA  E L  E+  ++  ++  ++P AF   RRGAL RK+G L  A +D+N AI++EP L+ AYW RHL+  +  K   A+EDLN+I+K +K Y  AY S+A IY   GD +++I + +QA++  PDD E Y +RA++YE   E ++A++DY +  +L  +   A+ KHG+Y      W +A +DF+++++   +N EA  + RG A+ +L  + +A  DFSA IHL+P+N++A++ RGCLLRK  P+ A++DF +   L  S EN+ +++YRGILY     ++EAI DFE V+  ++ +  AH+NLGLI    + D+ +++++ T+ L  DP YI+AY CRA+A+ Q+                                           N ++ A++ +  AI +       Y  RG     + +M +  A C+    +A EI+ N  Q+ + +A  + F + Y +AI     A + +P SV      G  +  +K +R    I S   C+ +   K+       G     +   LV R   YLEL+++  +      T K      EA                 +   N+AL I P   +A + R      +G +    +A  +    L + P C+ A   R  L Y ++A  L   A   FT A+ ID   IL F  RA+  + +  +   A+QD +  L +  +  L      NRG+++  +G + NA+ D+  A                                  +  D  + LA  +  N+++     N +   AK+ Y   + +D  +  A++N G         + A   F + +   P S      RA +   +     A  D+++A+ +QP   ++Y  R  +   +     A++DY  AI + G
Sbjct:  123 KYGGIRDKQVVREWVRDIWNTWFDEVFPPS-----RASSDNEQEQPY-----SLKEITEGATKEGILWLQDSVQPVLIEDP----GASVEDLEGEIARLTVLIDEKEKPCAFHCCRRGALNRKLGKLSLAIQDLNLAINLEPQLLDAYWNRHLIFCLQGKTTAALEDLNMIIKLNKLYTDAYLSKAEIYKQEGDYTMSILSYTQALKCRPDDDEIYFRRAQMYEAQDEYKIAMDDYAKCFQLSQSRVDALQKHGMYCFENCNWNIAVQDFTALIKQDINNVEASRIFRGRAHTQLANYTEAAEDFSAAIHLNPSNWMAFYYRGCLLRKCLPWQAVQDFML---LCDSSENLNAFLYRGILYIDMGLWAEAICDFERVLALDRTVVLAHMNLGLISLLNRKDYAQAIRHFTAALNVDPVYIKAYLCRAQAFQQVHICYCLSALIFFFICIPLDIFLLKFHVVDPYSFCTLVPASYSYNTFQ-ALEALTSAIKVRSRFHEAYYQRG-----LCRMHLQQAKCLDDFNKALEINPNYFQALLCRATFYGFRKRYSKAIMNCNAAIKVQPHSVRAYLYRGALKYYIKVRR----ILSLIVCIYRGALKDYSIVLLLGGWKEVDSKVLVNRGLLYLELQDFANALEVSMCTQKFRQQFFEA-----------------VQAFNQALNITPLSAEACIGRGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAA---RICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAI-VSLQIGDTFAALQDMNAALKLCGSAQL----LTNRGVIHQFMGKLPNAMRDYQAA----------------------------------ITADQDYSLAYFNAANLYL----HNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRADIRGKLGLTKEAIEDYEHAITLLG 1037          

HSP 2 Score: 317.005 bits (811), Expect = 1.289e-89
Identity = 272/956 (28.45%), Postives = 421/956 (44.04%), Query Frame = 2
Query: 1670 LILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPY-LAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPC-RAEAYFQMNKYEDAIKDINRAIHLFP-----------------------------DRS---NFYMLRGDFYLAMGKMEMAAIC-VRQAAEISHNLGQSPVQQALVHSFL--QHYDQAIDALLVATRGKP---SVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLV----ARCYLELKNYKKSQL----AFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKN-LKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            LI +K+K        R  +    G +SLAI +L+ AI L P   +AY  R  ++   G+   ALED N II+L          + LY                        T+A+L +   Y +   +  ++  ++  +   P++   YF+R  +    + Y +A+ D                       YA   Q S++ VD             A    G+  FE  ++  +V+  T+ +  D   + A    R  A+ Q+  Y +A +D + AIHL P                             D S   N ++ RG  Y+ MG +   AIC   +   +   +  + +   L+ S L  + Y QAI     A    P      L       Q+       A+  F  C+            P     L F V    + C L   +Y  +      A ++ +K+     EAYY +G CR+ L + K  + D N+AL INP  +QA L RAT +GF+ +Y+KAI+NCN  + ++P  +RAYLYRG LKY IK                   +    +  VC       Y  A++DYSIVLL+     +  K  +NRGL+YLEL D  NAL                   V +C  K +    EA++ F + L+  P    A + RGN +++Y        A +D+   L +    + A + LG+  QAQG F++AW+ FT+A++  P S    +GRAIV +Q+ D   AL+D+N A+++   S+ L  NRGV++Q M     AM+DY +A I       +AYFNA  +Y+HN Q  QA E + + V  DP +E+  +N  +  +     + ++      +SL P S+  YFNRA++   LQ+YQ AE D    L + PDDP + K R D R K G +  A+EDY+ ++ +
Sbjct:  210 LIDEKEKPCAFHCCRRGALNRKLGKLSLAIQDLNLAINLEPQLLDAYWNRHLIFCLQGKTTAALEDLNMIIKL----------NKLY------------------------TDAYLSKAEIYKQEGDYTMSILSYTQALKCRPDDDEIYFRRAQMYEAQDEYKIAMDD-----------------------YAKCFQLSQSRVD-------------ALQKHGMYCFENCNWNIAVQDFTALIKQDINNVEASRIFRGRAHTQLANYTEAAEDFSAAIHLNPSNWMAFYYRGCLLRKCLPWQAVQDFMLLCDSSENLNAFLYRGILYIDMG-LWAEAICDFERVLALDRTVVLAHMNLGLI-SLLNRKDYAQAIRHFTAALNVDPVYIKAYLCRAQAFQQVHICYCLSALIFFFICI------------PLDIFLLKFHVVDPYSFCTLVPASYSYNTFQALEALTSAIKVRSRFHEAYYQRGLCRMHLQQAK-CLDDFNKALEINPNYFQALLCRATFYGFRKRYSKAIMNCNAAIKVQPHSVRAYLYRGALKYYIK-------------------VRRILSLIVCI------YRGALKDYSIVLLLGGWKEVDSKVLVNRGLLYLELQDFANALE------------------VSMCTQKFRQQFFEAVQAFNQALNITPLSAEACIGRGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKL-CGSAQLLTNRGVIHQFMGKLPNAMRDY-QAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRADIRGKLGLTKEAIEDYEHAITL 1035          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Xenopus
Match: tbx2 (T-box 2 [Source:Xenbase;Acc:XB-GENE-1018115])

HSP 1 Score: 294.278 bits (752), Expect = 1.091e-86
Identity = 175/491 (35.64%), Postives = 262/491 (53.36%), Query Frame = 2
Query: 2915 AFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLK-NLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            A ++ +K+     EAYY +G CR+ L + K  + D N+AL INP  +QA L RAT +GF+ +Y+KAI+NCN  + ++P  +RAYLYRG LKY IK                   +    +  VC       Y  A++DYSIVLL+     +  K  +NRGL+YLEL D  NAL                   V +C  K +    EA++ F + L+  P    A + RGN +++Y        A +D+   L +    + A + LG+  QAQG F++AW+ FT+A++  P S    +GRAIV +Q+ D   AL+D+N A+++   S+ L  NRGV++Q M     AM+DY +A I       +AYFNA  +Y+HN Q  QA E + + V  DP +E+  +N  +  +     + ++      +SL P S+  YFNRA++   LQ+YQ AE D    L + PDDP + K R D R K G +  A+EDY+ ++
Sbjct:   58 ALTSAIKVRSRFHEAYYQRGLCRMHLQQAK-CLDDFNKALEINPNYFQALLCRATFYGFRKRYSKAIMNCNAAIKVQPHSVRAYLYRGALKYYIK-------------------VRRILSLIVCI------YRGALKDYSIVLLLGGWKEVDSKVLVNRGLLYLELQDFANALE------------------VSMCTQKFRQQFFEAVQAFNQALNITPLSAEACIGRGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKL-CGSAQLLTNRGVIHQFMGKLPNAMRDY-QAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRADIRGKLGLTKEAIEDYEHAI 502          

HSP 2 Score: 75.485 bits (184), Expect = 3.955e-13
Identity = 59/205 (28.78%), Postives = 95/205 (46.34%), Query Frame = 2
Query: 1514 GALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRG 2128
            G   +  G    A      A+ I+P  I+ +  R ++ L       A++D+N  LK   +  L   +R  I+   G +  A+ +   AI    D S AY   A LY  N +   A E Y + + L P N  A++  G+  + ++  Q A  DF  VL   P ++ A+ +R + Y  LQQ+Q A +D S  ++L P++ L Y  R 
Sbjct:  279 GYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKLCGSAQL-LTNRGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRA 482          

HSP 3 Score: 69.707 bits (169), Expect = 2.496e-11
Identity = 107/479 (22.34%), Postives = 184/479 (38.41%), Query Frame = 2
Query: 1550 ASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRL----------ALEDYNQIIRL---QPNNCLAMMKHGLYYLNI-----------------EQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAK----------------------------------LQQ---WQDALTDFSAVIHLDPNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAIT 2782
            A + +  AI +      AY++R L  +   + +  ++D N  L+ + NY  A   RA  Y      S AI N + AI++ P    AY  R  L       R+          AL+DY+ ++ L   +  +   ++  GL YL +                 +Q+  A + F+  L   P + EA + RG AY +                                  LQ    +Q A   F+  + +DP + L +  R  + L+  + + A++D + +L L  S + + +   RG+++    +   A+ D++  I  ++D   A+ N   +Y     F ++ +Y T  +A DP    A   R      +   + A+ D    + L P  S  Y  R   Y  + + + A               +S + QAL    LQ  D  I  L    RGK        LG T+   + ++ AIT
Sbjct:   55 ALEALTSAIKVRSRFHEAYYQRGLCRMHLQQAK-CLDDFNKALEINPNYFQALLCRATFYGFRKRYSKAIMNCNAAIKVQPHSVRAYLYRGALKYYIKVRRILSLIVCIYRGALKDYSIVLLLGGWKEVDSKVLVNRGLLYLELQDFANALEVSMCTQKFRQQFFEAVQAFNQALNITPLSAEACIGRGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKLCGSAQLLTN---RGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWA---------------ESDISQALN---LQPDDPLIYKLRADIRGK--------LGLTKEAIEDYEHAIT 503          

HSP 4 Score: 62.7734 bits (151), Expect = 3.065e-9
Identity = 55/218 (25.23%), Postives = 92/218 (42.20%), Query Frame = 2
Query: 1511 RGALYRKMGY---LVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPY 2155
            RG  Y + G+      A +D   A+ + P  + A              Q A     + L  D   +L ++ RA +    GD   A+ +++ A++L    ++  + R  +++  G+   A+ DY   I    +  LA       YL+  Q+  A + ++  +   P+N  A L+RG     LQ  Q AL DF  V+ L P +  AYF R  L    + Y
Sbjct:  241 RGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKLC-GSAQLLTNRGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQY 457          

HSP 5 Score: 61.2326 bits (147), Expect = 9.476e-9
Identity = 84/364 (23.08%), Postives = 151/364 (41.48%), Query Frame = 2
Query: 2390 GLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRG--DFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVAL------LNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLA---FSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLY--RGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDF 3442
             L  +P Y +A  CRA  Y    +Y  AI + N AI + P     Y+ RG   +Y+ + ++    +C+ + A   +++             L    + +D+ ++  RG   + L      L +   TQ   +++ +A+ +F          NQ     P +A         Y+E  + + +  A   F   + ++P+   A    G+     G  +Q       AL I+P+    +  RA +         A+ + N  L +   C  A L   RGV+   +     A++D+  AI  D +  LA+FN A  +    + + +A + Y+  + +  A   +  A +NRG+  + L D Q ALHDF
Sbjct:   95 ALEINPNYFQALLCRATFYGFRKRYSKAIMNCNAAIKVQPHSVRAYLYRGALKYYIKVRRILSLIVCIYRGALKDYSI-----------VLLLGGWKEVDSKVLVNRGLLYLELQDFANALEVSMCTQKFRQQFFEAVQAF----------NQALNITPLSAEACIGRGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKL---CGSAQLLTNRGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLY-LHNRQFTQAKEYYTRAVALDPA---NESAVLNRGITNMLLQDAQAALHDF 430          

HSP 6 Score: 56.225 bits (134), Expect = 3.455e-7
Identity = 45/167 (26.95%), Postives = 72/167 (43.11%), Query Frame = 2
Query: 1490 NAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWE----------------------------------RHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRL 1888
            +A LL+ RG +++ MG L  A +D   AI+ + D  +AY+                                   R + +++    Q A+ D  L+L        AY +RA +Y +      A S++SQA+ L PDD   Y  RA++  + G  + A+EDY   I L
Sbjct:  338 SAQLLTNRGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRADIRGKLGLTKEAIEDYEHAITL 504          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Xenopus
Match: tbx2 (T-box 2 [Source:Xenbase;Acc:XB-GENE-1018115])

HSP 1 Score: 241.891 bits (616), Expect = 3.111e-70
Identity = 133/361 (36.84%), Postives = 206/361 (57.06%), Query Frame = 2
Query: 3308 YEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            Y++A++DYSIVLL+     +  K  +NRGL+YLEL D  NAL DF       P D+ +  V+G CH +L+  +EA++ F + L+  P    A + RGN +++Y        A +D+   L +    + A + LG+  QAQG F++AW+ FT+A++  P S    +GRAIV +Q+ D   AL+D+N A+++   S+ L  NRGV++Q M     AM+DY +A I       +AYFNA  +Y+HN Q  QA E + + V  DP +E+  +N  +  +     + ++      +SL P S+  YFNRA++   LQ+YQ AE D    L + PDDP + K R D R K G +  A+EDY+ ++ +
Sbjct:    2 YDEALKDYSIVLLLGGWKEVDSKVLVNRGLLYLELQDFANALEDFKCVALRTPGDIKIHLVIGNCHQRLQQYEEAVQAFNQALNITPLSAEACIGRGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKL-CGSAQLLTNRGVIHQFMGKLPNAMRDY-QAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRADIRGKLGLTKEAIEDYEHAITL 360          

HSP 2 Score: 74.7146 bits (182), Expect = 3.311e-13
Identity = 56/186 (30.11%), Postives = 91/186 (48.92%), Query Frame = 2
Query: 1571 AISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRG 2128
            A+ I+P  I+ +  R ++ L       A++D+N  LK   +  L   +R  I+   G +  A+ +   AI    D S AY   A LY  N +   A E Y + + L P N  A++  G+  + ++  Q A  DF  VL   P ++ A+ +R + Y  LQQ+Q A +D S  ++L P++ L Y  R 
Sbjct:  154 ALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKLCGSAQL-LTNRGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRA 338          

HSP 3 Score: 65.855 bits (159), Expect = 1.976e-10
Identity = 78/361 (21.61%), Postives = 151/361 (41.83%), Query Frame = 2
Query: 2258 FSEAIVDFEVVICFN--KDM-CFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVR---QAAEISHN-------LGQSPVQQALVHSFLQHYDQAID---ALLVATRGKPSVAL---------------LNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFL-VARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKI 3244
            + EA+ D+ +V+     K++     VN GL+Y E  DF  +++         P  I+ +      + ++ +YE+A++  N+A+++ P  +   + RG+ Y+  G     A   R   +A  +S +       LG +   Q L      H+  A+D     ++   G+  V+L               L L G+ Q+   R    I  F   L       Q         +L +   A  YL  + + +++  ++  V ++P +  A  ++G   + L   +  + D    L++ P    AY  RA+L+    QY  A  + ++ L+++P     Y  R  ++ K+     AI+D+  AI +
Sbjct:    2 YDEALKDYSIVLLLGGWKEVDSKVLVNRGLLYLELQDFANALEDFKCVALRTPGDIKIHLVIGNCHQRLQQYEEAVQAFNQALNITPLSAEACIGRGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKLCGSAQLLTNR--GVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRADIRGKLGLTKEAIEDYEHAITL 360          

HSP 4 Score: 62.7734 bits (151), Expect = 1.820e-9
Identity = 62/299 (20.74%), Postives = 125/299 (41.81%), Query Frame = 2
Query: 1712 SRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAA---KDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQA 2596
            +R  +Y    D + A+ +       +P D + +      +++  +   A++ +NQ + + P +  A +  G  Y+     +  A   +DF   L   PS   A +  G        +Q A   F+  + +DP + L +  R  + L+  + + A++D + +L L  S + + +   RG+++    +   A+ D++  I  ++D   A+ N   +Y     F ++ +Y T  +A DP    A   R      +   + A+ D    + L P  S  Y  R   Y  + + + A   + QA
Sbjct:   28 NRGLLYLELQDFANALEDFKCVALRTPGDIKIHLVIGNCHQRLQQYEEAVQAFNQALNITPLSAEACIGRGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKLCGSAQLLTN---RGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQA 323          

HSP 5 Score: 61.6178 bits (148), Expect = 4.413e-9
Identity = 55/218 (25.23%), Postives = 92/218 (42.20%), Query Frame = 2
Query: 1511 RGALYRKMGY---LVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPY 2155
            RG  Y + G+      A +D   A+ + P  + A              Q A     + L  D   +L ++ RA +    GD   A+ +++ A++L    ++  + R  +++  G+   A+ DY   I    +  LA       YL+  Q+  A + ++  +   P+N  A L+RG     LQ  Q AL DF  V+ L P +  AYF R  L    + Y
Sbjct:   97 RGNAYIEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKLC-GSAQLLTNRGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQY 313          

HSP 6 Score: 61.2326 bits (147), Expect = 6.399e-9
Identity = 86/400 (21.50%), Postives = 158/400 (39.50%), Query Frame = 2
Query: 1856 ALEDYNQIIRL---QPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPS--VALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAI 3040
            AL+DY+ ++ L   +  +   ++  GL YL ++ +  A +DF  V    P + +  L  G  + +LQQ+++A+  F+  +++ P +  A   RG        Y                          I Y   +  ++A  DF   +  +     A + LG     +G F+++  + T  L  DP  I  +  RA    Q+     A++D+N A+ L    +     RG  +  MGK+  A    + A     +   +    A ++   + + QA +    A    P+   A+LN  G T M  +  + A+  F   L             P ++   F  A  Y  L+ Y+ ++   S  + + P+    Y  +   R +LG  K+ I D   A+ +
Sbjct:    5 ALKDYSIVLLLGGWKEVDSKVLVNRGLLYLELQDFANALEDFKCVALRTPGDIKIHLVIGNCHQRLQQYEEAVQAFNQALNITPLSAEACIGRG------NAY--------------------------IEYGHQRGTAQAKRDFLRALHLSPSCVAARICLGYTLQAQGLFQQAWNHFTVALDIDPQSILGFEGRAIVSLQIGDTFAALQDMNAALKLCGS-AQLLTNRGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLN-RGITNMLLQDAQAALHDFQLVLS----------LCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRADIRGKLGLTKEAIEDYEHAITL 360          

HSP 7 Score: 55.4546 bits (132), Expect = 3.817e-7
Identity = 45/167 (26.95%), Postives = 72/167 (43.11%), Query Frame = 2
Query: 1490 NAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWE----------------------------------RHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRL 1888
            +A LL+ RG +++ MG L  A +D   AI+ + D  +AY+                                   R + +++    Q A+ D  L+L        AY +RA +Y +      A S++SQA+ L PDD   Y  RA++  + G  + A+EDY   I L
Sbjct:  194 SAQLLTNRGVIHQFMGKLPNAMRDYQAAITADQDYSLAYFNAANLYLHNRQFTQAKEYYTRAVALDPANESAVLNRGITNMLLQDAQAALHDFQLVLSLCPVSSAAYFNRASLYNTLQQYQWAESDISQALNLQPDDPLIYKLRADIRGKLGLTKEAIEDYEHAITL 360          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Xenopus
Match: eno4 (enolase 4 [Source:Xenbase;Acc:XB-GENE-1009720])

HSP 1 Score: 101.679 bits (252), Expect = 6.119e-21
Identity = 137/591 (23.18%), Postives = 240/591 (40.61%), Query Frame = 2
Query: 2693 VATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY-----FNRANVLFDLQRYQEAELDFCSCLRIAP-DDPHVLKARGDCRSKTGDSLGALEDYKTS 4381
            + + GKP+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  S      A + YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++LE+     NR  S+ P+ + LY     F +A      +R+    LD  + L   P + P  LKA  D R + G       ++ TS
Sbjct:    7 IGSIGKPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVVD---AEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEK-----NRLPSVHPHHSMLYPLSHGFRKAIA----ERHGNLCLDKINVLHKPPYEHPKDLKA-SDGRLRVGYVSSDFGNHPTS 570          

HSP 2 Score: 89.7373 bits (221), Expect = 3.057e-17
Identity = 106/468 (22.65%), Postives = 185/468 (39.53%), Query Frame = 2
Query: 2990 LGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +GK  + +L       +  R YQA             +  A  +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +     + A + YN A+ +    CP    +  N   +      +E+A+  +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   10 IGKPTKRMLSFQGLAELAHREYQA-----------GDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVVDAEECYNTALRL----CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 455          

HSP 3 Score: 77.7962 bits (190), Expect = 1.233e-13
Identity = 91/418 (21.77%), Postives = 176/418 (42.11%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     DA +  N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   80 AIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVVDAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 471          

HSP 4 Score: 52.7582 bits (125), Expect = 5.633e-6
Identity = 79/377 (20.95%), Postives = 138/377 (36.60%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            +PN A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A E YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++ +                          +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K +          NR   + P  S  Y L   F  A+ +
Sbjct:  186 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVVDAEECYNTALRLCPTHADSL--NNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD------------------------VQGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAE 524          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Xenopus
Match: eno4 (enolase 4 [Source:Xenbase;Acc:XB-GENE-1009720])

HSP 1 Score: 98.5969 bits (244), Expect = 4.991e-20
Identity = 137/592 (23.14%), Postives = 239/592 (40.37%), Query Frame = 2
Query: 2690 LVATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY-----FNRANVLFDLQRYQEAELDFCSCLRIAP-DDPHVLKARGDCRSKTGDSLGALEDYKTS 4381
            L+    KP+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  S      A + YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++LE+     NR  S+ P+ + LY     F +A      +R+    LD  + L   P + P  LKA  D R + G       ++ TS
Sbjct:   35 LLRNSTKPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVVD---AEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEK-----NRLPSVHPHHSMLYPLSHGFRKAIA----ERHGNLCLDKINVLHKPPYEHPKDLKA-SDGRLRVGYVSSDFGNHPTS 599          

HSP 2 Score: 88.9669 bits (219), Expect = 5.203e-17
Identity = 98/425 (23.06%), Postives = 172/425 (40.47%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +     + A + YN A+ +    CP    +  N   +      +E+A+  +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   71 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVVDAEECYNTALRL----CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 484          

HSP 3 Score: 77.7962 bits (190), Expect = 1.334e-13
Identity = 91/418 (21.77%), Postives = 176/418 (42.11%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     DA +  N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:  109 AIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVVDAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 500          

HSP 4 Score: 52.7582 bits (125), Expect = 5.078e-6
Identity = 79/377 (20.95%), Postives = 138/377 (36.60%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            +PN A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A E YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++ +                          +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K +          NR   + P  S  Y L   F  A+ +
Sbjct:  215 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVVDAEECYNTALRLCPTHADSL--NNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD------------------------VQGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAE 553          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Mouse
Match: Ttc6 (tetratricopeptide repeat domain 6 [Source:MGI Symbol;Acc:MGI:2684915])

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 399/1092 (36.54%), Postives = 638/1092 (58.42%), Query Frame = 2
Query: 1139 IHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLD----EVDEEFRGALFETLLE----EVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGD-FEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQ-SPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            I NF+ ++++RG     N   W       W  E++            DKP +T           T+V++   E  D+PE   PV++    E+ +  +  L   +++    EV+ +++++++ +R  AF+  RRGA+YRK+G L +A  D+ +AI  EP  + AYW RH ++L  +K+  A++DLN I K +KN+  AY S+A I+    DI+LAI N SQAI+  P D++ Y KR E+YE+  +  LA++DY++ I        A+ K G++Y     W  A  DF+S+L+  P N++A  +RG AY K   ++ A  DFSA IHLDPNN++A + R CL RK+ PY A++D+S+S+L+    +N+  +++RGILY   K +  AI DFE V+   ++   A++N+G+IY E  D + ++  + T  +  DP Y+++Y CRAE Y +++K + A+ ++ RAIHL PD  + Y++RG F L M   ++A   + Q AE++  + + SP+Q+AL++SF +++D+AI  L      KP ++   LL   QMKAKR K+++  F   LE     ++       +A   + +  CY+E  N++ +  +F+  VK NP  AEA+YH+G C+++L K +  ILD NRAL +NP+ YQAYL+R   +G K +Y+KAILNCNE + + P  +RAY+ RGVLKY  + Y L I D + AIK+D N   A++NRA+C+  +   ++ A++DY IVLL+    ++     INRGL+Y EL     AL DF +A  +    + +      CHH++K  + A+  FTR +  +P ++ A + RGN +M+Y+  ++   A KD+   L +D   L A ++LG+  QAQGKF+KAW  FT+ IE +P S    +GRA+VC+QMS+   A++D+N AI+I   +  L  NRGV+++ M  +  AM DY  AI +      +AYFNAG +Y+H+ Q  QA + F   ++ +P +E   +N A+      K EE+ +  + ++   P+ A LYFNRA+    L++Y+ AE D    L + PD+  +   R   R K G    A+ DY  ++
Sbjct:  795 ILNFDKFAESRG-GIPKNTDPWT------WVLELF----------AKDKPRQTH----------TAVASSAQE--DVPE---PVIELSKLELSDHVKCNLPPEVIKYYESEVEKLTQEIKSEKRNLAFVYCRRGAIYRKLGKLQSAMNDLQEAIFQEPFFLNAYWHRHFIYLFQDKVNDALDDLNFITKYNKNHAEAYLSKAEIFREK-DITLAILNYSQAIKCRPKDADLYFKRGEMYEKTNKV-LAIDDYSKCIYYNRKRSDALWKRGMFYFENGNWIGAVYDFTSLLKLDPYNSKARTYRGRAYFKRNLYKQATQDFSAAIHLDPNNWVALYYRACLFRKSSPYRALQDYSVSVLINDGYDNLNCFLHRGILYTQLKFWMLAICDFETVVSLERNATLAYINIGIIYLEHLDNYTEAFWWFTEAIKVDPLYLQSYICRAETYSKLHKLKRAVIELTRAIHLQPDAIHLYIMRGQFLLMMKSYDLAKFTIYQVAEMNKGIIEMSPIQEALIYSFCENHDKAIHILEGVIASKPDISTYALLAKAQMKAKRIKESVRLFKKALELYTFSDKGPVATSVSAECLYNLGLCYMEEGNFQMAFESFTKAVKANPEFAEAFYHRGLCKVKLNK-QNSILDFNRALTLNPKHYQAYLSRVAYYGLKGRYSKAILNCNEAIKLYPESVRAYICRGVLKYYNRTYKLGITDLSTAIKMDKNNYTAYYNRALCYT-KIGEHQMALRDYGIVLLLDAGENIALNTLINRGLIYTELKQYGFALEDFKQAALMSGTSVSLCQATATCHHRIKEFEGAVEFFTRAIKINPHYVDAYIGRGNSYMEYSQEDAMIQAQKDFLKALHLDPSCLKARISLGYNLQAQGKFQKAWIHFTVGIESNPKSYLAYEGRAVVCLQMSNYFAAMQDINCAIKINSTAEFL-TNRGVIHEFMGQQQSAMADYQAAISLNP-SYSLAYFNAGNIYLHHRQFSQASDYFSTALKFNPENEYALMNRAVTNSVLKKYEEAEKDFSCAMERCPHWAALYFNRASFYVYLKKYKLAEEDLGIGLSLKPDEAIMYNLRAQVRGKMGLIAEAMSDYNQAL 1848          

HSP 2 Score: 79.337 bits (194), Expect = 4.548e-14
Identity = 97/438 (22.15%), Postives = 177/438 (40.41%), Query Frame = 2
Query: 1511 RGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSK---RAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDAL----TDFSAVIHLD----------------------------------PNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNI-------------------------------MSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI 2605
            R A Y   G    A  + N+AI + P+ + AY  R +L       ++ I DL+  +K DKN   AY +RA  Y   G+  +A+ +    + L   ++ A +    R  +Y +  +   ALED+ Q   +   +          +  I++++ A + F+  ++  P   +A++ RG +Y +  Q +DA+     DF   +HLD                                  P +YLAY  R  + L+ +  + A++D + ++ + S+ E +                               ++Y   G +Y   +QFS+A   F   + FN +  +A +N  +       +E++ K  +  +   P +   Y  RA  Y  + KY+ A +D+   + L PD +  Y LR      MG +  A     QA ++
Sbjct: 1414 RVAYYGLKGRYSKAILNCNEAIKLYPESVRAYICRGVLKYYNRTYKLGITDLSTAIKMDKNNYTAYYNRALCYTKIGEHQMALRDYGIVLLLDAGENIALNTLINRGLIYTELKQYGFALEDFKQAALMSGTSVSLCQATATCHHRIKEFEGAVEFFTRAIKINPHYVDAYIGRGNSYMEYSQ-EDAMIQAQKDFLKALHLDPSCLKARISLGYNLQAQGKFQKAWIHFTVGIESNPKSYLAYEGRAVVCLQMSNYFAAMQDINCAIKINSTAEFLTNRGVIHEFMGQQQSAMADYQAAISLNPSYSLAYFNAGNIYLHHRQFSQASDYFSTALKFNPENEYALMNRAVTNSVLKKYEEAEKDFSCAMERCPHWAALYFNRASFYVYLKKYKLAEEDLGIGLSLKPDEAIMYNLRAQVRGKMGLIAEAMSDYNQALDL 1850          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Mouse
Match: Ogt (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) [Source:MGI Symbol;Acc:MGI:1339639])

HSP 1 Score: 97.0561 bits (240), Expect = 1.201e-19
Identity = 121/528 (22.92%), Postives = 213/528 (40.34%), Query Frame = 2
Query: 2693 VATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            VA   +P+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  S      A   YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I   +LE+     NR  S+ P+ + LY
Sbjct:    8 VADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAE---AEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVAEQLEK-----NRLPSVHPHHSMLY 513          

HSP 2 Score: 87.4261 bits (215), Expect = 1.132e-16
Identity = 98/425 (23.06%), Postives = 170/425 (40.00%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +       A   YN A+ +    CP    +  N   +      +E+A+  +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   43 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL----CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 456          

HSP 3 Score: 75.485 bits (184), Expect = 4.482e-13
Identity = 90/418 (21.53%), Postives = 175/418 (41.87%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A    N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   81 AIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 472          

HSP 4 Score: 51.9878 bits (123), Expect = 6.683e-6
Identity = 78/377 (20.69%), Postives = 138/377 (36.60%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            +PN A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A + YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++ +                          +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K +          NR   + P  S  Y L   F  A+ +
Sbjct:  187 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSL--NNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD------------------------VQGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVAEQLEKNRLPSVHPHHSMLYPLSHGFRKAIAE 525          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Mouse
Match: Ogt (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) [Source:MGI Symbol;Acc:MGI:1339639])

HSP 1 Score: 95.5153 bits (236), Expect = 3.917e-19
Identity = 114/477 (23.90%), Postives = 192/477 (40.25%), Query Frame = 2
Query: 2840 PGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  S      A   YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I   +LE+     NR  S+ P+ + LY
Sbjct:   42 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAE---AEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVAEQLEK-----NRLPSVHPHHSMLY 503          

HSP 2 Score: 87.0409 bits (214), Expect = 1.323e-16
Identity = 98/425 (23.06%), Postives = 170/425 (40.00%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +       A   YN A+ +    CP    +  N   +      +E+A+  +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   33 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL----CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 446          

HSP 3 Score: 75.485 bits (184), Expect = 4.578e-13
Identity = 90/418 (21.53%), Postives = 175/418 (41.87%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A    N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   71 AIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 462          

HSP 4 Score: 51.9878 bits (123), Expect = 7.014e-6
Identity = 85/400 (21.25%), Postives = 146/400 (36.50%), Query Frame = 2
Query: 1418 GALFETL--LEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            G L + L  LEE K         Q   A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A + YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++      ++D                   +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K +          NR   + P  S  Y L   F  A+ +
Sbjct:  154 GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSL--NNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE------MQDV------------------QGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVAEQLEKNRLPSVHPHHSMLYPLSHGFRKAIAE 515          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Mouse
Match: Ttc13 (tetratricopeptide repeat domain 13 [Source:MGI Symbol;Acc:MGI:2384573])

HSP 1 Score: 73.9442 bits (180), Expect = 1.172e-12
Identity = 55/230 (23.91%), Postives = 106/230 (46.09%), Query Frame = 2
Query: 2885 ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINP--RLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDP 3568
            ++KN + +    S  + + P+  E +  +      LG++ + + DL +A+ + P  RLY+    R TL+     Y  A  +  + L +      A LY+G+  +       AI+ F EA+K   + I A+ +    +  E  N++ A + +   LL++     H +    RG++    G +Q AL +F R   ++P +    Y+ G+ H  +    E I+  T+ + +DP
Sbjct:  179 DIKNAELALFELSRVIALEPDRPEVFEQRAEILSPLGRINEAVNDLTKAIQLQPSARLYR---HRGTLYFISEDYATAHEDFQQSLELNRNQPTAMLYKGLTFFHRGLLKEAIEAFKEALKQKVDFIDAYKSLGQAYR-ELGNFDAATESFQKALLLNQN---HVQTLQLRGMMLYHHGSLQEALKNFKRCLQLEPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDP 401          

HSP 2 Score: 64.3142 bits (155), Expect = 1.277e-9
Identity = 58/242 (23.97%), Postives = 110/242 (45.45%), Query Frame = 2
Query: 1856 ALEDYNQIIRLQPNNCLAMMKHGLYY-----LNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPY-LAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            A+  ++ +++ +P+   A+   G+ Y      +I+  +LA  + S V+   P   E +  R    + L +  +A+ D +  I L P+  L Y  RG L   +E Y  A  DF  SL L  ++   M  +Y+G+ +       EAI  F+  +    D   A+ +LG  Y E G+F+ + +     L  +  +++    R    +     ++A+K+  R + L P       ++G  ++AMG+
Sbjct:  147 AIRHFSTMLQEEPDLVSAIYGRGIAYGKKGLHDIKNAELALFELSRVIALEPDRPEVFEQRAEILSPLGRINEAVNDLTKAIQLQPSARL-YRHRGTLYFISEDYATAHEDFQQSLELNRNQPTAM--LYKGLTFFHRGLLKEAIEAFKEALKQKVDFIDAYKSLGQAYRELGNFDAATESFQKALLLNQNHVQTLQLRGMMLYHHGSLQEALKNFKRCLQLEPYNEVCQYMKGLSHVAMGQ 385          

HSP 3 Score: 63.1586 bits (152), Expect = 2.413e-9
Identity = 50/212 (23.58%), Postives = 96/212 (45.28%), Query Frame = 2
Query: 1958 AAKDFSSVLRHYPSNTEAWLHRGTAYAK-----LQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRK-AEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMA 2575
            A + FS++L+  P    A   RG AY K     ++  + AL + S VI L+P+    + +R  +L        A+ D +        + +   Y +RG LY  ++ ++ A  DF+  +  N++   A +  GL +F +G  +++++     L     +I AY    +AY ++  ++ A +   +A+ L  +      LRG      G ++ A
Sbjct:  147 AIRHFSTMLQEEPDLVSAIYGRGIAYGKKGLHDIKNAELALFELSRVIALEPDRPEVFEQRAEILSPLGRINEAVNDLT---KAIQLQPSARLYRHRGTLYFISEDYATAHEDFQQSLELNRNQPTAMLYKGLTFFHRGLLKEAIEAFKEALKQKVDFIDAYKSLGQAYRELGNFDAATESFQKALLLNQNHVQTLQLRGMMLYHHGSLQEA 355          

HSP 4 Score: 62.3882 bits (150), Expect = 4.720e-9
Identity = 59/258 (22.87%), Postives = 110/258 (42.64%), Query Frame = 2
Query: 3527 EAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVES--DPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAP 4294
            EAIR F+  L  +P  + A   RG   + Y      D+         E+  + L  ++ L                        P+     + RA +   +  +N A+ DL +AI++QP S+ LY +RG +Y +  D   A +D+ +++ +   + P A    G  + H   L++A+E F++ ++   D +D   + +L   Y      + + E   +++ L+ N       R  +L+     QEA  +F  CL++ P
Sbjct:  146 EAIRHFSTMLQEEPDLVSAIYGRG---IAYGKKGLHDIKNA------ELALFELSRVIAL-----------------------EPDRPEVFEQRAEILSPLGRINEAVNDLTKAIQLQP-SARLYRHRGTLYFISEDYATAHEDFQQSLELNRNQ-PTAMLYKGLTFFHRGLLKEAIEAFKEALKQKVDFID--AYKSLGQAYRELGNFDAATESFQKALLLNQNHVQTLQLRGMMLYHHGSLQEALKNFKRCLQLEP 367          

HSP 5 Score: 61.6178 bits (148), Expect = 7.277e-9
Identity = 63/269 (23.42%), Postives = 112/269 (41.64%), Query Frame = 2
Query: 1652 AIEDLNLILKKDKNYVLAYKSRAGIYASTG-----DISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTS--------GLAADPTYIR 2419
            AI   + +L+++ + V A   R   Y   G     +  LA+  LS+ I L PD  E + +RAE+    G    A+ D  + I+LQP+  L   +  LY+++ E +  A +DF   L    +   A L++G  +      ++A+  F   +    +   AY   G   R+   + A  + S    L  ++ ++ +   RG++        EA+ +F+  +             GL +   G F + +K  T         G  A P Y+R
Sbjct:  147 AIRHFSTMLQEEPDLVSAIYGRGIAYGKKGLHDIKNAELALFELSRVIALEPDRPEVFEQRAEILSPLGRINEAVNDLTKAIQLQPSARLYRHRGTLYFIS-EDYATAHEDFQQSLELNRNQPTAMLYKGLTFFHRGLLKEAIEAFKEALKQKVDFIDAYKSLGQAYRELGNFDAATE-SFQKALLLNQNHVQTLQLRGMMLYHHGSLQEALKNFKRCLQLEPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDPLPGQKASPEYLR 413          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Mouse
Match: Dnajc7 (DnaJ heat shock protein family (Hsp40) member C7 [Source:MGI Symbol;Acc:MGI:1928373])

HSP 1 Score: 71.2478 bits (173), Expect = 6.174e-12
Identity = 73/352 (20.74%), Postives = 142/352 (40.34%), Query Frame = 2
Query: 2333 GLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLA---RATLFGFKNQYTKAILNCN---------EVLSIEPRCLRA----YLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIV 3340
            G  Y+ K D+ ++  Y T  +   P     Y  RA     + ++ +A+ D  +++ L       ++  G  +L++G    A    ++A E+ H   Q+  +    ++ +++                 +A ++            K       FC+++         + P       L A C   L  Y ++Q   S  ++++  +A+A Y +G C      +++ +    +AL + P   +A +A      L   K    KA    N         E L I+P  ++     Y  RG +  K++    AI+D T A+K+D   I A+  RA C+  + + +E+A++DY  V
Sbjct:   35 GNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEY---------------EKIAEVDF----------EKRDFRKVVFCMDRALE------FAPACHRFKILKAECLAMLGRYPEAQFVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCY-MDTEQFEEAVRDYEKV 354          

HSP 2 Score: 54.6842 bits (130), Expect = 8.432e-7
Identity = 72/302 (23.84%), Postives = 112/302 (37.09%), Query Frame = 2
Query: 3380 YINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVV--GVCHHKLKNLKEAIRVFTRCLDHDPKFILAK--VSRGNVFMDYNSSNSRDLAAKDYNSV-----------------------------------------LEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPL----DGRAIVCMQMSDLNGALKDLN---------EAIRIQPQ----SSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDE 4099
            Y NR    + LG  + AL D    Q+++ +D +V   +  G CH  L N   A R F R L+ D K   A+      N  M+Y      D   +D+  V                                         L +DS + DAL   G C   +   +KA   F  A+   P+ E+      + +A+   +  D N A K+ N         EA+ I P     ++ LY NRG V   +R    A++D   A+ +       AY      Y+   Q E+A+  + K  +++   E
Sbjct:   65 YGNRAATLMMLGRFREALGDA--QQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAEVDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQFVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACVACRNAKALKA-KKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRQLEDAIEDCTNAVKLDDTYIK-AYLRRAQCYMDTEQFEEAVRDYEKVYQTEKTKE 362          
BLAST of TPR_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86TZ1|TTC6_HUMAN (Tetratricopeptide repeat protein 6 OS=Homo sapiens OX=9606 GN=TTC6 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 5.435e-76
Identity = 154/423 (36.41%), Postives = 233/423 (55.08%), Query Frame = 2
Query: 3128 EVLSIEPRCLR----AYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +  +I   CL      Y+  G L+     Y LAI D T AI +D N   AF+NRA+C+  + +  + A+ DY IVLL+     +    ++NRGL+Y+ELG    AL DF +A  I   +  + +   +CHH++   +EA+  FT  L  +P F+ A V RGN +M+Y    +   A KD+   L I+  ++ A ++ G+  QAQGKF+KAW+ FT+AI+  P +    +GRA+VC+QM +   A++D+N A++I   +  L  NRGV+++ M  K  AMKDY  AI +   K  +AYFNAG +Y H+ Q  QA + F K ++ DP +E   +N A+      K EE+ E     I   P  A +YFNRA+  + L++Y+ AE D    L + P+D  V   R   R K G    A+ DY  ++
Sbjct:   95 DATAISADCLYNLGLCYMEEGNLQ---MTYKLAITDLTTAISMDKNSYTAFYNRALCYT-KIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFL-TNRGVIHEFMGHKQNAMKDYQDAITLNP-KYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQAL 511          

HSP 2 Score: 127.487 bits (319), Expect = 4.200e-29
Identity = 138/586 (23.55%), Postives = 236/586 (40.27%), Query Frame = 2
Query: 2555 MGKMEMAAICVRQAAEISHNLGQ-SPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKN----YKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGD---VQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRI 4288
            M   ++A   + Q AE+   L + SP+QQAL++SF +++D+AI+ L   +  +  + +  LL   QMKAKR K+A+      L+ +   ++       +A+  + +  CY+E  N    YK +    +  + ++ N   A+Y++  C  ++ +++  + D    L                          +L+  E +      L  +L RG++  ++  Y  A++DF +A  I           A+C +     +E+A+  ++  L I+        AY+ RG  Y+E G     + A  DF++A  I P  +      G         ++A   FT  +D DPK  LA   R  V                                    C Q    F    DI   A  K   +   L  R ++   M     A+KD  +AI + P+ S+ Y N G +Y   R    A   ++KA+     +      N         + E+A E F   +ES P   A + N A  Y    + E + E +N+++SL PN A +Y  RA V   +   +EA  D+   L +
Sbjct:    2 MKYYDLAKFTIYQIAEMDKGLSELSPMQQALIYSFCENHDKAIEVLDGISWNRAEMTMCALLAKVQMKAKRTKEAVEVLKKALDAISHSDKGPDATAISADCLYNLGLCYMEEGNLQMTYKLAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVL--------------------------LLDATETVK-----LNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHH-RINEFEEAVNFFTWALKINPCF---LDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVV------------------------------------CLQMGNNFAAMQDI--NAAMKISTTAEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDP-ENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALDL 513          

HSP 3 Score: 99.7525 bits (247), Expect = 4.227e-20
Identity = 95/399 (23.81%), Postives = 174/399 (43.61%), Query Frame = 2
Query: 1529 KMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVL---AYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNI---EQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMA------AICVRQAAEISHNL-GQSPVQQALVHSFLQHYDQAID 2683
            +M Y +A + D+  AIS++ +   A++ R L +    ++QMA+ D  ++L  D    +    + +R  IY   G    A+ +  QA  +S  +       A  + +  E   A+  +   +++ P    A +  G  Y+     E  + A KDF   L   P+  +A +  G       ++Q A   F+  I  DP NYLAY  R  + L+    + A++D + ++ + ++ E + +   RG+++        A+ D++  I  N     A+ N G IYF    F ++  Y +  L  DP        RA     + KYE+A +D    I   P  +  Y  R  FY  + + E+A      A+ ++    + +N   +   +  L+   +  Y+QA+D
Sbjct:  118 QMTYKLAIT-DLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAALISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTTAEFLTN---RGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQALD 512          

HSP 4 Score: 80.4925 bits (197), Expect = 4.797e-14
Identity = 101/435 (23.22%), Postives = 177/435 (40.69%), Query Frame = 2
Query: 1751 LAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAM---MKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTA--YAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPS--VALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRAL 3034
            LAI++L+ AI +  +   A+  RA  Y +  E ++AL DY  ++ L     + +   +  GL Y+ + Q+  A +DF        S T   L   TA  + ++ ++++A+  F+  + ++P    AY  RG                             SYM  G   AT     +A  DF   +  N     A ++ G     +G F+K+  + T  +  DP    AY  RA    QM     A++DIN A+ +    + F   RG  +  MG  + A    + A  ++     +      ++   + + QA D    A +  P     L+N    T    K++++A   F   +E            P  A + F  A  Y  LK Y+ ++   +  + + PN A  Y  +   R ++G +++ + D N+AL
Sbjct:  123 LAITDLTTAISMDKNSYTAFYNRALCYTKIRELQMALTDYGIVLLLDATETVKLNTFLNRGLIYVELGQYGFALEDFKQAA--LISRTNGSLCHATAMCHHRINEFEEAVNFFTWALKINPCFLDAYVGRG----------------------------NSYMEYGHDEAT----KQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKI-STTAEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNR-AITNTILKKYEEAKEDFANVIESC----------PFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVYNFRAKVRGKIGLIEEAMADYNQAL 511          

HSP 5 Score: 58.151 bits (139), Expect = 5.582e-7
Identity = 59/239 (24.69%), Postives = 94/239 (39.33%), Query Frame = 2
Query: 1511 RGALYRKMGYLVA---ASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIH----------------------------------LDPNNYLAY 2116
            RG  Y + G+  A   A KD   A+ I P  I A            K Q A     + +  D    LAY+ RA +    G+   A+ +++ A+++S   +E  + R  ++E  G  + A++DY   I L P   LA    G  Y +  Q+  A+  FS  L+  P N    ++R      L+++++A  DF+ VI                                   L PN+ L Y
Sbjct:  250 RGNSYMEYGHDEATKQAQKDFLKALHINPAYIKARISFGYNLQAQGKFQKAWNHFTIAIDTDPKNYLAYEGRAVVCLQMGNNFAAMQDINAAMKISTT-AEFLTNRGVIHEFMGHKQNAMKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEYVLMNRAITNTILKKYEEAKEDFANVIESCPFWAAVYFNRAHFYYCLKQYELAEEDLNKALSLKPNDALVY 487          
BLAST of TPR_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9M8Y0|SEC_ARATH (Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 7.624e-21
Identity = 98/410 (23.90%), Postives = 167/410 (40.73%), Query Frame = 2
Query: 2861 FLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDP 4090
             L+   Y +L+ Y          ++I P  AE Y +        G   + I     A+ + P    A+   A+ +  K + ++A   C + LS+ P  + A+   G L         A   + EA++I     +A+ N A  F  E  +  +A+Q Y   + +  A      AY+N G VY  LG    A+  +  A  ++PN       +   +++   L  AIR + + L  DP+F+ A  + GN   D       D A + YN  L +   H  A+ NLG           A  +F   +        P +  AI+  Q  + + A+   NE +RI P ++   +NRG  Y+ +     A++DY  AI         A+ N    Y  +  +E A+  +++ +   P
Sbjct:   91 LLIGAIYYQLQEYDMCIARNEEALRIQPQFAECYGNMANAWKEKGDTDRAIRYYLIAIELRPNFADAWSNLASAYMRKGRLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLF-MESGDLNRALQYYKEAVKLKPAFP---DAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRV---DEAVRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLAIIYKQQGNYSDAISCYNEVLRIDPLAADALVNRGNTYKEIGRVTEAIQDYMHAINFRPTMAE-AHANLASAYKDSGHVEAAITSYKQALLLRP 492          

HSP 2 Score: 80.4925 bits (197), Expect = 9.061e-14
Identity = 94/437 (21.51%), Postives = 177/437 (40.50%), Query Frame = 2
Query: 3101 YTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQP-------NDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            + +A+ + N V    P      L  G + Y+++ Y + I    EA++I       + N A  +  EK + ++AI+ Y I + +         A+ N    Y+  G +  A     +A ++ P       N   ++   G+ H       EA+R+        P F +A  +   +FM+   S   + A + Y   +++     DA +NLG   +A G+  +A   +  A++  PNS       A +  +   L+ A++   +A+   P+    Y N G   + +     A++ YN+ + +     P A  N G +Y+    +  A   F+ T+       A + NLA++Y  Q    ++I   N  + + P +A    NR N   ++ R  EA  D+   +   P               +G    A+  YK ++ +
Sbjct:   69 FKQALEHSNMVYQRNPLRTDNLLLIGAIYYQLQEYDMCIARNEEALRIQPQFAECYGNMANAWK-EKGDTDRAIRYYLIAIELRPNFA---DAWSNLASAYMRKGRLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRI-------QPTFAIAWSNLAGLFME---SGDLNRALQYYKEAVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLALQP-NHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLAIIYKQQGNYSDAISCYNEVLRIDPLAADALVNRGNTYKEIGRVTEAIQDYMHAINFRPTMAEAHANLASAYKDSGHVEAAITSYKQALLL 490          

HSP 3 Score: 76.6406 bits (187), Expect = 1.428e-12
Identity = 80/349 (22.92%), Postives = 146/349 (41.83%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCL-----LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPD 2512
            RPN A   S   + Y + G L  A++    A+S+ P L+ A+     L      I  A       ++    + +A+ + AG++  +GD++ A+    +A++L P   +AY     +Y+  G    A+  Y   ++++PN+ +A       Y    Q  LA + +   L   P   EA+ + G A   + +  +A+  ++  + L PN+  A    G +     +      L     +++  L +   N+       I+Y     +S+AI  +  V+  +     A VN G  Y E G   ++++     +   PT   A+   A AY      E AI    +A+ L PD
Sbjct:  151 RPNFADAWSNLASAYMRKGRLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLFMESGDLNRALQYYKEAVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNL------AIIYKQQGNYSDAISCYNEVLRIDPLAADALVNRGNTYKEIGRVTEAIQDYMHAINFRPTMAEAHANLASAYKDSGHVEAAITSYKQALLLRPD 493          

HSP 4 Score: 69.707 bits (169), Expect = 1.826e-10
Identity = 69/305 (22.62%), Postives = 124/305 (40.66%), Query Frame = 2
Query: 3413 GDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGD 4327
            GD + AL          P     L ++G  +++L+     I      L   P+F       GN+   +      D A + Y   +E+     DA  NL      +G+  +A      A+  +P           +      ++ A     EA+RIQP  ++ + N   ++    D   A++ Y +A+ +     P AY N G VY    +  +A+ C++  ++  P     + N+A +Y  Q +L+ +I +  +++S  P     Y N  N L D+ R  EA   +  CL + P+ P  +   G+
Sbjct:   67 GDFKQALEHSNMVYQRNPLRTDNLLLIGAIYYQLQEYDMCIARNEEALRIQPQF---AECYGNMANAWKEKGDTDRAIRYYLIAIELRPNFADAWSNLASAYMRKGRLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLFMESGDLNRALQYYKEAVKLKP-AFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNHPQAMANLGN 367          

HSP 5 Score: 67.781 bits (164), Expect = 7.087e-10
Identity = 72/310 (23.23%), Postives = 117/310 (37.74%), Query Frame = 2
Query: 1493 AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRA 2422
            A   S    L+ + G L  A +   +A+ ++P    AY     ++    +   AI      L+   N  +A+ + A IY   G + LAI +  QA+   P   EAY+      +  G    A+  YNQ + LQPN+  AM   G  Y+       A+  F + L      +  + +    Y +   + DA++ ++ V+ +DP                   LA                  + + RG  Y    + +EAI D+   I F   M  AH NL   Y + G  E ++      L   P +  A
Sbjct:  223 AIAWSNLAGLFMESGDLNRALQYYKEAVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLAIIYKQQGNYSDAISCYNEVLRIDP-------------------LAAD----------------ALVNRGNTYKEIGRVTEAIQDYMHAINFRPTMAEAHANLASAYKDSGHVEAAITSYKQALLLRPDFPEA 497          

HSP 6 Score: 62.7734 bits (151), Expect = 2.828e-8
Identity = 73/385 (18.96%), Postives = 160/385 (41.56%), Query Frame = 2
Query: 1643 IQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFK-RGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKP--SVALLNLLGTTQMKAKRWKDAITSF 2788
             + A+E  N++ +++            IY    +  + I+   +A+R+ P  +E Y   A  +++ G+   A+  Y   I L+PN   A       Y+   +   A +     L   P   +A  + G          +A + +   + + P   +A+    G  +   +   A++ +  ++ L+ +  +  +Y+  G +Y    + +EAI+ ++  +    +   A  N+  IY+E+G  + ++++    L+ DP ++ AY     A   + + ++A++  N+ + L P+        G+ Y+    M  A+   +    ++  L       A+++    +Y  AI       R  P  + AL+N  G T  +  R  +AI  +
Sbjct:   69 FKQALEHSNMVYQRNPLRTDNLLLIGAIYYQLQEYDMCIARNEEALRIQPQFAECYGNMANAWKEKGDTDRAIRYYLIAIELRPNFADAWSNLASAYMRKGRLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLFMESGDLNRALQYYKEAVKLKPAFPD--AYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLAIIYKQQGNYSDAISCYNEVLRIDPLAADALVN-RGNTYKEIGRVTEAIQDY 450          

HSP 7 Score: 62.7734 bits (151), Expect = 2.900e-8
Identity = 73/343 (21.28%), Postives = 143/343 (41.69%), Query Frame = 2
Query: 1571 AISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRK-AEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQA 2596
            AI + P+   A+      ++   ++  A +     L  +   V A+ +   +  + G I  A S   +A+R+ P  + A+S  A L+ ++G+   AL+ Y + ++L+P    A +  G  Y  + +   A   +   L+  P++  A+ +  + Y +  Q   A+  +   +  DP    AY   G  L+       A+R ++  L L+ +    M+ +  G +Y        A   F+  +     +     NL +IY ++G++  ++      L  DP    A   R   Y ++ +  +AI+D   AI+  P  +  +      Y   G +E A    +QA
Sbjct:  147 AIELRPNFADAWSNLASAYMRKGRLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLFMESGDLNRALQYYKEAVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQALSRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLALQPNHPQAMANL--GNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLAIIYKQQGNYSDAISCYNEVLRIDPLAADALVNRGNTYKEIGRVTEAIQDYMHAINFRPTMAEAHANLASAYKDSGHVEAAITSYKQA 487          

HSP 8 Score: 58.9214 bits (141), Expect = 4.146e-7
Identity = 94/485 (19.38%), Postives = 180/485 (37.11%), Query Frame = 2
Query: 1793 DDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMS-YMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEIS-------HNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPK---------NQYKPW---PPGAANLNFLVARC-------------YLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEP 3148
            DD    +   +LY + G+ + ALE  N + +  P     ++  G  Y  ++++ +        LR  P   E + +   A+ +      A+  +   I L PN   A+                              N+ S YM +G       + SEA    +  +  N  +  AH NLG +   +G   ++       +   PT+  A+   A  + +      A++    A+ L P   + Y+  G+ Y A+G+   A +C + A ++         N+     +Q  +   ++HY QA+      +R    +   N LG       R  +A+  +  CL  L+P          N Y  W    P ++     +A               Y +  NY  +   ++  ++I+P  A+A  ++G     +G++ + I D   A+   P + +A+   A+ +        AI +  + L + P
Sbjct:   52 DDDARLALAHQLY-KGGDFKQALEHSNMVYQRNPLRTDNLLLIGAIYYQLQEYDMCIARNEEALRIQPQFAECYGNMANAWKEKGDTDRAIRYYLIAIELRPNFADAW-----------------------------SNLASAYMRKG-------RLSEATQCCQQALSLNPLLVDAHSNLGNLMKAQGLIHEAYSCYLEAVRIQPTFAIAWSNLAGLFMESGDLNRALQYYKEAVKLKPAFPDAYLNLGNVYKALGRPTEAIMCYQHALQMRPNSAMAFGNIASIYYEQGQLDLAIRHYKQAL------SRDPRFLEAYNNLGNALKDIGRVDEAVRCYNQCLA-LQPNHPQAMANLGNIYMEWNMMGPASSLFKATLAVTTGLSAPFNNLAIIYKQQGNYSDAISCYNEVLRIDPLAADALVNRGNTYKEIGRVTEAIQDYMHAINFRPTMAEAHANLASAYKDSGHVEAAITSYKQALLLRP 492          
BLAST of TPR_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q27HV0|OGT1_PIG (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.732e-19
Identity = 121/528 (22.92%), Postives = 214/528 (40.53%), Query Frame = 2
Query: 2693 VATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            VA   +P+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  S      A   YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++LE+     NR  S+ P+ + LY
Sbjct:    8 VADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAE---AEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEK-----NRLPSVHPHHSMLY 513          

HSP 2 Score: 87.0409 bits (214), Expect = 9.307e-16
Identity = 98/425 (23.06%), Postives = 170/425 (40.00%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +       A   YN A+ +    CP    +  N   +      +E+A+  +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   43 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL----CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 456          

HSP 3 Score: 75.485 bits (184), Expect = 3.189e-12
Identity = 90/418 (21.53%), Postives = 175/418 (41.87%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A    N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   81 AIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 472          
BLAST of TPR_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P81436|OGT1_RABIT (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 7.027e-19
Identity = 121/528 (22.92%), Postives = 214/528 (40.53%), Query Frame = 2
Query: 2693 VATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            VA   +P+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  S      A   YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++LE+     NR  S+ P+ + LY
Sbjct:    8 VADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAE---AEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEK-----NRLPSVHPHHSMLY 513          

HSP 2 Score: 87.0409 bits (214), Expect = 1.039e-15
Identity = 98/425 (23.06%), Postives = 170/425 (40.00%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +       A   YN A+ +    CP    +  N   +      +E+A+  +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   43 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL----CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 456          

HSP 3 Score: 75.485 bits (184), Expect = 3.590e-12
Identity = 90/418 (21.53%), Postives = 175/418 (41.87%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A    N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   81 AIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 472          
BLAST of TPR_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O15294|OGT1_HUMAN (UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3)

HSP 1 Score: 97.4413 bits (241), Expect = 7.332e-19
Identity = 121/528 (22.92%), Postives = 214/528 (40.53%), Query Frame = 2
Query: 2693 VATRGKPSVALLNLLGTTQMKAKRWK--DAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            VA   +P+  +L+  G  ++  + ++  D   +   C++  + +       P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  S      A   YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++LE+     NR  S+ P+ + LY
Sbjct:    8 VADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE-------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAE---AEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEK-----NRLPSVHPHHSMLY 513          

HSP 2 Score: 87.0409 bits (214), Expect = 1.084e-15
Identity = 98/425 (23.06%), Postives = 170/425 (40.00%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPI---AYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP     Y N     +       A   YN A+ +    CP    +  N   +      +E+A+  +RK +E  P   A   NLA V   Q KL+E++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   43 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL----CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTAL 456          

HSP 3 Score: 75.485 bits (184), Expect = 3.652e-12
Identity = 90/418 (21.53%), Postives = 175/418 (41.87%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A    N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   81 AIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHC 472          
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3JZA6 (uncharacterized protein LOC106177489 OS=Lingula unguis OX=7574 GN=LOC106177489 PE=4 SV=1)

HSP 1 Score: 999.964 bits (2584), Expect = 0.000e+0
Identity = 532/1287 (41.34%), Postives = 799/1287 (62.08%), Query Frame = 2
Query:  584 IIHQRKRCTSVPNRHWLEEDSLIVHLEYHQIMDEINIQRQKIRALKNTSEINEDINEKKPLEE--DEKIFNDN-FDSGILTTNVENEYKTHQSVKSIEDDCSSPAKNALRAGQNYIYYXXXXXXXXXXXXXXNIARISDIERFLGQPPNKLDKTKSFENIRIELKRIRSCXXXXXXXXXXXXXXXXADIHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGD-FEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYIXXXXXXXXXXNNCC 4432
            +  + +R  S+PN +  +ED L +  ++   MDEI  Q ++I+  K        + +K P+++  +E I +++   +G+  T      +   + K   DD  + A+ AL AG+ Y+ YP +K+ K  P    ++AR+ +IERFL  PP KL++T+S   + + ++R+     R    +K    +S+ DI +F+ +++ RGYK E + R+W   IW+ WFDE++PP      +  +   S      +   R     S +   I ++ + IEP+ D  +E     L   L +EV+ +S+ +     P AF L RRGA+YRK+G +    +D++ AI++EP L+ AYW RHLLHL+  K   A+EDLN +L+  K +  AY+SRA IY  +GD+++AI N +QAI+L P+D EAY +RAE+YE++GE RLALEDY    RL P    A+ KHGLYY N + WQ    DF+ +L+  P+N EA  +RG A+AK+ QW  A+ D SA IHLDPNN +A++ RGCLLRK +P  A++D S+S++L+  + N+M+Y +RGILY +T +  +AI DFE V+  +KD+  AHVNLGLIY  + D  + +++  ++ +  DPTYIRAY CRAEAY +++ + +A+ D  RAIHL PD  ++YM RG   L MG +E+AA CVR A+E++  LGQSP+QQA+V SFL++YD+AI AL  ATR KP  +L  LLG TQMKAK W++AI +F   L  LKP +    WP  AA +++L+  C +EL+ Y ++  AF+  +K++  +AEA+Y +G  R+RL K  +GI D NRALA++P+++Q YL+RA  +G + QY+KAILNCNE + ++P  +RAYL+RG LKY IKAY LAI+D T+A  ID+ C LA+FNRAVC++ + KN+ KA+QDY IVLL+ DAL L  K  INRGL+Y +  D +NAL DF+ A  I   +  + + +G+C+HKL  L++A++ F+  L  D  F+   + RGNV MDY        A +DY   L+++  +L A VNL +  Q  GK+  AW  FT A+  +P  +  L+GRAIV +QMSD   A +D+N ++R+ P + +L  NRGV++Q M DK  AM+DY +AI I      +AYFNA  +Y    Q +QA   + K +  +P DE+  +N A+  +       +++    ++ LSP+SA++YFNR N+   L+++ +AE D+   L + PDD  V K R D R K G    A+ DYK ++ I S        N+  
Sbjct: 1027 VFPKPRRTNSMPNLYGDDEDFLFIPQDFSTAMDEITKQMKQIKEAK--------LGKKTPVQQLPEEVIESESGAKTGVARTRSPTTEQRVYTRKQEYDDKPTLAEEALEAGRKYVMYPKRKKKKMVPL---DMARLEEIERFLAMPPGKLERTESLPKVNVPVERL----LRVPQYVKNKHRRSIPDILDFDSFAEKRGYKGE-DEREWTRDIWNAWFDEVFPPTQSERDEDEARAMSAMSSTTDRSVRSKGHASVVSTHISEVIDEIEPLAD-TEENAEAILL--LQDEVEKLSELISQSPTPTAFDLCRRGAIYRKLGQIKLGLEDLDRAIALEPMLLDAYWHRHLLHLLKGKKNDALEDLNFLLRHSKQHAGAYRSRAEIYRESGDVTMAIVNFNQAIKLDPNDHEAYYRRAEMYEKSGEMRLALEDYAIATRLAPEKTEALFKHGLYYFNSQNWQPCINDFTDLLKVEPNNAEARTYRGRAFAKMSQWTPAIEDLSAAIHLDPNNSVAHYHRGCLLRKLQPKKALQDLSVSIILDDGDSNVMAYFHRGILYNSTGRPEDAIPDFETVLKLDKDIASAHVNLGLIYMTQLDNVQNAIRKFSAAIKVDPTYIRAYVCRAEAYHRIHDHRNALLDFTRAIHLKPDTHHYYMYRGQLVLEMGNLELAAFCVRHASELNAGLGQSPMQQAVVQSFLKNYDKAIGALESATRQKPVASLFTLLGKTQMKAKLWRNAIGNFDKALGILKPWSDKDSWPHEAAEVHYLIGMCNMELRGYLEAHEAFNNAIKVDGTNAEAFYQRGLSRIRL-KQGKGIQDFNRALALDPKIFQVYLSRAAYYGLRGQYSKAILNCNEAIKLQPNSVRAYLFRGALKYHIKAYQLAIRDLTKATSIDSTCALAYFNRAVCYH-DSKNHAKALQDYGIVLLLGDALRL--KVLINRGLLYFDRDDYRNALQDFLLAAKIDAKNCKIYHTIGLCYHKLNCLEDAVKAFSVALTLDKFFLEGYIGRGNVLMDYGHDAGLKFARRDYERALQLNPIYLPARVNLAYNLQVCGKYMHAWRQFTAALTANPYYKPALEGRAIVNLQMSDTFAAFQDINASVRVVPSAELL-TNRGVIHQFMGDKANAMRDYQQAISIDPSHA-LAYFNAANIYFQMRQFKQAHAHYDKAILFNPKDESALLNRAITKVLLRDSAGALDDFKAAVKLSPHSAHMYFNRGNLYSSLKQFDKAEKDYTKALTLQPDDALVYKRRADVRGKLGKKAEAIADYKYAIEIQSKKRATIDANSVT 2288          
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: A0A267G818 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000887g9 PE=4 SV=1)

HSP 1 Score: 943.725 bits (2438), Expect = 0.000e+0
Identity = 558/1526 (36.57%), Postives = 845/1526 (55.37%), Query Frame = 2
Query:  167 ERIISQKNEIEKWRTKANEMLN----------------------LTSEIEIVGTFIS--PSEPKIIDIWQPLAPRLFMSQNQVTNVLCPKYNPNI-----------FEPTIEEVSK-QNTFENF--------------TSEDLTLSNEASFCNEIDLEALETKERLLSRKINSVECLADERIDENKFSKIIHQRKRCTSVPNRHWLEEDSLIVHLEYHQIMDEINIQRQKIRALKNTSEINEDINEKKP----------LEEDEKIFNDNFDSGILTTNVENEYKTHQSVK--SIEDDCSSPAKNALRAGQNYIYYXXXXXXXXXXXXXX--------NIARISDIERFLGQPPNKLDKTKSFENIRI----EL---KRIRSCXXXXXXXXXXXXXXXXADIHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPIP---DHIID---------------LTSDKPSETPYKNE--LLNREP----------TSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQR----PNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNL----GQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKP--WPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYL-ELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +RI+ +    E W+ +A E L                        T ++E+VG+ +       + +D+ +P  PR      QV   L  +Y   +           F P      + Q    +F               + D+      +   E++  AL T+ RL +R   S+E L  E  +E         R R  S+P  H  EED+L+++L+Y+ I  E+  Q + +   +N  ++NE     +           ++E E+  +    +G   T+ + +    + ++  +I++   +PA+ AL AG+ Y+  P + +   + ++          ++ARI  IERFL +P N+L + +S ++++     EL   KRIRS + R      +          +F  W+   GY+ + + RDW+  +WD+WFDE+YPP     D  +                 T    S++   +E  LLN +P          +S  A     + LPE I P LDE+ E  R      L +EV  ++ D+E  +R    P+AF L RRGAL RK+GYL  A +D++  I  EP  + AYW RHLL ++ N++  A++DLN++LK  K+   AYK+RA IY    D+++AI N  QAI+L+P D++ Y KRA LYE+ GE RLALEDY+   +L P+   A+ KHGLYY   EQWQ A  DF+ +L   P ++ A+ + G  YAKLQQ   A+  FS+ IHL+P N++A++ RG LLR+A+P  A+RD SIS++L    EN M++MYRGILY    +  +AI DFE ++   +D+  AHVNLGL+Y        ++ + ++ +  DPTYIRA  CR +A+  M +Y +A+ DI R IH+ P   ++YM+RG+  L MG ++MAA CVR +A ++H      G SP Q+ALV SFL  +D+AI  L    R +P   +L LLG TQMKAKR+ DA  SF  CLE LKP    K   WP  AA +++L+  C+  L+NY +   +++A + I+   A+ +YH+G CR+ L K  +G+ DLN+ALAINP +YQ YL+RA  +  + +Y+KA+LNCNE L ++P+C+RA LYRG +K +I+AY LA+ D T AI +D  C LA+FNRAVC + E +  + A++DY +VL+++D   L Y+  +NRGL+YL    D +NAL DF+ A   +PND  +L+ +G C+H+L+ L +A+R F+R LD +  F  A + R N ++D+ S  S   A +DY  VL  D  HL A VNL F  Q  G+ + AWD  + AI   P+S +P + RA+V +QMS+L+GAL D NEA+R++P S+   + RGVV Q   D++ AM+DY KA I+      +AY+NA  VY+   Q  QAL  +   +  +P DE    N AL       ++ ++   +R+I LSP+ A+ +FNR  +      +  AE DF + L I PDDP VLK+R DC  K G    A+EDYK +V +
Sbjct:  558 DRIMKEIESYEAWQKRAMEALRQLQADEAEEAAAAAAGVDLNSRRTPQLELVGSRVQFLGQTARRVDMLEPPPPRAQAGPEQVRAALFKQYESALPSDEFGAVGRGFSPVSANAERRQRNGTDFTGTGAAAGAATVGSANGDVVEGIAMTDVVEVEEGAL-TRMRLQNRLSRSIERLNAEYRNEGGVESFFGLR-RSRSLPTVHLDEEDNLVLNLDYNSIEKELQAQTRLMEEEENRVKLNEASQSAEEQQQQSEQGEGVQEGERAGST---AGGEETSAKTDAPRSKVLQQLAIKEPEPTPAQLALAAGRKYVILPRQVQQAQQQQQQLMRQRRGLVSMARIDAIERFLNEPANQLARRESLDSVKKPADWELRVPKRIRSTRRRSLPLNLR---------DDFPAWAAEHGYRGDGDPRDWVPAVWDRWFDEVYPPSSRDGDREVGADAAGGQLQRQPQRQRTDSATSDSAVTDERALLN-DPEFARVRHDSDSSSEAPSEHPVQLPEKIPPALDEIPEADRETAAAILEQEVAKLTADIEAAERLEKLPSAFQLCRRGALRRKLGYLRGAREDLDRCIGQEPRYLDAYWHRHLLKVLENRLSGALDDLNVLLKHTKDNASAYKARAEIYRKKNDVTMAIINYGQAIKLNPSDADCYHKRAGLYEKRGEMRLALEDYSMASKLSPDKTDALFKHGLYYFQNEQWQFAINDFTELLTRDPKDSRAYTYIGRCYAKLQQMIPAVQAFSSAIHLNPYNWIAFYHRGRLLRRAQPDKALRDLSISVMLNEDVENAMAFMYRGILYCEMDRPEDAIPDFETLVRLRQDIPCAHVNLGLVYHHTDRHHLAIHHYSAAINVDPTYIRAVRCRVDAFVAMREYRNALLDITRCIHMNPMDPSYYMVRGEILLKMGNLDMAAFCVRHSAAMNHGRRSAEGASPTQRALVLSFLGQFDEAIRVLAQEARFRPGKDILFLLGKTQMKAKRFADAAGSFQECLEILKPWGGDKKLVWPKEAAQVHYLIGDCHTALQNYGEGLESYTAALAIDSGFADGFYHRGLCRI-LMKQAKGVQDLNQALAINPAMYQVYLSRAAHYACEGRYSKAVLNCNEALRLQPQCVRALLYRGSIKCRIRAYGLAVDDLTRAIAVDPTCALAYFNRAVC-HGESRQPDLALRDYGVVLMLND-RRLRYRTLVNRGLLYLTSCSDPENALGDFLLAARDRPNDERLLHAIGTCYHRLRRLPQAVRAFSRALDANSNFYDAYIGRANCYLDFGSPRSVLFARRDYERVLMSDPRHLAARVNLAFSLQMDGRMRAAWDQLSAAIRFQPDSPKPWECRAVVSLQMSNLDGALADANEAVRLRPSSAESLVTRGVVQQCAGDRVSAMRDYQKA-ILAEPSFSLAYYNAANVYLQQRQYHQALRYYDSCIRLNPADEGAHNNRALTRGLLGDVDGALADASRAIELSPHMAHAFFNRGKLAVRAGNFDSAEADFSAALLIQPDDPVVLKSRADCLGKLGKRQAAIEDYKRAVQL 2064          
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: K1PHE8 (Tetratricopeptide repeat protein 6 OS=Crassostrea gigas OX=29159 GN=CGI_10013650 PE=4 SV=1)

HSP 1 Score: 942.954 bits (2436), Expect = 0.000e+0
Identity = 543/1314 (41.32%), Postives = 805/1314 (61.26%), Query Frame = 2
Query:  497 ETKERLLSRKINSVECLADERIDENKFSKIIHQRKRCTSVPNRHWLEEDSLIVHLEYHQIMDEINIQRQKIRALK--NTSEINEDINEKKPLE---EDEKIFNDNFDSGILTTNVENEYKTHQSVKSIEDDCSSPAKNALRAGQNYIYYXXXXXXXXXXXXXXNIARISDIERFLGQPPNKLDKTKSFENIRIELKRIRSCXXXXXXXXXXXXXXXXADIHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPIPDHIIDLT----SDKP-SETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEK-GDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHN--LGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRL---GKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            ETKE  ++  +  +  + D  I    F   +  R+  +++     L+ D+L+V  +Y+  M+EI+ Q+  +R +K        ++  E+  LE   + EK+  +  ++          YK    +K    D  +PA+ AL+AG+ Y+  P K + KSK K   ++ R+  IE+FL  PP  ++++ S   I   ++R    + R  S +++    SL ++ +F+ ++K +    +   R+W+  +W+ WFD+++PP P    D       D+P S+T  + E   +   S+S+    I D    IEP LD+ ++     L + + EE++ ++  +    +P AF L RRGALYRK+G + AA  D++ AI +EP L+ AYW RHLL+L+ ++ Q A  DL  ILK +  +  AY+S A I     + + AI N S AI+L+P D EAY +RA +YE+  +  LAL+D+    ++ P    A++KH +YY   + W  A +DF+ +LR  P N+ A ++RG A A+  QW  A+ D SA IHLDP ++ A+F R C+LRKA P  A+ D+S+SLL+  +++N+MSY++RGILY +  +F +AI DFE V+  NKD+  AHVNLGLIY     ++ +++K  T+G+  DPTY+RAY CR EAY +++    A+KD  RAIHL PD  ++YM RG   L +G +EMAA CV+ A+E+S N  LG+ P QQA+V SFL++YD+AI+AL  ATR KP   L  LLG TQMKAK +KDAITSF   L+  KP  + +PWP  A+  +FL+  C++ELK Y +++ AF++ VKINPN+A+A Y +G  +++L   G  ++GI D NRALAINPR++QAYL+RA  +G K  YTKAILNCNE   ++PR +RAYLYRG LKY IKAY LAI+D   AI ID+ C LAFFNRAVC+  EKKNY K+++DY IVLL+ D   L  K  INRGL+Y    D  NAL+DF  A  + P +  +L+ +G+C+HK+  LKEA+ VFT CL+ +P F+   ++RGNV+MDY S      A +DY  VL  +  HL A VNL +  Q  GKF  AW  FT AIE +P  +  L+GRA+V +QMS+   A +D+ E+I++ P + +L  NRGV+ Q M+D++ AMKDY  AI +      +AYFNA  VY H    +QAL  +   VE +P DE+  +N A+  +     + ++     +I LSP++A++YFNR N+   ++++ +AE D+   L + PDDP VLK R D   K G    A+EDYK +V I
Sbjct:  890 ETKEAPVTPVLQRMTEMTDNEI----FPVFVPLRRSTSTLGLSKGLD-DTLLVPQDYNAAMEEISTQKSNVRQMKLNKKLLEAKEKEEESRLEWQLQQEKLAEERAET----------YKEEPKMK----DEPTPAELALQAGRAYVILPKKGKKKSKRKAPISMERLEQIEKFLRAPPKPIERSNSMLKIVPPVER----ELRVSSKVRQGSRLSLPNLLDFDSFTKIKKMPNDCVPREWVRDMWNGWFDQVFPPTPSESEDEEPEYQPDEPVSQTREEKEKEKKRKDSLSSY---ISDALSEIEP-LDDSEQNIE--LHQIIHEEIQKLTGQIA-MGKPKAFDLCRRGALYRKVGMIKAAQIDLDLAIKMEPLLLDAYWHRHLLYLLKDQKQQAKADLTFILKYNNKHGGAYRSMAEILRKENNPNDAIINYSMAIKLNPRDHEAYFQRAAMYEKTDKMPLALDDFMMCKKILPTRTDAILKHAMYYFQQKNWNTAIQDFTDLLRVDPLNSMARMYRGRALAEQNQWNAAVEDLSAAIHLDPKSWQAFFYRACILRKAHPKQALHDYSVSLLINDNDDNVMSYLHRGILYNSMNRFEDAIPDFESVLKLNKDIACAHVNLGLIYMNHYENYHRAIKKFTAGIKVDPTYVRAYVCRGEAYHKIHDLRAALKDFTRAIHLRPDVHHYYMYRGQLVLELGNLEMAAFCVKHASEMSSNSSLGEMPTQQAVVQSFLKNYDKAIEALNAATRVKPVPPLFMLLGKTQMKAKVFKDAITSFDRALQLYKPWRR-EPWPMEASECHFLIGMCHIELKGYHEAKDAFTSAVKINPNYAQALYQRGVAKMKLSSRGLSREGIQDFNRALAINPRIFQAYLSRACYYGMKKNYTKAILNCNEATKLQPRSVRAYLYRGALKYHIKAYDLAIRDLDIAIGIDSTCDLAFFNRAVCYQ-EKKNYHKSLKDYGIVLLLGDDNRLRTKVLINRGLLYFSQKDYTNALYDFKMAAKLDPQNYRILHTLGLCYHKMDRLKEAVGVFTSCLERNPFFLDGIIARGNVYMDYGSQGGIIYARRDYERVLMQNPLHLPARVNLAYTLQVSGKFMHAWRQFTAAIEINPRFKPALEGRAVVNLQMSNTFAAFQDICESIKVSPTAELL-TNRGVINQFMKDRVNAMKDYQNAIRMDPTYS-LAYFNAANVYFHTRHFKQALNYYNSAVEHNPQDESALLNRAITKVMLRDSQGALGDFKAAIKLSPHTAHMYFNRGNLYASMEQFDQAEKDYSKALSLKPDDPLVLKRRADVLGKLGKRDEAIEDYKRAVEI 2169          
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: A0A267EN22 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000887g4 PE=4 SV=1)

HSP 1 Score: 942.569 bits (2435), Expect = 0.000e+0
Identity = 558/1528 (36.52%), Postives = 846/1528 (55.37%), Query Frame = 2
Query:  167 ERIISQKNEIEKWRTKANEMLN----------------------LTSEIEIVGTFIS--PSEPKIIDIWQPLAPRLFMSQNQVTNVLCPKYNPNI-----------FEPTIEEVSK-QNTFENF---------------TSEDLTLSNEASFCNEIDLEALETKERLLSRKINSVECLADERIDENKFSKIIHQRKRCTSVPNRHWLEEDSLIVHLEYHQIMDEINIQRQKIRALKNTSEINEDINEKKP------------LEEDEKIFNDNFDSGILTTNVENEYKTHQSVK--SIEDDCSSPAKNALRAGQNYIYYXXXXXXXXXXXXXX-------NIARISDIERFLGQPPNKLDKTKSFENIRI----EL---KRIRSCXXXXXXXXXXXXXXXXADIHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPI---------PDHIIDLTSDKP---------SETPYKNE--LLNREP----------TSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQR----PNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNL----GQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKP--WPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYL-ELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +RI+ +    E W+ +A E L                        T ++E+VG+ +       + +D+ +P  PR      QV   L  +Y   +           F P      + Q    +F                + D+      +   E++  AL T+ RL +R   S+E L  E  +E         R R +S+P  H  EED+L+++L+Y+ I  E+  Q + +   +N  ++NE     +             ++E E+  +    +G   T+ + +    + ++  +I++   +PA+ AL AG+ Y+  P + +   + ++         ++ARI  IERFL +P N+L + +S ++++     EL   KRIRS + R      +          +F  W+   GY+ + + RDW+  +WD WFDE+YPP           D     +  +P         S++   +E  LLN +P          +S  A     + LPE I P LDE+ E  R      L +EV  ++ D+E  +R    P+AF L RRGAL RK+GYL  A +D++  I  EP  + AYW RHLL ++ N++  A++DLN++LK  K+   AYK+RA IY    D+++AI N  QAI+L+P D++ Y KRA LYE+ GE RLALEDY+   +L P+   A+ KHGLYY   EQWQ A  DF+ +L   P ++ A+ + G  YAKLQQ   A+  FS+ IHL+P N++A++ RG LLR+A+P  A+RD SIS++L    EN M++MYRGILY    +  +AI DFE ++   +D+  AHVNLGL+Y        ++ + ++ +  DPTYIRA  CR +A+  M +Y +A+ DI R IH+ P   ++YM+RG+  L MG ++MAA CVR +A ++H      G SP Q+ALV SFL  +D+AI  L    R +P   +L LLG TQMKAKR+ DA  SF  CLE LKP    K   WP  AA +++L+  C+  L+NY +   +++A + I+   A+ +YH+G CR+ L K  +G+ DLN+ALAINP +YQ YL+RA  +  + +Y+KA+LNCNE L ++P+C+RA LYRG +K +I+AY LA+ D T AI +D  C LA+FNRAVC + E +  + A++DY +VL+++D   L Y+  +NRGL+YL    D +NAL DF+ A   +PND  +L+ +G C+H+L+ L +A+R F+R LD +  F  A + R N ++D+ S  S   A +DY  VL  D  HL A VNL F  Q  G+ + AWD  + AI   P+S +P + RA+V +QMS+L+GAL D NEA+R++P S+   + RGVV Q   D++ AM+DY KA I+      +AY+NA  VY+   Q  QAL  +   +  +P DE    N AL       ++ ++   +R+I LSP+ A+ +FNR  +      +  AE DF + L I PDDP VLK+R DC  K G    A+EDYK +V +
Sbjct:  556 DRIMKEIESYEAWQKRAMEALRQLQADEAEEAAAAAAGVDLNSRRTPQLELVGSRVQFLGQTARRVDMLEPPPPRAQAGPEQVRAALFKQYESALPSDEFGAVGRGFSPVSANAERRQRNGTDFTGTGAAAAGAATVGSANGDVVEGIAMTDVVEVEEGAL-TRMRLQNRLSRSIERLNAEYRNEGGVESFFGLR-RSSSLPTVHLDEEDNLVLNLDYNSIEKELQAQTRLMVEEENRVKLNEASQSAEEQQQQQQSEQGEGVQEGERAGST---AGGEETSAKTDAPRSKVLQQLAIKEPEPTPAQLALAAGRKYVILPRQVQQAQQQQQLMRQRRGLVSMARIDAIERFLNEPANQLARRESLDSVKKPADWELRVPKRIRSTRRRSLPLNLR---------DDFPAWAAEHGYRGDGDPRDWVPAVWDLWFDEVYPPSSRDGDREVGADAAGGQSQRQPQRQWTDSATSDSAVTDERALLN-DPEFARVRHDSDSSSEAPSEHPVQLPEKIPPALDEIPEADRETAAAILEQEVAKLTADIEAAERLEKLPSAFQLCRRGALRRKLGYLRGAREDLDRCIGQEPRYLDAYWHRHLLKVLENRLSGALDDLNVLLKHTKDNASAYKARAEIYRKKNDVTMAIINYGQAIKLNPSDADCYHKRAGLYEKRGEMRLALEDYSMASKLSPDKTDALFKHGLYYFQNEQWQFAINDFTELLTRDPKDSRAYTYIGRCYAKLQQMIPAVQAFSSAIHLNPYNWIAFYHRGRLLRRAQPDKALRDLSISVMLNEDVENAMAFMYRGILYCEMDRPEDAIPDFETLVRLRQDIPCAHVNLGLVYHHTDRHHLAIHHYSAAINVDPTYIRAVRCRVDAFVAMREYRNALLDITRCIHMNPMDPSYYMVRGEILLKMGNLDMAAFCVRHSAAMNHGRRSAEGASPTQRALVLSFLGQFDEAIRVLAEEARFRPGKDILFLLGKTQMKAKRFADAAGSFQECLEILKPWGGDKKLVWPKEAAQVHYLIGDCHTALQNYGEGLESYTAALAIDSGFADGFYHRGLCRI-LMKQAKGVQDLNQALAINPAMYQVYLSRAAHYACEGRYSKAVLNCNEALRLQPQCVRALLYRGSIKCRIRAYGLAVDDLTRAIAVDPTCALAYFNRAVC-HGESRQPDLALRDYGVVLMLND-RRLRYRTLVNRGLLYLTSCSDPENALGDFLLAARDRPNDERLLHAIGTCYHRLRRLPQAVRAFSRALDANSNFYDAYIGRANCYLDFGSPRSVLFARRDYERVLMSDPRHLAARVNLAFSLQMDGRMRAAWDQLSAAIRFQPDSPKPWECRAVVSLQMSNLDGALADANEAVRLRPSSAESLVTRGVVQQCAGDRVSAMRDYQKA-ILAEPSFSLAYYNAANVYLQQRQYHQALRYYDSCIRLNPADEGAHNNRALTRGLLGDVDGALADASRAIELSPHMAHAFFNRGKLAVRAGNFDSAEADFSAALLIQPDDPVVLKSRADCLGKLGKRQAAIEDYKRAVQL 2064          
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Match: A0A267F2Y6 (TPR_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000887g3 PE=4 SV=1)

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 557/1527 (36.48%), Postives = 842/1527 (55.14%), Query Frame = 2
Query:  167 ERIISQKNEIEKWRTKANEMLN----------------------LTSEIEIVGTFIS--PSEPKIIDIWQPLAPRLFMSQNQVTNVLCPKYNPNI-----------FEPTIEEVSK-QNTFENF--------------TSEDLTLSNEASFCNEIDLEALETKERLLSRKINSVECLADERIDENKFSKIIHQRKRCTSVPNRHWLEEDSLIVHLEYHQIMDEINIQRQKIRALKNTSEINEDINEKKP------------LEEDEKIFNDNFDSGILTTNVENEYKTHQSVK--SIEDDCSSPAKNALRAGQNYIYYXXXXXXXXXXXXXX-------NIARISDIERFLGQPPNKLDKTKSFENIRI----EL---KRIRSCXXXXXXXXXXXXXXXXADIHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPIP---DHIID---------------LTSDKPSETPYKNE--LLNREP----------TSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQR----PNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNL----GQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKP--WPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYL-ELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +RI+ +    E W+ +A E L                        T ++E+VG+ +       + +D+ +P  PR      QV   L  +Y   +           F P      + Q    +F               + D+      +   E++  AL T+ RL +R   S+E L  E  +E         R R  S+P  H  EED+L+++L+Y+ I  E+  Q + +   +N  ++NE     +             ++E E+  +    +G   T+ + +    + ++  +I++   +PA+ AL AG+ Y+  P + +   + ++         ++ARI  IERFL +P N+L + +S ++++     EL   KRIRS + R      +          +F  W+   GY+ + + RDW+  +WD WFDE+YPP     D  +                 T    S++   +E  LLN +P          +S  A     + LPE I P LDE+ E  R      L +EV  ++ D+E  +R    P+AF L RRGAL RK+GYL  A +D++  I  EP  + AYW RHLL ++ N++  A++DLN++LK  K+   AYK+RA IY    D+++AI N  QAI+L+P D++ Y KRA LYE+ GE RLALEDY+   +L P+   A+ KHGLYY   EQWQ A  DF+ +L   P ++ A+ + G  YAKLQQ   A+  FS+ IHL+P N++A++ RG LLR+A+P  A+RD SIS++L    EN M++MYRGILY    +  +AI DFE ++   +D+  AHVNLGL+Y        ++ + ++ +  DPTYIRA  CR +A+  M +Y +A+ DI R IH+ P   ++YM+RG+  L MG ++MAA CVR +A ++H      G SP Q+ALV SFL  +D+AI  L    R +P   +L LLG TQMKAKR+ DA  SF  CLE LKP    K   WP  AA +++L+  C+  L+NY +   +++A + I+   A+ +YH+G CR+ L K  +G+ DLN+ALAINP +YQ YL+RA  +  + +Y+KA+LNCNE L ++P+C+RA LYRG +K +I+AY LA+ D T AI +D  C LA+FNRAVC + E +  + A++DY +VL+++D   L Y+  +NRGL+YL    D +NAL DF+ A   +PND  +L+ +G C+H+L+ L +A+R F+R LD +  F  A + R N ++D+ S  S   A +DY  VL  D  HL A VNL F  Q  G+ + AWD  + AI   P+S +P + RA+V +QMS+L+GAL D NEA+R++P S+     RGVV Q   D++ AM+DY KA I+      +AY+NA  VY+   Q  QAL  +   +  +P DE    N AL       ++ ++   +R+I LSP+  + +FNR  +      +  AE DF + L I PDDP VLK+R DC  K G    A+EDYK +V +
Sbjct:  556 DRIMKEIESYEAWQKRAMEALRQLQADEAEEAAAAAAGVDLNSRRTPQLELVGSRVQFLGQTARRVDMLEPPPPRAQAGPEQVRAALFKQYESALPSDEFGAVGRGFSPVSANAERRQRNGTDFTGTGAAAGAAMVGSANGDVVEGIAMTDVVEVEEGAL-TRMRLQNRLSRSIERLNAEYRNEGGVESFFGLR-RSRSLPTVHLDEEDNLVLNLDYNSIEKELQAQTRLMVEEENRVKLNEASQSAEEQQQQQQSEQGEGVQEGERAGST---AGGEETSAKTDAPRSKVLQQLAIKEPEPTPAQLALAAGRKYVILPRQVQQAQQQQQLMRQRRGLVSMARIDAIERFLNEPANQLARRESLDSVKKPADWELRVPKRIRSTRRRSLPLNLR---------DDFPAWAAEHGYRGDGDPRDWVPAVWDLWFDEVYPPSSRDGDREVGADAAGGQSQRQPQRQRTDSATSDSAVTDERALLN-DPEFARVRHDSDSSSEAPSEHPVQLPEKIPPALDEIPEADRETAAAILEQEVAKLTADIEAAERLEKLPSAFQLCRRGALRRKLGYLRGAREDLDRCIGQEPRYLDAYWHRHLLKVLENRLSGALDDLNVLLKHTKDNASAYKARAEIYRKKNDVTMAIINYGQAIKLNPSDADCYHKRAGLYEKRGEMRLALEDYSMASKLSPDKTDALFKHGLYYFQNEQWQFAINDFTELLTRDPKDSRAYTYIGRCYAKLQQMIPAVQAFSSAIHLNPYNWIAFYHRGRLLRRAQPDKALRDLSISVMLNEDVENAMAFMYRGILYCEMDRPEDAIPDFETLVRLRQDIPCAHVNLGLVYHHTDRHHLAIHHYSAAINVDPTYIRAVRCRVDAFVAMREYRNALLDITRCIHMNPMDPSYYMVRGEILLKMGNLDMAAFCVRHSAAMNHGRRSAEGASPTQRALVLSFLGQFDEAIRVLAEEARFRPGKDILFLLGKTQMKAKRFADAAGSFQECLEILKPWGGDKKLVWPKEAAQVHYLIGDCHTALQNYGEGLESYTAALAIDSGFADGFYHRGLCRI-LMKQAKGVQDLNQALAINPAMYQVYLSRAAHYACEGRYSKAVLNCNEALRLQPQCVRALLYRGSIKCRIRAYGLAVDDLTRAIAVDPTCALAYFNRAVC-HGESRQPDLALRDYGVVLMLNDR-RLRYRTLVNRGLLYLTSCSDPENALGDFLLAARDRPNDERLLHAIGTCYHRLRRLPQAVRAFSRALDANSNFYDAYIGRANCYLDFGSPRSVLFARRDYERVLMSDPRHLAARVNLAFSLQMDGRMRAAWDQLSAAIRFQPDSPKPWECRAVVSLQMSNLDGALADANEAVRLRPSSAESLATRGVVQQCAGDRVSAMRDYQKA-ILAEPSFSLAYYNAANVYLQQRQYHQALRYYDSCIRLNPADEGAHNNRALTRGLLGDVDGALADASRAIELSPHMVHAFFNRGKLAVRAGNFDSAEADFSAALLIQPDDPVVLKSRADCLGKLGKRQAAIEDYKRAVQL 2063          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Cavefish
Match: ttc6 (tetratricopeptide repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-090429-2])

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 427/1070 (39.91%), Postives = 644/1070 (60.19%), Query Frame = 2
Query: 1196 RDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVD--EEF-RGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEK-GDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL---ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            ++W+  IW+ WFDE++PP  DH         S T  + E    +P S     N+ L   + I P+LD+VD  E    G   E L  EV  +++ M      N F L RRGALY+K+G L  A  D+N AIS+EP L+ AYW RH + L+ N    A++DLN I+K +K +  A++SRA IY   G+  LAI + +Q I+  PDD+E Y +RA+LYE+  E  LA+EDY +   +      A+M H L++ +   W++A  DFS +L+  P+N  A  +RG  +AKL  +++A+ DF   +HLDP ++LA++ RGCLLR+  P +A+RD S+S+L+  S EN+ +++YRG+LY   +Q+ +A+ DF+ VI  ++ +  AH+NLGLIY  K    +K+++  ++ + ADPT I+ Y CRA AY  +N  + A+KD+ RA+HL PD    +++RG     M +  +A  C++ +AE+   LG + VQQA V SFLQ+  +AI  L+ A    PS ++L LLG TQ+K  ++ +A+ SF   L  L PK       P A  L +L   CY+   E     ++  AFS   +INP++AEAY+ +G CR+RL +    + D NRAL INP  YQAYL+RA L+G K  Y KAI NC+E L I+P+ ++AYLY+G LK+ +K Y  A++D T AI+ID++C LA++NR VC+   ++ Y+ A++DYS VLL+ +   + +K  INR LV+ EL D  NAL D   A + QP D  + + +G+  H+L  L+EA+  ++  L   P  + A V RGN FMDY  S     A +D+ S L ++     A + L +  Q  G F++ W+ FT+A+E +P      +GRAIV +QM +   A +D+N A++  P S  L  NRGV+ Q M DK+ AM DY +AI +    C +A+FNA  +Y +N Q EQA E + + +E DP DE+  +N A+      K+ ES++  + ++ L P SA++YFNRAN+   L++Y+ AE +F   L++ PDD  + K R D R   G    A++DY+T+V
Sbjct:  655 QEWVGDIWNTWFDEVFPP-QDH---------SSTKSEPEARQMQPVS-----NKQLKKKKEI-PILDKVDLSEALDEGFTVEDLEMEVAKLTESMIKNTGNNGFDLCRRGALYKKLGLLKQALDDLNAAISLEPHLLDAYWHRHSISLLRNAPNSALDDLNFIIKHNKKHADAFRSRAEIYRMRGETRLAILDYTQVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLLRRILPDVALRDLSVSVLINGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRIRL-QHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEIDSSCSLAYYNRGVCYQVLQE-YKLALRDYSTVLLLPEQKEIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSARIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAIVNLQMGNTYAAFQDINNALKCNPHSDQLLTNRGVINQFMGDKVSAMSDYQRAISLNP-TCALAFFNAANLYFYNRQFEQACEYYSRAIELDPSDESPVLNRAISLALLQKIPESLQDFSEALRLCPYSAHIYFNRANLYHSLRKYKAAEREFTQALQLQPDDALLYKLRADVRGHLGLMEEAVKDYRTAV 1705          

HSP 2 Score: 141.739 bits (356), Expect = 2.659e-33
Identity = 195/904 (21.57%), Postives = 363/904 (40.15%), Query Frame = 2
Query: 1448 VKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDD--------------------------------SE---AYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGL-YYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRG-CL------------------LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRG---------ILYATTK----QFSEAIVDFEVVICF----NKDMCFA------HVNLGLIYFEKGD---FEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNL-LGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL--ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLF---GFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIK---DFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLI---SDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQ 3880
            +KN   D ENY         RR  LY K   +  A +D     +I  +   A     L H   +  ++A++D +L+LK++     A   R   +A  G    AI +   A+ L P D                                SE   A+  R  LY +  + + A+ D+  +I++      A +  GL Y L + Q Q A + FS+ ++  P+N + ++ R  AY  +   + AL D +  +HL P++   +  RG CL                  ++KA     ++  ++   L++  + I   +            IL   T+    +F EA+  F+  + F      ++C        +   G+ Y  +G+     ++++  +     +P Y  AY  R     ++ ++ ++++D NRA+ + P+    Y+ R   Y A G    A     +A +I     ++ + +  +  +L+ Y +A++ L VA     S +L     G      + +K A+  ++  L  L P+ +             L+ R  +  EL ++  +     A     P  A  ++  G    RLG++++ +   + AL ++P L  AY+ R   F   G    Y +A  +    L + PRC  A   R  L Y ++ +    +    FT A++++  C  A+  RA+  N +  N   A QD +  L     SD L        NRG++   +GD  +A+ D+ RA ++ P      +     +   +  ++A   ++R ++ DP      ++R  + +         L  +D++  L +  Y      N      +  K+K A   FT A++  P+       RA V   +  +  A+KD   A+ +Q
Sbjct:  836 IKNKPDDAENY--------FRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLLRRILPDVALRDLSVSVLINGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRIRL-QHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEIDSSCSLAYYNRGVCYQVLQEYKLALRDYSTVL--LLPEQK-------EIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSA---RIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAI-VNLQMGNTYAAFQDINNALKCNPHSDQL------LTNRGVINQFMGDKVSAMSDYQRAISLNPTCALAFFNAANLYFYNRQFEQACEYYSRAIELDPSDESPVLNRA-ISLALLQKIPESL--QDFSEALRLCPYSAHIYFNRANLYHSLRKYKAAEREFTQALQLQPDDALLYKLRADVRGHLGLMEEAVKDYRTAVELQ 1708          

HSP 3 Score: 96.6709 bits (239), Expect = 1.684e-19
Identity = 124/515 (24.08%), Postives = 221/515 (42.91%), Query Frame = 2
Query: 2912 LAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFI------RAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEI---DSY-HL---DALVNL------GFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQ---LEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            L ++  +K  P+ AE Y+ +     +  ++   + D  +  AIN     A +A A      + +  A+ + + +L  EP   RA  YRG    K+  +  AI+DF  A+ +D    LAF++R       +   + A++D S+ +LI+ +   +  A++ RGL+Y E    Q A+ DF       R  A    +L ++Y++     K+   ++AIR F+  +  DP  I   V R      Y++ N    A KD    L +   D Y H+     L N+       FC Q   + KKA  + T+  +    S    D +AI C+    ++ A    + +I I    + L +++ +       K ++  +  K  I    + P  Y+  G  Y+   +   L QALE F K    +P     +    L  I + +   S++  NR++ ++PN    Y +RA +      Y +A  +    L+I P +      +G  +    +   A+ED   ++ I
Sbjct:  830 LDYTQVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLL--RRILPDVALRDLSVSVLINGSSE-NLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYML-----KMNQSQKAIRRFSNAIKADPTNIKGYVCRARA---YHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGL-TLVQQAAVQSFLQNDAKAIACL----VSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRI-RLQHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEI 1327          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Cavefish
Match: ttc6 (tetratricopeptide repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-090429-2])

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 427/1070 (39.91%), Postives = 644/1070 (60.19%), Query Frame = 2
Query: 1196 RDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVD--EEF-RGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEK-GDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL---ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            ++W+  IW+ WFDE++PP  DH         S T  + E    +P S     N+ L   + I P+LD+VD  E    G   E L  EV  +++ M      N F L RRGALY+K+G L  A  D+N AIS+EP L+ AYW RH + L+ N    A++DLN I+K +K +  A++SRA IY   G+  LAI + +Q I+  PDD+E Y +RA+LYE+  E  LA+EDY +   +      A+M H L++ +   W++A  DFS +L+  P+N  A  +RG  +AKL  +++A+ DF   +HLDP ++LA++ RGCLLR+  P +A+RD S+S+L+  S EN+ +++YRG+LY   +Q+ +A+ DF+ VI  ++ +  AH+NLGLIY  K    +K+++  ++ + ADPT I+ Y CRA AY  +N  + A+KD+ RA+HL PD    +++RG     M +  +A  C++ +AE+   LG + VQQA V SFLQ+  +AI  L+ A    PS ++L LLG TQ+K  ++ +A+ SF   L  L PK       P A  L +L   CY+   E     ++  AFS   +INP++AEAY+ +G CR+RL +    + D NRAL INP  YQAYL+RA L+G K  Y KAI NC+E L I+P+ ++AYLY+G LK+ +K Y  A++D T AI+ID++C LA++NR VC+   ++ Y+ A++DYS VLL+ +   + +K  INR LV+ EL D  NAL D   A + QP D  + + +G+  H+L  L+EA+  ++  L   P  + A V RGN FMDY  S     A +D+ S L ++     A + L +  Q  G F++ W+ FT+A+E +P      +GRAIV +QM +   A +D+N A++  P S  L  NRGV+ Q M DK+ AM DY +AI +    C +A+FNA  +Y +N Q EQA E + + +E DP DE+  +N A+      K+ ES++  + ++ L P SA++YFNRAN+   L++Y+ AE +F   L++ PDD  + K R D R   G    A++DY+T+V
Sbjct:  690 QEWVGDIWNTWFDEVFPP-QDH---------SSTKSEPEARQMQPVS-----NKQLKKKKEI-PILDKVDLSEALDEGFTVEDLEMEVAKLTESMIKNTGNNGFDLCRRGALYKKLGLLKQALDDLNAAISLEPHLLDAYWHRHSISLLRNAPNSALDDLNFIIKHNKKHADAFRSRAEIYRMRGETRLAILDYTQVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLLRRILPDVALRDLSVSVLINGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRIRL-QHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEIDSSCSLAYYNRGVCYQVLQE-YKLALRDYSTVLLLPEQKEIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSARIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAIVNLQMGNTYAAFQDINNALKCNPHSDQLLTNRGVINQFMGDKVSAMSDYQRAISLNP-TCALAFFNAANLYFYNRQFEQACEYYSRAIELDPSDESPVLNRAISLALLQKIPESLQDFSEALRLCPYSAHIYFNRANLYHSLRKYKAAEREFTQALQLQPDDALLYKLRADVRGHLGLMEEAVKDYRTAV 1740          

HSP 2 Score: 141.354 bits (355), Expect = 3.979e-33
Identity = 195/904 (21.57%), Postives = 363/904 (40.15%), Query Frame = 2
Query: 1448 VKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDD--------------------------------SE---AYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGL-YYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRG-CL------------------LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRG---------ILYATTK----QFSEAIVDFEVVICF----NKDMCFA------HVNLGLIYFEKGD---FEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNL-LGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL--ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLF---GFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIK---DFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLI---SDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQ 3880
            +KN   D ENY         RR  LY K   +  A +D     +I  +   A     L H   +  ++A++D +L+LK++     A   R   +A  G    AI +   A+ L P D                                SE   A+  R  LY +  + + A+ D+  +I++      A +  GL Y L + Q Q A + FS+ ++  P+N + ++ R  AY  +   + AL D +  +HL P++   +  RG CL                  ++KA     ++  ++   L++  + I   +            IL   T+    +F EA+  F+  + F      ++C        +   G+ Y  +G+     ++++  +     +P Y  AY  R     ++ ++ ++++D NRA+ + P+    Y+ R   Y A G    A     +A +I     ++ + +  +  +L+ Y +A++ L VA     S +L     G      + +K A+  ++  L  L P+ +             L+ R  +  EL ++  +     A     P  A  ++  G    RLG++++ +   + AL ++P L  AY+ R   F   G    Y +A  +    L + PRC  A   R  L Y ++ +    +    FT A++++  C  A+  RA+  N +  N   A QD +  L     SD L        NRG++   +GD  +A+ D+ RA ++ P      +     +   +  ++A   ++R ++ DP      ++R  + +         L  +D++  L +  Y      N      +  K+K A   FT A++  P+       RA V   +  +  A+KD   A+ +Q
Sbjct:  871 IKNKPDDAENY--------FRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLLRRILPDVALRDLSVSVLINGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRIRL-QHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEIDSSCSLAYYNRGVCYQVLQEYKLALRDYSTVL--LLPEQK-------EIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSA---RIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAI-VNLQMGNTYAAFQDINNALKCNPHSDQL------LTNRGVINQFMGDKVSAMSDYQRAISLNPTCALAFFNAANLYFYNRQFEQACEYYSRAIELDPSDESPVLNRA-ISLALLQKIPESL--QDFSEALRLCPYSAHIYFNRANLYHSLRKYKAAEREFTQALQLQPDDALLYKLRADVRGHLGLMEEAVKDYRTAVELQ 1743          

HSP 3 Score: 96.6709 bits (239), Expect = 1.871e-19
Identity = 124/515 (24.08%), Postives = 221/515 (42.91%), Query Frame = 2
Query: 2912 LAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFI------RAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEI---DSY-HL---DALVNL------GFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQ---LEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            L ++  +K  P+ AE Y+ +     +  ++   + D  +  AIN     A +A A      + +  A+ + + +L  EP   RA  YRG    K+  +  AI+DF  A+ +D    LAF++R       +   + A++D S+ +LI+ +   +  A++ RGL+Y E    Q A+ DF       R  A    +L ++Y++     K+   ++AIR F+  +  DP  I   V R      Y++ N    A KD    L +   D Y H+     L N+       FC Q   + KKA  + T+  +    S    D +AI C+    ++ A    + +I I    + L +++ +       K ++  +  K  I    + P  Y+  G  Y+   +   L QALE F K    +P     +    L  I + +   S++  NR++ ++PN    Y +RA +      Y +A  +    L+I P +      +G  +    +   A+ED   ++ I
Sbjct:  865 LDYTQVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLL--RRILPDVALRDLSVSVLINGSSE-NLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYML-----KMNQSQKAIRRFSNAIKADPTNIKGYVCRARA---YHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGL-TLVQQAAVQSFLQNDAKAIACL----VSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRI-RLQHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEI 1362          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Cavefish
Match: ttc6 (tetratricopeptide repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-090429-2])

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 427/1070 (39.91%), Postives = 644/1070 (60.19%), Query Frame = 2
Query: 1196 RDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVD--EEF-RGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEK-GDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL---ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            ++W+  IW+ WFDE++PP  DH         S T  + E    +P S     N+ L   + I P+LD+VD  E    G   E L  EV  +++ M      N F L RRGALY+K+G L  A  D+N AIS+EP L+ AYW RH + L+ N    A++DLN I+K +K +  A++SRA IY   G+  LAI + +Q I+  PDD+E Y +RA+LYE+  E  LA+EDY +   +      A+M H L++ +   W++A  DFS +L+  P+N  A  +RG  +AKL  +++A+ DF   +HLDP ++LA++ RGCLLR+  P +A+RD S+S+L+  S EN+ +++YRG+LY   +Q+ +A+ DF+ VI  ++ +  AH+NLGLIY  K    +K+++  ++ + ADPT I+ Y CRA AY  +N  + A+KD+ RA+HL PD    +++RG     M +  +A  C++ +AE+   LG + VQQA V SFLQ+  +AI  L+ A    PS ++L LLG TQ+K  ++ +A+ SF   L  L PK       P A  L +L   CY+   E     ++  AFS   +INP++AEAY+ +G CR+RL +    + D NRAL INP  YQAYL+RA L+G K  Y KAI NC+E L I+P+ ++AYLY+G LK+ +K Y  A++D T AI+ID++C LA++NR VC+   ++ Y+ A++DYS VLL+ +   + +K  INR LV+ EL D  NAL D   A + QP D  + + +G+  H+L  L+EA+  ++  L   P  + A V RGN FMDY  S     A +D+ S L ++     A + L +  Q  G F++ W+ FT+A+E +P      +GRAIV +QM +   A +D+N A++  P S  L  NRGV+ Q M DK+ AM DY +AI +    C +A+FNA  +Y +N Q EQA E + + +E DP DE+  +N A+      K+ ES++  + ++ L P SA++YFNRAN+   L++Y+ AE +F   L++ PDD  + K R D R   G    A++DY+T+V
Sbjct:  656 QEWVGDIWNTWFDEVFPP-QDH---------SSTKSEPEARQMQPVS-----NKQLKKKKEI-PILDKVDLSEALDEGFTVEDLEMEVAKLTESMIKNTGNNGFDLCRRGALYKKLGLLKQALDDLNAAISLEPHLLDAYWHRHSISLLRNAPNSALDDLNFIIKHNKKHADAFRSRAEIYRMRGETRLAILDYTQVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLLRRILPDVALRDLSVSVLINGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRIRL-QHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEIDSSCSLAYYNRGVCYQVLQE-YKLALRDYSTVLLLPEQKEIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSARIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAIVNLQMGNTYAAFQDINNALKCNPHSDQLLTNRGVINQFMGDKVSAMSDYQRAISLNP-TCALAFFNAANLYFYNRQFEQACEYYSRAIELDPSDESPVLNRAISLALLQKIPESLQDFSEALRLCPYSAHIYFNRANLYHSLRKYKAAEREFTQALQLQPDDALLYKLRADVRGHLGLMEEAVKDYRTAV 1706          

HSP 2 Score: 142.124 bits (357), Expect = 2.403e-33
Identity = 195/904 (21.57%), Postives = 363/904 (40.15%), Query Frame = 2
Query: 1448 VKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDD--------------------------------SE---AYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGL-YYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRG-CL------------------LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRG---------ILYATTK----QFSEAIVDFEVVICF----NKDMCFA------HVNLGLIYFEKGD---FEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNL-LGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL--ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLF---GFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIK---DFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLI---SDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQ 3880
            +KN   D ENY         RR  LY K   +  A +D     +I  +   A     L H   +  ++A++D +L+LK++     A   R   +A  G    AI +   A+ L P D                                SE   A+  R  LY +  + + A+ D+  +I++      A +  GL Y L + Q Q A + FS+ ++  P+N + ++ R  AY  +   + AL D +  +HL P++   +  RG CL                  ++KA     ++  ++   L++  + I   +            IL   T+    +F EA+  F+  + F      ++C        +   G+ Y  +G+     ++++  +     +P Y  AY  R     ++ ++ ++++D NRA+ + P+    Y+ R   Y A G    A     +A +I     ++ + +  +  +L+ Y +A++ L VA     S +L     G      + +K A+  ++  L  L P+ +             L+ R  +  EL ++  +     A     P  A  ++  G    RLG++++ +   + AL ++P L  AY+ R   F   G    Y +A  +    L + PRC  A   R  L Y ++ +    +    FT A++++  C  A+  RA+  N +  N   A QD +  L     SD L        NRG++   +GD  +A+ D+ RA ++ P      +     +   +  ++A   ++R ++ DP      ++R  + +         L  +D++  L +  Y      N      +  K+K A   FT A++  P+       RA V   +  +  A+KD   A+ +Q
Sbjct:  837 IKNKPDDAENY--------FRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLLRRILPDVALRDLSVSVLINGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRIRL-QHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEIDSSCSLAYYNRGVCYQVLQEYKLALRDYSTVL--LLPEQK-------EIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSA---RIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAI-VNLQMGNTYAAFQDINNALKCNPHSDQL------LTNRGVINQFMGDKVSAMSDYQRAISLNPTCALAFFNAANLYFYNRQFEQACEYYSRAIELDPSDESPVLNRA-ISLALLQKIPESL--QDFSEALRLCPYSAHIYFNRANLYHSLRKYKAAEREFTQALQLQPDDALLYKLRADVRGHLGLMEEAVKDYRTAVELQ 1709          

HSP 3 Score: 96.6709 bits (239), Expect = 1.459e-19
Identity = 124/515 (24.08%), Postives = 221/515 (42.91%), Query Frame = 2
Query: 2912 LAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFI------RAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEI---DSY-HL---DALVNL------GFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQ---LEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            L ++  +K  P+ AE Y+ +     +  ++   + D  +  AIN     A +A A      + +  A+ + + +L  EP   RA  YRG    K+  +  AI+DF  A+ +D    LAF++R       +   + A++D S+ +LI+ +   +  A++ RGL+Y E    Q A+ DF       R  A    +L ++Y++     K+   ++AIR F+  +  DP  I   V R      Y++ N    A KD    L +   D Y H+     L N+       FC Q   + KKA  + T+  +    S    D +AI C+    ++ A    + +I I    + L +++ +       K ++  +  K  I    + P  Y+  G  Y+   +   L QALE F K    +P     +    L  I + +   S++  NR++ ++PN    Y +RA +      Y +A  +    L+I P +      +G  +    +   A+ED   ++ I
Sbjct:  831 LDYTQVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLL--RRILPDVALRDLSVSVLINGSSE-NLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYML-----KMNQSQKAIRRFSNAIKADPTNIKGYVCRARA---YHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGL-TLVQQAAVQSFLQNDAKAIACL----VSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRI-RLQHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEI 1328          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Cavefish
Match: ttc6 (tetratricopeptide repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-090429-2])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 427/1070 (39.91%), Postives = 644/1070 (60.19%), Query Frame = 2
Query: 1196 RDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVD--EEF-RGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEK-GDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL---ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            ++W+  IW+ WFDE++PP  DH         S T  + E    +P S     N+ L   + I P+LD+VD  E    G   E L  EV  +++ M      N F L RRGALY+K+G L  A  D+N AIS+EP L+ AYW RH + L+ N    A++DLN I+K +K +  A++SRA IY   G+  LAI + +Q I+  PDD+E Y +RA+LYE+  E  LA+EDY +   +      A+M H L++ +   W++A  DFS +L+  P+N  A  +RG  +AKL  +++A+ DF   +HLDP ++LA++ RGCLLR+  P +A+RD S+S+L+  S EN+ +++YRG+LY   +Q+ +A+ DF+ VI  ++ +  AH+NLGLIY  K    +K+++  ++ + ADPT I+ Y CRA AY  +N  + A+KD+ RA+HL PD    +++RG     M +  +A  C++ +AE+   LG + VQQA V SFLQ+  +AI  L+ A    PS ++L LLG TQ+K  ++ +A+ SF   L  L PK       P A  L +L   CY+   E     ++  AFS   +INP++AEAY+ +G CR+RL +    + D NRAL INP  YQAYL+RA L+G K  Y KAI NC+E L I+P+ ++AYLY+G LK+ +K Y  A++D T AI+ID++C LA++NR VC+   ++ Y+ A++DYS VLL+ +   + +K  INR LV+ EL D  NAL D   A + QP D  + + +G+  H+L  L+EA+  ++  L   P  + A V RGN FMDY  S     A +D+ S L ++     A + L +  Q  G F++ W+ FT+A+E +P      +GRAIV +QM +   A +D+N A++  P S  L  NRGV+ Q M DK+ AM DY +AI +    C +A+FNA  +Y +N Q EQA E + + +E DP DE+  +N A+      K+ ES++  + ++ L P SA++YFNRAN+   L++Y+ AE +F   L++ PDD  + K R D R   G    A++DY+T+V
Sbjct:  690 QEWVGDIWNTWFDEVFPP-QDH---------SSTKSEPEARQMQPVS-----NKQLKKKKEI-PILDKVDLSEALDEGFTVEDLEMEVAKLTESMIKNTGNNGFDLCRRGALYKKLGLLKQALDDLNAAISLEPHLLDAYWHRHSISLLRNAPNSALDDLNFIIKHNKKHADAFRSRAEIYRMRGETRLAILDYTQVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLLRRILPDVALRDLSVSVLINGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRIRL-QHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEIDSSCSLAYYNRGVCYQVLQE-YKLALRDYSTVLLLPEQKEIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSARIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAIVNLQMGNTYAAFQDINNALKCNPHSDQLLTNRGVINQFMGDKVSAMSDYQRAISLNP-TCALAFFNAANLYFYNRQFEQACEYYSRAIELDPSDESPVLNRAISLALLQKIPESLQDFSEALRLCPYSAHIYFNRANLYHSLRKYKAAEREFTQALQLQPDDALLYKLRADVRGHLGLMEEAVKDYRTAV 1740          

HSP 2 Score: 142.124 bits (357), Expect = 2.349e-33
Identity = 195/904 (21.57%), Postives = 363/904 (40.15%), Query Frame = 2
Query: 1448 VKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDD--------------------------------SE---AYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGL-YYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRG-CL------------------LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRG---------ILYATTK----QFSEAIVDFEVVICF----NKDMCFA------HVNLGLIYFEKGD---FEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNL-LGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL--ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLF---GFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIK---DFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLI---SDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQ 3880
            +KN   D ENY         RR  LY K   +  A +D     +I  +   A     L H   +  ++A++D +L+LK++     A   R   +A  G    AI +   A+ L P D                                SE   A+  R  LY +  + + A+ D+  +I++      A +  GL Y L + Q Q A + FS+ ++  P+N + ++ R  AY  +   + AL D +  +HL P++   +  RG CL                  ++KA     ++  ++   L++  + I   +            IL   T+    +F EA+  F+  + F      ++C        +   G+ Y  +G+     ++++  +     +P Y  AY  R     ++ ++ ++++D NRA+ + P+    Y+ R   Y A G    A     +A +I     ++ + +  +  +L+ Y +A++ L VA     S +L     G      + +K A+  ++  L  L P+ +             L+ R  +  EL ++  +     A     P  A  ++  G    RLG++++ +   + AL ++P L  AY+ R   F   G    Y +A  +    L + PRC  A   R  L Y ++ +    +    FT A++++  C  A+  RA+  N +  N   A QD +  L     SD L        NRG++   +GD  +A+ D+ RA ++ P      +     +   +  ++A   ++R ++ DP      ++R  + +         L  +D++  L +  Y      N      +  K+K A   FT A++  P+       RA V   +  +  A+KD   A+ +Q
Sbjct:  871 IKNKPDDAENY--------FRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLLRRILPDVALRDLSVSVLINGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRIRL-QHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEIDSSCSLAYYNRGVCYQVLQEYKLALRDYSTVL--LLPEQK-------EIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSA---RIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAI-VNLQMGNTYAAFQDINNALKCNPHSDQL------LTNRGVINQFMGDKVSAMSDYQRAISLNPTCALAFFNAANLYFYNRQFEQACEYYSRAIELDPSDESPVLNRA-ISLALLQKIPESL--QDFSEALRLCPYSAHIYFNRANLYHSLRKYKAAEREFTQALQLQPDDALLYKLRADVRGHLGLMEEAVKDYRTAVELQ 1743          

HSP 3 Score: 96.6709 bits (239), Expect = 1.598e-19
Identity = 124/515 (24.08%), Postives = 221/515 (42.91%), Query Frame = 2
Query: 2912 LAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFI------RAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEI---DSY-HL---DALVNL------GFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQ---LEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            L ++  +K  P+ AE Y+ +     +  ++   + D  +  AIN     A +A A      + +  A+ + + +L  EP   RA  YRG    K+  +  AI+DF  A+ +D    LAF++R       +   + A++D S+ +LI+ +   +  A++ RGL+Y E    Q A+ DF       R  A    +L ++Y++     K+   ++AIR F+  +  DP  I   V R      Y++ N    A KD    L +   D Y H+     L N+       FC Q   + KKA  + T+  +    S    D +AI C+    ++ A    + +I I    + L +++ +       K ++  +  K  I    + P  Y+  G  Y+   +   L QALE F K    +P     +    L  I + +   S++  NR++ ++PN    Y +RA +      Y +A  +    L+I P +      +G  +    +   A+ED   ++ I
Sbjct:  865 LDYTQVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLL--RRILPDVALRDLSVSVLINGSSE-NLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYML-----KMNQSQKAIRRFSNAIKADPTNIKGYVCRARA---YHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGL-TLVQQAAVQSFLQNDAKAIACL----VSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRI-RLQHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEI 1362          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Cavefish
Match: ttc6 (tetratricopeptide repeat domain 6 [Source:ZFIN;Acc:ZDB-GENE-090429-2])

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 413/1032 (40.02%), Postives = 623/1032 (60.37%), Query Frame = 2
Query: 1196 RDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVD--EEF-RGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEK-GDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL---ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDF 4270
            ++W+  IW+ WFDE++PP  DH         S T  + E    +P S     N+ L   + I P+LD+VD  E    G   E L  EV  +++ M      N F L RRGALY+K+G L  A  D+N AIS+EP L+ AYW RH + L+ N    A++DLN I+K +K +  A++SRA IY   G+  LAI + +Q I+  PDD+E Y +RA+LYE+  E  LA+EDY +   +      A+M H L++ +   W++A  DFS +L+  P+N  A  +RG  +AKL  +++A+ DF   +HLDP ++LA++ RGCLLR+  P +A+RD S+S+L+  S EN+ +++YRG+LY   +Q+ +A+ DF+ VI  ++ +  AH+NLGLIY  K    +K+++  ++ + ADPT I+ Y CRA AY  +N  + A+KD+ RA+HL PD    +++RG     M +  +A  C++ +AE+   LG + VQQA V SFLQ+  +AI  L+ A    PS ++L LLG TQ+K  ++ +A+ SF   L  L PK       P A  L +L   CY+   E     ++  AFS   +INP++AEAY+ +G CR+RL +    + D NRAL INP  YQAYL+RA L+G K  Y KAI NC+E L I+P+ ++AYLY+G LK+ +K Y  A++D T AI+ID++C LA++NR VC+   ++ Y+ A++DYS VLL+ +   + +K  INR LV+ EL D  NAL D   A + QP D  + + +G+  H+L  L+EA+  ++  L   P  + A V RGN FMDY  S     A +D+ S L ++     A + L +  Q  G F++ W+ FT+A+E +P      +GRAIV +QM +   A +D+N A++  P S  L  NRGV+ Q M DK+ AM DY +AI +    C +A+FNA  +Y +N Q EQA E + + +E DP DE+  +N A+      K+ ES++  + ++ L P SA++YFNRAN+   L++Y+ AE +F
Sbjct:  690 QEWVGDIWNTWFDEVFPP-QDH---------SSTKSEPEARQMQPVS-----NKQLKKKKEI-PILDKVDLSEALDEGFTVEDLEMEVAKLTESMIKNTGNNGFDLCRRGALYKKLGLLKQALDDLNAAISLEPHLLDAYWHRHSISLLRNAPNSALDDLNFIIKHNKKHADAFRSRAEIYRMRGETRLAILDYTQVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYHRGCLLRRILPDVALRDLSVSVLINGSSENLAAFLYRGLLYTEQQQWQKAMADFKAVIKIDRTVAAAHINLGLIYMLKMNQSQKAIRRFSNAIKADPTNIKGYVCRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPDYAEAYHQRGLCRIRL-QHSNSVQDFNRALCINPNFYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKKAVEDLTVAIEIDSSCSLAYYNRGVCYQVLQE-YKLALRDYSTVLLLPEQKEIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSARIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAIVNLQMGNTYAAFQDINNALKCNPHSDQLLTNRGVINQFMGDKVSAMSDYQRAISLNP-TCALAFFNAANLYFYNRQFEQACEYYSRAIELDPSDESPVLNRAISLALLQKIPESLQDFSEALRLCPYSAHIYFNRANLYHSLRKYKAAEREF 1702          

HSP 2 Score: 98.9821 bits (245), Expect = 3.067e-20
Identity = 188/898 (20.94%), Postives = 360/898 (40.09%), Query Frame = 2
Query: 1877 IIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFP-DRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLR----LGKMKQGILDLNRALAINPRLYQAYLARA---------TLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYR------------------------GVLKYKIKAYSLAIKDFTEAI-----KIDANCILA-----FFNRAVCFNAEKKN--YEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNL-KEAIRVFTRCLDHDPKFILAKVSRGNV---FMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAI---EKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGG--LKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +I+   NN   + + G  Y  +   + A  D ++ +   P   +A+ HR +          AL D + +I  +  +  A+  R  + R + E  LAI D++   ++++  ++  +Y  R  LY  T + S A+ D+      N +   A +   L +F    +  ++   +  L  +P   RA   R   + ++  +++AI+D   A+HL P D   FY  RG     + +  +  + +R  +               V   +    + + A L   RG        LL T Q   ++W+ A+  F   ++  +           AA++N  +    L++   +K+   FS  +K +P + + Y     CR R    +  +K+ + DL RAL + P     ++ R           L  F  QY+  +     +  ++   ++++L                          G  + K+  +  A++ F +A+     K    C +      ++   VC+ A+ ++    +A++ +S    I+     + +AY  RGL  + L    N++ DF RA  I PN  Y  Y+     +  K L  +AI   +  L   PK + A + +G +     +Y        A +D    +EIDS    A  N G C Q   ++K A   ++  +   E+     + L  R +V  +++D   AL+DL  A   QP+ + L+ + G+ +  +     A++ Y++A+ +    L   +   NA   Y H+   +QA   F   +  +P   +  + LA         +        ++ ++P     Y  RA V   +     A  D  + L+  P    +L  RG      GD + A+ DY+ ++ +
Sbjct:  768 MIKNTGNNGFDLCRRGALYKKLGLLKQALDDLNAAISLEPHLLDAYWHRHSISLLRNAPNSALDDLNFIIKHNKKHADAFRSRAEIYRMRGETRLAILDYT--QVIKNKPDDAENYFRRADLYEKTNEISLAMEDYAKTFAINLERTDALMAHALHHFHTSVWRVALDDFSLLLKQEPANARARTYRGRTFAKLGLFKEAIEDFCLAVHLDPRDWLAFYH-RG----CLLRRILPDVALRDLS---------------VSVLINGSSENLAAFLY--RG--------LLYTEQ---QQWQKAMADFKAVIKIDRTV--------AAAHINLGLIY-MLKMNQSQKAIRRFSNAIKADPTNIKGYV----CRARAYHNVNDLKRALKDLTRALHLRPDDQYLHIMRGQCLCNMEQTALATFCIQYSAEMKKALGLTLVQQAAVQSFLQNDAKAIACLVSAANSCPSPSILILLGKTQLKVHKFMEAVESFKKALSFLNPKKTNICNVPEAPELYYLTGVCYMAQGEDSLLPQALEAFSKATRINPD---YAEAYHQRGLCRIRLQH-SNSVQDFNRALCINPN-FYQAYLSRAALYGAKGLYNKAIFNCSEALKIQPKNVKAYLYKGALKFYLKEYKK------AVEDLTVAIEIDSSCSLAYYNRGVCYQVLQEYKLALRDYSTVLLLPEQKEIEFKVLINRTLVHKELNDHYNALQDLKAAASKQPKDASLFHSLGLYFHRLGQLQEAVEAYSEALRLSPFLLNAYVGRGNAFMDYGHSQGYKQAQRDFLSALHLNPRCSSARIGLAYNLQVFGCFQRVWNQFTVAVEVNPKCWAAYEGRAIVNLQMGNTYAAFQDINNALKCNPHSDQLLTNRGVINQFMGDKVSAMSDYQRAISL 1606          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: TTC6 (tetratricopeptide repeat domain 6 [Source:HGNC Symbol;Acc:HGNC:19739])

HSP 1 Score: 449.899 bits (1156), Expect = 8.700e-143
Identity = 239/594 (40.24%), Postives = 352/594 (59.26%), Query Frame = 2
Query: 2615 LGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQ-YKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNA-EKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            LG   +QQA++ SFL+ + QAI  L      +P V  L LLG+ QMKA+++++A  SF   L      N+  +P     AN+ FL+  C +E  N+K++  AFSA + I P H EA Y +G CRLRL +   G+LD+N+ LA+NP   QAYL RA  +G K ++TKAI+NCNEVL I+P C+RA+LYRG LKY IKAY LA++D + AI +D +C LA +NRA+C+    + +  +A++DYS + L+     L  K   NRGL+Y + GD QNA  DF  A  I P D  +L  +G+C+H+L  +KEA+  F      DP ++ A V RGN  M+Y  +     A +DY   L ++     A VNL +  QA G+F+KAW+ FT AIE         +GRA+V +QM+    AL+D+N A+++   + +L  NRG ++Q   D + AM+DY +A I+      +AY+NA  VY+H  QL QAL+ + + VE DP+DE   +N A+V         ++    ++ +LSP ++Y+YFNRAN+   L +Y+ AE D+   L + P D      R + R K G+   A+ DY+ +V I
Sbjct:    4 LGLCSMQQAIIQSFLKDHQQAIACLAGMCSMQPQVTTLALLGSIQMKAEQFQEAKMSFEQALHLSNSVNKDQQPADAARANIYFLLGLCLIEQSNFKEALKAFSAVLHIVPKHQEALYKRGICRLRL-QDSSGLLDINQTLALNPHHIQAYLTRAAYYGMKGRFTKAIMNCNEVLKIQPSCVRAFLYRGSLKYYIKAYKLAVEDLSSAIYLDGSCSLALYNRAICYQELHETDKMQAVKDYSTIALLGKQNDLCRKVMTNRGLLYFDRGDYQNAQQDFYAASKISPTDPKLLQALGICYHRLGRVKEAVAAFGEATKADPFYVSAYVGRGNALMNYGHAPGTRAAQRDYLRALRLNPLSAHARVNLAYSLQANGRFQKAWNHFTTAIELDTRCAEAFEGRAVVNLQMNSTFAALQDINAAVKLGKSAEVL-TNRGAIHQCSGDVVSAMRDY-QAAIVADPNYALAYYNAANVYLHGRQLTQALDYYDRVVELDPMDECAILNRAIVRSLSGDATGALADFCKAATLSPQTSYIYFNRANLHSMLGQYKRAEADYTEALTLQPHDAVTYLCRAEVRGKLGEKEDAISDYRRAVEI 594          

HSP 2 Score: 91.6633 bits (226), Expect = 5.210e-19
Identity = 120/507 (23.67%), Postives = 195/507 (38.46%), Query Frame = 2
Query: 1559 DINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEG--RLALEDYNQIIRLQPNNCL---AMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHL------FPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFT-FC-LEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAI 3040
            DIN  +++ P  I AY  R   + +  +   AI + N +LK   + V A+  R  +        LA+ +LS AI L    S A   RA  Y++  E     A++DY+ I  L   N L    M   GL Y +   +Q A +DF +  +  P++ +     G  Y +L + ++A+  F      DP    AY  RG  L                         M+Y +     A  + +  A+         N     A VNL       G F+K+  + T+ +  D     A+  RA    QMN    A++DIN A+ L        +R   +   GD   AM   + A +     A   +N     +    +   L +YD+ ++            A+LN      +      DA  +   FC    L P+  Y         + F  A  +  L  YK+++  ++  + + P+ A  Y  +   R +LG+ +  I D  RA+ I
Sbjct:  138 DINQTLALNPHHIQAYLTRAAYYGMKGRFTKAIMNCNEVLKIQPSCVRAFLYRGSLKYYIKAYKLAVEDLSSAIYLDGSCSLALYNRAICYQELHETDKMQAVKDYSTIALLGKQNDLCRKVMTNRGLLYFDRGDYQNAQQDFYAASKISPTDPKLLQALGICYHRLGRVKEAVAAFGEATKADPFYVSAYVGRGNAL-------------------------MNYGHAPGTRAAQRDYLRALR-------LNPLSAHARVNLAYSLQANGRFQKAWNHFTTAIELDTRCAEAFEGRAVVNLQMNSTFAALQDINAAVKLGKSAEVLTNRGAIHQCSGDVVSAMRDYQAAIVADPNYALAYYNAANVYLHGRQLTQALDYYDRVVE-----LDPMDECAILNRAIVRSLSG----DATGALADFCKAATLSPQTSY---------IYFNRANLHSMLGQYKRAEADYTEALTLQPHDAVTYLCRAEVRGKLGEKEDAISDYRRAVEI 594          

HSP 3 Score: 74.3294 bits (181), Expect = 1.392e-13
Identity = 137/637 (21.51%), Postives = 244/637 (38.30%), Query Frame = 2
Query: 1859 LEDYNQII-------RLQPN-NCLAMMKHGLYYLNIEQWQLAAKDFSSVLR--------HYPSNT---EAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRG-CLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKME-MAAICVRQAAEISHNLGQSPV-QQALVHSFLQHYDQ-----AIDALLVATRGKPS-VALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAAN--LNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDS 3679
            L+D+ Q I        +QP    LA++  G   +  EQ+Q A   F   L           P++      +   G    +   +++AL  FSAV+H+ P +  A +KRG C LR                                      Q S  ++D    +  N     A++     Y  KG F K++      L   P+ +RA+  R    + +  Y+ A++D++ AI+L    S     R   Y  + + + M A  V+  + I+    Q+ + ++ + +  L ++D+     A      A++  P+   LL  LG    +  R K+A+ +F    E  K    Y     G  N  +N      Y      + +Q  +   +++NP  A A  +  +     G+ ++       A+ ++ R  +A+  RA +    N    A+ + N  + +  +       RG +         A++D+  AI  D N  LA++N A  +    +   +A+  Y  V+ +     +   A +NR +V    GD   AL DF +A  + P   Y+ +     H  L   K A   +T  L   P   +  + R  V         ++ A  DY   +EI +
Sbjct:   18 LKDHQQAIACLAGMCSMQPQVTTLALL--GSIQMKAEQFQEAKMSFEQALHLSNSVNKDQQPADAARANIYFLLGLCLIEQSNFKEALKAFSAVLHIVPKHQEALYKRGICRLR-------------------------------------LQDSSGLLDINQTLALNPHHIQAYLTRAAYYGMKGRFTKAIMNCNEVLKIQPSCVRAFLYRGSLKYYIKAYKLAVEDLSSAIYLDGSCSLALYNRAICYQELHETDKMQA--VKDYSTIALLGKQNDLCRKVMTNRGLLYFDRGDYQNAQQDFYAASKISPTDPKLLQALGICYHRLGRVKEAVAAFG---EATKADPFYVSAYVGRGNALMN------YGHAPGTRAAQRDYLRALRLNPLSAHARVNLAYSLQANGRFQKAWNHFTTAIELDTRCAEAFEGRAVVNLQMNSTFAALQDINAAVKL-GKSAEVLTNRGAIHQCSGDVVSAMRDYQAAIVADPNYALAYYNAANVY-LHGRQLTQALDYYDRVVELDP---MDECAILNRAIVRSLSGDATGALADFCKAATLSPQTSYIYFNRANLHSMLGQYKRAEADYTEALTLQPHDAVTYLCRAEV---RGKLGEKEDAISDYRRAVEIQT 596          

HSP 4 Score: 63.5438 bits (153), Expect = 2.361e-10
Identity = 39/142 (27.46%), Postives = 80/142 (56.34%), Query Frame = 2
Query: 1490 NAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMM 1915
            +A +L+ RGA+++  G +V+A +D   AI  +P+  +AY+    ++L   ++  A++  + +++ D     A  +RA + + +GD + A+++  +A  LSP  S  Y  RA L+   G+ + A  DY + + LQP++ +  +
Sbjct:  428 SAEVLTNRGAIHQCSGDVVSAMRDYQAAIVADPNYALAYYNAANVYLHGRQLTQALDYYDRVVELDPMDECAILNRAIVRSLSGDATGALADFCKAATLSPQTSYIYFNRANLHSMLGQYKRAEADYTEALTLQPHDAVTYL 569          

HSP 5 Score: 62.7734 bits (151), Expect = 4.805e-10
Identity = 45/194 (23.20%), Postives = 82/194 (42.27%), Query Frame = 2
Query: 1511 RGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHL 2092
            R  +  +M    AA +DIN A+ +     +    R  +H     +  A+ D    +  D NY LAY + A +Y     ++ A+    + + L P D  A   RA +   +G+   AL D+ +   L P            +  + Q++ A  D++  L   P +   +L R     KL + +DA++D+   + +
Sbjct:  402 RAVVNLQMNSTFAALQDINAAVKLGKSAEV-LTNRGAIHQCSGDVVSAMRDYQAAIVADPNYALAYYNAANVYLHGRQLTQALDYYDRVVELDPMDECAILNRAIVRSLSGDATGALADFCKAATLSPQTSYIYFNRANLHSMLGQYKRAEADYTEALTLQPHDAVTYLCRAEVRGKLGEKEDAISDYRRAVEI 594          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9631])

HSP 1 Score: 85.1149 bits (209), Expect = 9.327e-17
Identity = 111/483 (22.98%), Postives = 192/483 (39.75%), Query Frame = 2
Query: 2840 PGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKK------NYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++ + +     A+ + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FN++ +      ++EKA+      L           AYIN G V  E      A+  ++RA ++  N   V   +   +++   +  AI  + R ++  P F  A  +  N   +  +      A + YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I   +LE+     NR  S+ P+ + LY
Sbjct:   53 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVFKERGQLAEALEHYRHAVRLKPDFIDGYINLAAALVAAGDLEGAVQAYVTALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFSVAWSNLGCVFNSQGEIWLAIHHFEKAVSLDPNFL----------DAYINLGNVLKEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGNIAE---AEECYNTALHLCPNHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAISSYRTALKLKPDFPDAYCNLAHCLQIICDWTDYDERMKKLVQIVAEQLEK-----NRLPSVHPHHSMLY 514          

HSP 2 Score: 82.8037 bits (203), Expect = 4.403e-16
Identity = 101/432 (23.38%), Postives = 175/432 (40.51%), Query Frame = 2
Query: 3101 YTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDY-SIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCP---IAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            Y  A  +C ++   EP      L    + ++ +    +    T AIK +     A+ N    F  E+    +A++ Y   V L  D +      YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   NS     LA   +   + +D   LDA +NLG   +    F +A   +  A+  + N        A V  +   ++ A+     AI +QP     Y N     +   +   A + YN A+ +    CP    +  N   +      +E+A+  +RK +E  P   A   NLA V   Q KL++++ +   +I +SP  A  Y N  N L ++Q  Q A   +   ++I P               +G+   A+  Y+T++
Sbjct:   38 YEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVFK-ERGQLAEALEHYRHAVRLKPDFI----DGYINLAAALVAAGDLEGAVQAYVTALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFSVAWSNLGCVF---NSQGEIWLAIHHFEKAVSLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGNIAEAEECYNTALHL----CPNHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAISSYRTAL 457          

HSP 3 Score: 80.1073 bits (196), Expect = 3.069e-15
Identity = 91/418 (21.77%), Postives = 177/418 (42.34%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            AI+ +P  +EAYS    ++++ G+   ALE Y   +RL+P+           Y+N+    +AA D    ++ Y +    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  N +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +  N A+HL P+ ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C
Sbjct:   82 AIKQNPMLAEAYSNLGNVFKERGQLAEALEHYRHAVRLKPDFIDG-------YINLAAALVAAGDLEGAVQAYVTALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFSVAWSNLGCVFNSQGEIWLAIHHFEKAVSLDPNFLD--AYINLGNVLKEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGNIAEAEECYNTALHLCPNHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAISSYRTALKLKPDFPDAYCNLAHC 473          

HSP 4 Score: 64.6994 bits (156), Expect = 1.786e-10
Identity = 76/341 (22.29%), Postives = 137/341 (40.18%), Query Frame = 2
Query: 3374 KAYINRGLVYLELGDVQNALHDFIRAQAIQPN--DLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +AY N G V+ E G +  AL  +  A  ++P+  D Y+     +      +L+ A++ +   L ++P     +   GN+     +    + A   Y   +E       A  NLG    +QG+   A   F  A+   PN          V  +    + A+     A+ +    ++++ N   VY       +A+  Y +AI +     P AY N          + +A EC+   +   P       NLA +   Q  +EE++    +++ + P  A  + N A+VL    + Q+A L +   +RI+P         G+   +  D  GAL+ Y  ++ I
Sbjct:   91 EAYSNLGNVFKERGQLAEALEHYRHAVRLKPDFIDGYINLAAALV--AAGDLEGAVQAYVTALQYNPDLYCVRSDLGNLL---KALGRLEEAKACYLKAIETQPNFSVAWSNLGCVFNSQGEIWLAIHHFEKAVSLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP-NFPDAYCNLANALKEKGNIAEAEECYNTALHLCPNHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQI 425          

HSP 5 Score: 55.8398 bits (133), Expect = 7.654e-8
Identity = 78/369 (21.14%), Postives = 136/369 (36.86%), Query Frame = 2
Query: 1505 SRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            S  G ++   G +  A      A+S++P+ + AY     +         A+      L  + N+ + + + A +Y   G I LAI    +AI L P+  +AY   A   ++ G    A E YN  + L PN+  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + QDAL  +   I + P    AY   G  L++ +                          +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K +          NR   + P  S  Y L   F  A+ +
Sbjct:  196 SNLGCVFNSQGEIWLAIHHFEKAVSLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLNHNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGNIAEAEECYNTALHLCPNHADSL--NNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQDALLHYKEAIRISPTFADAYSNMGNTLKEMQD------------------------VQGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAISSYRTALKLKPDFPDAY-CNLAHCLQIICDWTDYDERMKKLVQIVAEQLEKNRLPSVHPHHSMLYPLSHAFRRAIAE 526          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: bbs4 (Bardet-Biedl syndrome 4 [Source:ZFIN;Acc:ZDB-GENE-060126-2])

HSP 1 Score: 51.2174 bits (121), Expect = 1.397e-6
Identity = 65/293 (22.18%), Postives = 117/293 (39.93%), Query Frame = 2
Query: 3371 YKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFM---DYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDL 4240
            Y  Y+ + L++   G +Q +L  F     + P +   L  V      L   K AI V+      + +      ++G  +M   DY      + A +  NS L+   + L + V LG     +G  ++A +++  AIE  P +   L    ++ +QM     A + L  A+   P +    +  G + Q   D  +A+  Y  A      + P  + N    +    +   A+ C ++     P D     NL LV++   +   +  +++ +ISL P    LY   A  L +L
Sbjct:   57 YAVYV-QALIFRLEGKIQESLELFQTCAILNPQNAENLKQVARSLFLLGKHKAAIEVYNEAAKMNERDWEISHNQGVCYMYLKDY------EKAKECLNSALQCSRHDLTSGV-LGRVHLLEGDAERAIEVYRRAIEHSPENTELLTTLGLLYLQMGSYQRAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVA-AHSAPESPPLWNNIAMCFFGKKKYVAAISCLKRAHYLAPFDGKVLYNLGLVHLTMQQHASAFHFLSAAISLMPRMGELYMLLAVALNNL 340          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ift88 (intraflagellar transport 88 homolog [Source:ZFIN;Acc:ZDB-GENE-030131-574])

HSP 1 Score: 50.8322 bits (120), Expect = 2.238e-6
Identity = 79/385 (20.52%), Postives = 151/385 (39.22%), Query Frame = 2
Query: 3296 EKKNYEKAIQDYSIVL--LISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCL---------------DHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLD-GRAIVCMQMSDLNGALKDLN----EAIRIQPQSSM----LYINRGVVYQLMR--DKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALE 4366
            ++KN+ KAI+ Y + L  + S    +  K   N G+ +L +G    A+  F    +  P DL   + + +C+  L   +   R F R +               + DP   L   +  N  +       R +A +   +  ++ +  ++     G+           W + T+   ++      L+  +AI+ +++ D + A++ L     +  R++  ++     L+  R  V Q  R  D  MA   YN          P A  N G         EQA + +R+ + +D        NL LV+    +L+++++   +  S+  N   +  + A++   L+   +A       + + P DPH L   GD     GD   AL+
Sbjct:   82 KQKNFPKAIKFYRMALDQVPSSQREMRMKIMQNIGVAFLRVGHYTEAVSAFEHIMSESP-DLRAAFNLTLCYFALGEHERIKRAFQRLVAVPLGVGDEDRYTPHNDDPHTNLVIDAIKNDMLRQMERERRTMAERFIMTAAKLIAPAIEETFVAGY----------DWCVETVKASQYVELANDLEINKAIMYLKLKDFDQAVEALKMFEKKDTRVKSAAATNLAFLFFLRNDVAQAERYADAAMAADRYN----------PQALVNKGNCLFLGGSAEQAADYYREALRNDASCTEALYNLGLVHKHLGRLQDALDCFLKLHSILRNHPPVMHHIASIYEALEEAGQAAEWLLQLVTVVPTDPHALARLGDVYDADGDKSQALQ 445          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007591.1 (pep scaffold:Pmarinus_7.0:GL480573:24572:27393:-1 gene:ENSPMAG00000006852.1 transcript:ENSPMAT00000007591.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 5.258e-6
Identity = 45/166 (27.11%), Postives = 69/166 (41.57%), Query Frame = 2
Query: 3809 AIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNK---LEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPD 4297
            +I+    S L  A     +AI ++P  +  YI+RG +   M+    A   Y KA+ + G    + ++N   V+I   Q   AL  F + +   P       N AL+         LEE+   + R   L P+    YFN   V  D+ R  EAE      + + PD
Sbjct:   22 SIIRTNESRLQEADSLYRQAIAMRPDFTQAYISRGELLLKMQRLPEARAAYEKAVALDGDNADL-WYNLAIVHIELRQPRDALAHFERALALKPAHRLALFNSALLIQETGASELLEEAHGRLLRYAELEPSDEKAYFNLGMVATDMGRADEAERWLRRAVALRPD 186          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO40344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7J9])

HSP 1 Score: 749.969 bits (1935), Expect = 0.000e+0
Identity = 397/919 (43.20%), Postives = 589/919 (64.09%), Query Frame = 2
Query: 1502 LSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEK-GDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQE 4255
            L RRGA++RK+G L  A  D+N AI +E  L+ AYW RHLL+L+ N  + A++DL  I+K   +   AY+SRA +Y   GD ++AI N SQAI+L+P+D E Y +RA +++  G+  LALEDY    RL P+   AM + G+Y  N E W  A  DF+ +L   P ++ A+ +RGT +AK+ Q+  AL D +A +H +P+N +A+++RGC+LRK  P  A++DFS+SLLL+ SEEN+M++M+RGILY   K++ +AI DFE  I  +  +  A+VN+GLIY  K  +++K+++  TS +  DPTY+RA  CRAEA+ +M   ++AI D  RAIH+ PD S+++M RG   L   K+++A+  V+QAA+++  LG S  QQA+VHSFL+++DQAID L  ATR KPS  +  LLG T MKAKR++DAI+SF   +E L P N   P P  AA + FL+  C  E+ N   +  A++  +K+NP++AEA+Y +G  +++L   K G+ D NRALAINP+L+QA+L+RA  +G K +Y+K I++CNE + ++P+ +RAYLYRG LKY IKA+ LA+KD TEA+ ID  C LA+FNRAVC + E K ++KA+ DY  V+L+    +L  K   NRGL+YLE+GD++NAL DF  A  +   +  + + +G+C+HKL  L+EA+  +   L  DP F+ A   RGN  MD+       L  +DY   L +D   L A VNL +  Q +GKF+ AW+ F+ AI      +  L+GRA++ +QM +  GA  D+NEA++I   + +L  NRGVV Q M D + A++DY  AI +      ++Y+NAG VY    Q +QAL  F K +     DE+  +N A+     + +    +Y   +I L P+ A  Y+N  NV F  +++++
Sbjct:    3 LCRRGAIHRKVGELKKAWDDLNKAIELENMLLDAYWHRHLLYLLQNNKKAALDDLTFIIKHSSSQARAYRSRAELYRQEGDATMAIVNYSQAIKLNPNDVETYYQRAAMFKMRGDMLLALEDYKIASRLLPSKTEAMFEIGMYRFNNENWTGAVNDFTEILEQDPQDSRAYTYRGTVFAKMGQFSKALPDLAAGVHYNPDNAVAFYQRGCILRKIHPRRALQDFSVSLLLDDSEENVMAFMHRGILYTDLKRWEDAIPDFEAAIRLDPSLASAYVNIGLIYIIKHSNYQKAIRQYTSAIRVDPTYVRALICRAEAFQKMGMLQEAILDYARAIHMRPDVSDYHMARGKLLLEQKKLDLASFHVKQAAQLNQGLGASATQQAVVHSFLKNFDQAIDVLERATRVKPSAQIFVLLGKTNMKAKRFEDAISSFLKAIEILTPWNSRNPMPLEAAGVYFLIGMCQSEVHNDSGALDAYNEAIKVNPDYAEAFYQRGLTKMKLSHTK-GVHDFNRALAINPKLFQAFLSRAAYYGMKGRYSKGIMSCNEAIKLQPQSVRAYLYRGALKYHIKAFGLAVKDLTEAVAIDCRCSLAYFNRAVCHH-EMKYFQKALMDYGTVMLLETNPNL--KVLQNRGLLYLEIGDIENALEDFKAAAKVSTLNPKIRHTLGLCYHKLNKLEEAVAAYDDALKIDPFFVEAYNGRGNALMDFGHEQGNVLGRRDYLKALHLDPLCLSARVNLAYNLQVEGKFQAAWNQFSAAIAIDSTCQAALEGRAVINLQMGNTFGAFVDMNEALKISKTAELLN-NRGVVQQYMGDYVNAVRDYQAAIRLEP-SYALSYYNAGNVYFRQRQFKQALSYFNKALSWIGDDESAVLNRAITKYMGDYVNAVRDY-QAAIRLEPSYALSYYNAGNVYFRQRQFKQ 914          

HSP 2 Score: 126.331 bits (316), Expect = 2.962e-29
Identity = 186/909 (20.46%), Postives = 350/909 (38.50%), Query Frame = 2
Query: 1814 KRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYL-ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLF---------------------GFKNQYTKAIL------NCNEVLSIEPRCLRA------YLYRGVLKYKIKAYSLAIKDFTEAIKI----------DANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKN-LKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIF--TMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFR----KTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSV 4384
            +R  ++ + GE + A +D N+ I L+     A     L YL     + A  D + +++H  S   A+  R   Y +      A+ ++S  I L+PN+   Y++R  + + + +  LA+ D+ I+  L  S+   M                     FE+               G+  F   ++  +V   T  L  DP   RAY  R   + +M ++  A+ D+   +H  PD +  +  RG              C+         L +   ++AL         Q     L+    + +V      G      KRW+DAI  F   +             P  A+    +   Y+ +  NY+K+   +++ ++++P +  A   +     ++G +++ ILD  RA+ + P +   ++AR  L                      G     T+  +      N ++ + +  R  R       ++  G    K K +  AI  F +AI+I                 +F   +C  +E  N   A+  Y+  + ++     + +A+  RGL  ++L   +  +HDF RA AI P  L+  ++    ++ +K    + I      +   P+ + A + RG +     +     LA KD    + ID     A  N   C      F+KA   +   M +E +PN  + L  R ++ +++ D+  AL+D   A ++   +  +    G+ Y  +     A+  Y+ A+ I      +  +N     + +F  EQ     R    K +  DPL  +  VNLA     + K + +    + +I++          RA +   +     A +D    L+I+     +L  RG  +   GD + A+ DY+ ++
Sbjct:    5 RRGAIHRKVGELKKAWDDLNKAIELENMLLDAYWHRHLLYLLQNNKKAALDDLTFIIKHSSSQARAYRSRAELYRQEGDATMAIVNYSQAIKLNPNDVETYYQRAAMFKMRGDMLLALEDYKIASRLLPSKTEAM---------------------FEI---------------GMYRFNNENWTGAVNDFTEILEQDPQDSRAYTYRGTVFAKMGQFSKALPDLAAGVHYNPDNAVAFYQRG--------------CI---------LRKIHPRRAL---------QDFSVSLLLDDSEENVMAFMHRGILYTDLKRWEDAIPDFEAAIR----------LDPSLASAYVNIGLIYIIKHSNYQKAIRQYTSAIRVDPTYVRALICRAEAFQKMGMLQEAILDYARAIHMRPDVSDYHMARGKLLLEQKKLDLASFHVKQAAQLNQGLGASATQQAVVHSFLKNFDQAIDVLERATRVKPSAQIFVLLGKTNMKAKRFEDAISSFLKAIEILTPWNSRNPMPLEAAGVYFLIGMC-QSEVHNDSGALDAYNEAIKVNPD---YAEAFYQRGLTKMKLSHTK-GVHDFNRALAINPK-LFQAFLSRAAYYGMKGRYSKGIMSCNEAIKLQPQSVRAYLYRGALKYHIKAFG---LAVKDLTEAVAIDCRCSLAYFNRAVCHHEMKYFQKALMDYGTVMLLETNPNL-KVLQNRGLLYLEIGDIENALEDFKAAAKVSTLNPKIRHTLGLCYHKLNKLEEAVAAYDDALKIDPF--FVEAYNGRGNALMDFGHEQGNVLGRRDYLKALHLDPLCLSARVNLAYNLQVEGKFQAAWNQFSAAIAIDSTCQAALEGRAVINLQMGNTFGAFVDMNEALKISK-TAELLNNRGVVQQYMGDYVNAVRDYQAAI 822          

HSP 3 Score: 116.701 bits (291), Expect = 3.324e-26
Identity = 123/568 (21.65%), Postives = 243/568 (42.78%), Query Frame = 2
Query: 2918 FSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQ-YTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHH-KLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVF----------MDYNSSNSRDLAAKDYNSV----------LEIDSYHLD--ALVNLGFCRQAQGK---------FKKAWDIFTMAIEKHP-----------------------------------NSERPLDGRA-----IVCMQMSDLN---GALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPD-DPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +S  +K+NPN  E YY +       G M   + D   A  + P   +A +    ++ F N+ +T A+ +  E+L  +P+  RAY YRG +  K+  +S A+ D    +  + +  +AF+ R       K +  +A+QD+S+ LL+ D+   +  A+++RG++Y +L   ++A+ DF  A  + P+       +G+ +  K  N ++AIR +T  +  DP ++ A + R   F          +DY  +        DY+            L++ S+H+   A +N G    A  +         F +A D+   A    P                                   NS  P+   A     ++ M  S+++   GAL   NEAI++ P  +  +  RG+  ++       + D+N+A+ I   K   A+ +    Y    +  + +    + ++  P     ++    +         +++ +  ++++    +  YFNRA    +++ +Q+A +D+ + + +  + +  VL+ RG    + GD   ALED+K +  +
Sbjct:   91 YSQAIKLNPNDVETYYQRAAMFKMRGDMLLALEDYKIASRLLPSKTEA-MFEIGMYRFNNENWTGAVNDFTEILEQDPQDSRAYTYRGTVFAKMGQFSKALPDLAAGVHYNPDNAVAFYQRGCIL--RKIHPRRALQDFSVSLLLDDSEE-NVMAFMHRGILYTDLKRWEDAIPDFEAAIRLDPSLASAYVNIGLIYIIKHSNYQKAIRQYTSAIRVDPTYVRALICRAEAFQKMGMLQEAILDYARAIHMRPDVSDYHMARGKLLLEQKKLDLASFHVKQAAQLNQGLGASATQQAVVHSFLKNFDQAIDVLERATRVKPSAQIFVLLGKTNMKAKRFEDAISSFLKAIEILTPWNSRNPMPLEAAGVYFLIGMCQSEVHNDSGALDAYNEAIKVNPDYAEAFYQRGLT-KMKLSHTKGVHDFNRALAINP-KLFQAFLSRAAYYGMKGRYSKGIMSCNEAIKLQPQSVRAYLYRGALKYHIKAFGLAVKDLTEAVAIDCRCSLAYFNRAVCHHEMKYFQKALMDYGTVMLLETNPNLKVLQNRGLLYLEIGDIENALEDFKAAAKV 652          

HSP 4 Score: 51.9878 bits (123), Expect = 1.870e-6
Identity = 61/259 (23.55%), Postives = 104/259 (40.15%), Query Frame = 2
Query: 1514 GALYRKMGYLVAASKDINDAISIEPDLIIAYWER---------------------HLLHL----------------VCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRG-TAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFS 2176
            G  Y K+  L  A    +DA+ I+P  + AY  R                       LHL                V  K Q A    +  +  D     A + RA I    G+   A  ++++A+++S   +E  + R  + +  G+   A+ DY   IRL+P+  L+    G  Y    Q++ A   F+  L     +  A L+R  T Y  +  + +A+ D+ A I L+P+  L+Y+  G +  +   +  +R  S
Sbjct:  664 GLCYHKLNKLEEAVAAYDDALKIDPFFVEAYNGRGNALMDFGHEQGNVLGRRDYLKALHLDPLCLSARVNLAYNLQVEGKFQAAWNQFSAAIAIDSTCQAALEGRAVINLQMGNTFGAFVDMNEALKISKT-AELLNNRGVVQQYMGDYVNAVRDYQAAIRLEPSYALSYYNAGNVYFRQRQFKQALSYFNKALSWIGDDESAVLNRAITKY--MGDYVNAVRDYQAAIRLEPSYALSYYNAGNVYFRQRQFKQVRRSS 919          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO47073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN48])

HSP 1 Score: 97.0561 bits (240), Expect = 3.405e-20
Identity = 113/483 (23.40%), Postives = 198/483 (40.99%), Query Frame = 2
Query: 2840 PGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKK------NYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLY 4210
            P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++K  + +   A+ + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   +  +A+ N    FNA+ +      ++EKA+Q     L           AYIN G V  E      A+  ++RA  + PN   V   +   +++   +  A+  + R ++  P F  A  +  N   +    +    A + YN+ L++   H D+L NL   ++ QGK +++  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  + N G + + M+D   A++ Y++AI I       A+ N   V+  +  + +A++ +R  ++  P     + NLA                  LV I   +LE      NR  S+ P+ + LY
Sbjct:   48 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVFKERGQLKDALANYRHAVKLKPDFIDGYINLAAALVAAGDLEGAVHAYATALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQLDPNFL----------DAYINLGNVLKEARIFDRAVAAYLRALNLSPNHAVVHGNLACVYYEQGLIDLAVDTYRRAIELQPNFPDAYCNLANALKEQGKVSE---AEECYNTALQLSPTHADSLNNLANIKREQGKIEESIRLYCKALEIFPEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNMGNLLKEMQDIQGAIQCYSRAIQINPAFAD-AHSNLASVHKDSGNIPEAIQSYRTALKLKPSFPDAYCNLAHCLQIICDWTDYDNRMKKLVNIVAEQLEH-----NRLPSVHPHHSMLY 509          

HSP 2 Score: 80.4925 bits (197), Expect = 4.291e-15
Identity = 98/431 (22.74%), Postives = 165/431 (38.28%), Query Frame = 2
Query: 3101 YTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDY-SIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            Y +A   C ++   EP      L    + ++ +    +    T AIK +     A+ N    F  E+   + A+ +Y   V L  D +      YIN     +  GD++ A+H +  A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   +++D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP                                     P AY N         ++ +A EC+   ++  P       NLA +   Q K+EESI    +++ + P  A  + N A+VL    + QEA L +   +RI P         G+   +  D  GA++ Y  ++ I
Sbjct:   33 YDRAEQICMQLWRREPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVFK-ERGQLKDALANYRHAVKLKPDFI----DGYINLAAALVAAGDLEGAVHAYATALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPSFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNHAVVHGNLACVYYEQGLIDLAVDTYRRAIELQP-----------------------------------NFPDAYCNLANALKEQGKVSEAEECYNTALQLSPTHADSLNNLANIKREQGKIEESIRLYCKALEIFPEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNMGNLLKEMQDIQGAIQCYSRAIQI 420          

HSP 3 Score: 68.1662 bits (165), Expect = 2.553e-11
Identity = 89/432 (20.60%), Postives = 161/432 (37.27%), Query Frame = 2
Query: 1583 EPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPY-----LAIRDFSIXXXXXXXXXNIMSYMY-RGILYATTKQFSEAI---VDF------------------EVVICFNKDMCFAHV------NLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSV--ALLNLLGTTQMKAKRWKD 2773
            EPD          +H  C ++  +     L +K++     AY +   ++   G +  A++N   A++L PD  + Y   A      G+   A+  Y   ++  P+        G     + + + A   +   +   PS   AW + G  +    +   A+  F   + LDPN   AY   G +L++A  +       +R  ++S        N+    Y +G++      +  AI    +F                  E   C+N  +  +        NL  I  E+G  E+S++     L   P +  A+   A    Q  K ++A+     AI + P  ++ +   G+    M  ++ A  C  +A +I+     +    A VH    +  +AI +   A + KPS   A  NL    Q+    W D
Sbjct:   47 EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVFKERGQLKDALANYRHAVKLKPDFIDGYINLAAALVAAGDLEGAVHAYATALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNHAVVHGNLACVYYEQGLIDLAVDTYRRAIELQPNFPDAYCNLANALKEQGKVSEAEECYNTALQLSPTHADSLNNLANIKREQGKIEESIRLYCKALEIFPEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNMGNLLKEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKDSGNIPEAIQSYRTALKLKPSFPDAYCNLAHCLQIICD-WTD 477          

HSP 4 Score: 57.3806 bits (137), Expect = 5.092e-8
Identity = 80/433 (18.48%), Postives = 171/433 (39.49%), Query Frame = 2
Query: 1874 QIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFK-RGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAY 3166
            Q+ R +P+N   ++     +    +   +A   +  ++  P   EA+ + G  + +  Q +DAL ++   + L P+    Y      L+   +   A+  ++ +L        + S +  G L     +  EA   +   I        A  NLG ++  +G+   ++ +    +  DP ++ AY        +   ++ A+    RA++L P+ +  +      Y   G +++A    R+A E+  N   +    A          +A +    A +  P+ A  LN L   + +  + +++I  +   LE            P  A  +  +A    +    +++ L +   ++I+P  A+A+ + G     +  ++  I   +RA+ INP    A+   A++        +AI +    L ++P    AY
Sbjct:   42 QLWRREPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVFKERGQLKDALANYRHAVKLKPDFIDGYINLAAALVAAGDLEGAVHAYATALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNHAVVHGNLACVYYEQGLIDLAVDTYRRAIELQPNFPDAYCNLANALKEQGKVSEAEECYNTALQLSPTHADSLNNLANIKREQGKIEESIRLYCKALEIF----------PEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNMGNLLKEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKDSGNIPEAIQSYRTALKLKPSFPDAY 462          

HSP 5 Score: 51.9878 bits (123), Expect = 1.907e-6
Identity = 75/384 (19.53%), Postives = 159/384 (41.41%), Query Frame = 2
Query: 1514 GALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNI-----EQWQLAAKD--FSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLL-RKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIKDI----------NRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAA 2599
            G L + +G L  A      AI  +P   +A+     +     +I +AI      ++ D N++ AY +   +         A++   +A+ LSP+ +  +   A +Y + G   LA++ Y + I LQPN   A       Y N+     EQ +++  +  +++ L+  P++ ++  +      +  + ++++  +   + + P    A+     +L ++ +   A+  +  ++ +  +  +  S M  G L    +    AI  +   I  N     AH NL  ++ + G+  ++++   + L   P++  AY C      Q+      Y++ +K +          NR   + P  S  Y L  +F  A+       +CV + A
Sbjct:  160 GNLLKALGRLEEAKACYLKAIETQPSFAVAWSNLGCVFNAQGEIWLAIHHFEKAVQLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLSPNHAVVHGNLACVYYEQGLIDLAVDTYRRAIELQPNFPDA-------YCNLANALKEQGKVSEAEECYNTALQLSPTHADSLNNLANIKREQGKIEESIRLYCKALEIFPEFAAAHSNLASVLQQQGKLQEALLHYKEAIRIHPTFADAFSNM--GNLLKEMQDIQGAIQCYSRAIQINPAFADAHSNLASVHKDSGNIPEAIQSYRTALKLKPSFPDAY-CNLAHCLQIICDWTDYDNRMKKLVNIVAEQLEHNRLPSVHPHHSMLYPLTHEFRRAIANRH-GNLCVEKVA 532          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO43484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL8])

HSP 1 Score: 65.0846 bits (157), Expect = 1.962e-10
Identity = 52/203 (25.62%), Postives = 91/203 (44.83%), Query Frame = 2
Query: 3701 NLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHV 4309
            N+G  R  Q + ++A   +  A+  +P     L+    +  +  +++ A K L  A+      +  ++N G V   +     A   Y  AI     K P A+FN G +YI   +  +A+  FRK V+        W+N  L+    +K  E IE    ++   P+ + ++FN  N+L   +R++EAE  F   L + P  P +
Sbjct:  516 NIGKVRSTQQRDEEALAYYREAVRLNPTYSDALNNLGNLLKEKGEISEAEKLLERAVDSSKAFAAGWMNLGTVKAALNKMQEAETCYKNAIRYRK-KYPDAFFNLGNLYIDWNRDAEAVAAFRKAVKLKSDHVGAWMNHILLLDKTDKRTEGIELAYEALKHIPDESSIHFNLGNMLGQEKRFKEAEKHFLRALELNPVQPEI 717          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO33965 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQP9])

HSP 1 Score: 63.5438 bits (153), Expect = 5.481e-10
Identity = 54/220 (24.55%), Postives = 96/220 (43.64%), Query Frame = 2
Query: 2918 FSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFN-AEKKNYEKAIQDYSIVLLI----SDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDH 3562
            FS  +  +P + E +  +      +G++ + I D++ AL++ P   + YL   TL      Y  A  N  + L   P    A LY G+  Y       AI  + +A++ + N   A  +R++     E  +   A + ++  LL+    ++  HL       RG++    G    AL+DF   Q+  P +   LY+  VC+  L N  E +++ T+   H
Sbjct:   68 FSTVISHSPKNPEGWIRRAEVLSPIGRIPEAIKDISVALSLQPSA-ELYLISGTLHFMSEDYVTATKNLEKSLEYNPSQATATLYLGLSLYHRGLIQQAIPLYKKALQANTNT--AEVHRSLGHAYRELGDASAAYEHFTAALLLEPRSAETFHL-------RGMLQYMNGKPALALNDFKACQSFDPQNTACLYMKAVCYATLGNFYETVKMSTKVRLH 277          

HSP 2 Score: 62.7734 bits (151), Expect = 1.056e-9
Identity = 54/240 (22.50%), Postives = 96/240 (40.00%), Query Frame = 2
Query: 1856 ALEDYNQIIRLQPNNCLAMMKHGLYYLNI-----EQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMG 2560
            A+  + +II+  P    A +  G  Y+       E    A  DFS+V+ H P N E W+ R    + + +  +A+ D S  + L P+  L Y   G L   +E Y+     ++   LE +     + +Y G+         +AI  ++  +  N +    H +LG  Y E GD   + ++ T+ L  +P     +  R    +   K   A+ D        P  +    ++   Y  +G
Sbjct:   25 AISYFTKIIKEHPKVTSAFLGRGTAYVKKGIQIKENSDAAISDFSTVISHSPKNPEGWIRRAEVLSPIGRIPEAIKDISVALSLQPSAEL-YLISGTLHFMSEDYVTATK-NLEKSLEYNPSQATATLYLGLSLYHRGLIQQAIPLYKKALQANTNTAEVHRSLGHAYRELGDASAAYEHFTAALLLEPRSAETFHLRGMLQYMNGKPALALNDFKACQSFDPQNTACLYMKAVCYATLG 262          

HSP 3 Score: 62.003 bits (149), Expect = 1.760e-9
Identity = 65/268 (24.25%), Postives = 105/268 (39.18%), Query Frame = 2
Query: 1592 LIIAYWERHLLHLV-CNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTG-----DISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWL-------HRGT---------------------------AYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAI 2272
            L +++   H + L+ C  I  AI     I+K+      A+  R   Y   G     +   AIS+ S  I  SP + E + +RAE+    G    A++D +  + LQP+  L ++   L++++ E +  A K+    L + PS   A L       HRG                            AY +L     A   F+A + L+P +   +  RG L     +P LA+ DF          +N      + + YAT   F E +
Sbjct:    4 LFVSFITAHAISLLGCGDIDDAISYFTKIIKEHPKVTSAFLGRGTAYVKKGIQIKENSDAAISDFSTVISHSPKNPEGWIRRAEVLSPIGRIPEAIKDISVALSLQPSAELYLISGTLHFMS-EDYVTATKNLEKSLEYNPSQATATLYLGLSLYHRGLIQQAIPLYKKALQANTNTAEVHRSLGHAYRELGDASAAYEHFTAALLLEPRSAETFHLRGMLQYMNGKPALALNDFK--ACQSFDPQNTACLYMKAVCYATLGNFYETV 268          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO43788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXJ9])

HSP 1 Score: 58.5362 bits (140), Expect = 1.713e-8
Identity = 46/207 (22.22%), Postives = 87/207 (42.03%), Query Frame = 2
Query: 3833 DLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLY----------------------------------FNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDS 4351
            +L+     L E  R  P++   +   G  + L ++   A+K + +A+ +    C  AY   G  Y+   +L++A+ C+R  + SDP     W  + ++Y  Q K   +  +  +++S++P+S+ LY                                  F+RA++LF + +YQEA  +     +I P +  V    G    K G +
Sbjct:  540 ELSSLAHHLVEVDRSSPEA---WCATGNCFSLQKEHDTAIKFFQRAVQVDQ-ACTYAYTLLGHEYVLTEELDRAMSCYRMAIRSDPRHYNAWYGVGMIYYKQEKFNLAEVHFRKALSINPSSSVLYCHVGVVQHAMRKSEAALATINKAMLIDPKNPLCKFHRASILFSIDKYQEALHELEDLKKIVPREALVYFLIGKVYKKLGQA 742          

HSP 2 Score: 51.9878 bits (123), Expect = 2.063e-6
Identity = 53/222 (23.87%), Postives = 89/222 (40.09%), Query Frame = 2
Query: 3392 GLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQAL 4057
            G  + EL + Q A   F + Q + P+ L  + +       L+   E   +    ++ D     A  + GN F   +     D A K +   +++D     A   LG       +  +A   + MAI   P       G  ++  +    N A     +A+ I P SS+LY + GVV   MR    A+   NKA++I   K P+  F+   +     + ++AL
Sbjct:  495 GRAHFELAEYQLAEKVFSQVQHLDPSRLEGMEIYSTILWHLQKEVELSSLAHHLVEVDRSSPEAWCATGNCF---SLQKEHDTAIKFFQRAVQVDQACTYAYTLLGHEYVLTEELDRAMSCYRMAIRSDPRHYNAWYGVGMIYYKQEKFNLAEVHFRKALSINPSSSVLYCHVGVVQHAMRKSEAALATINKAMLIDP-KNPLCKFHRASILFSIDKYQEAL 712          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Medaka
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase [Source:NCBI gene;Acc:101164571])

HSP 1 Score: 96.2857 bits (238), Expect = 1.718e-19
Identity = 123/517 (23.79%), Postives = 212/517 (41.01%), Query Frame = 2
Query: 2840 PGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPR--CLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDL-QRYQEAELDFCSCL-RIAPDDPHVLKARG 4324
            P    +  L++  + + +   +S    +  +K NP  AEAY + G      G++++ I     AL + P     Y+  A           A+      L   P   C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  + +    A + YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++L++     NR  S+ P+ + LY    N    + +R+    LD  + L + A + P  LKA G
Sbjct:   42 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSE---AEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLDK-----NRLPSVHPHHSMLYPLSHNFRKAIAERHGNLCLDKINALHKPAYEHPKDLKASG 543          

HSP 2 Score: 77.411 bits (189), Expect = 9.777e-14
Identity = 101/476 (21.22%), Postives = 197/476 (41.39%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRL----------RLGKMKQGI---LDLNRALAINPRLYQAYLARATLFGFKNQYTKAI 3115
            AI+ +P  +EAYS    +Y++ G+ + A+E Y   +RL+P+           Y+N+    +AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +  N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C            R+ K+   +   LD NR  +++P         + L+   + + KAI
Sbjct:   71 AIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLDKNRLPSVHPH-------HSMLYPLSHNFRKAI 513          

HSP 3 Score: 75.8702 bits (185), Expect = 3.176e-13
Identity = 90/424 (21.23%), Postives = 160/424 (37.74%), Query Frame = 2
Query: 3119 NCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +C ++   EP      L    + ++ +    +    T AIK +     A+ N    +  E+   ++AI+ Y   L +          YIN     +  GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP                                     P AY N          + +A EC+   +   P       NLA +   Q  +EE+++   +++ + P  A  + N A+VL    + QEA + +   +RI+P         G+   +  D  GAL+ Y  ++ I
Sbjct:   33 HCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYK-ERGQLQEAIEHYRHALRLKPDF---IDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPH-----------------------------------FPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQI 414          

HSP 4 Score: 58.9214 bits (141), Expect = 4.958e-8
Identity = 86/461 (18.66%), Postives = 178/461 (38.61%), Query Frame = 2
Query: 1796 DSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYR---GILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAY 3166
            DS   ++ A    Q+G+   A     Q+ R +P+N   ++     +    +   +A   +  ++  P   EA+ + G  Y +  Q Q+A+  +   + L P+    Y      L  A       + ++   + + + N   Y  R   G L     +  EA   +   I    +   A  NLG ++  +G+   ++ +    +  DP ++ AY        +   ++ A+    RA+ L P+ +  +      Y   G +++A    R+A E+  +   +    A       +  +A +    A R  P+ A  LN L   + +    ++A+  +   LE            P  A  +  +A    +    +++ + +   ++I+P  A+AY + G     +  ++  +    RA+ INP    A+   A++        +AI +    L ++P    AY
Sbjct:   10 DSTGLAELAHREYQSGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAA----GDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVF----------PEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY 456          

HSP 5 Score: 55.8398 bits (133), Expect = 4.327e-7
Identity = 81/377 (21.49%), Postives = 141/377 (37.40%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIK----------DINRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            +PN A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A E YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++      ++D                   +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K          D NR   + P  S  Y L  +F  A+ +
Sbjct:  177 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSL--NNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE------MQDV------------------QGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVADQLDKNRLPSVHPHHSMLYPLSHNFRKAIAE 515          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Medaka
Match: ogt.1 (O-linked N-acetylglucosamine (GlcNAc) transferase [Source:NCBI gene;Acc:101164571])

HSP 1 Score: 83.1889 bits (204), Expect = 1.525e-15
Identity = 121/521 (23.22%), Postives = 206/521 (39.54%), Query Frame = 2
Query: 2840 PGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAY------YHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA------------------LVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDL-QRYQEAELDFCSCL-RIAPDDPHVLKARG 4324
            P    +  L++  + + +   +S    +  +K NP  AEAY      Y +    +  G M+  +     AL  NP LY                                C+R+ L  G L   +     A   + +AI+   N  +A+ N    FNA+ + +  AI  +   + +         AYIN G V  E      A+  ++RA ++ PN   V   +   +++   +  AI  + R ++  P F  A  +  N   +  + +    A + YN+ L +   H D+L NL   ++ QG  ++A  ++  A+E  P         A V  Q   L  AL    EAIRI P  +  Y N G   + M+D   A++ Y +AI I       A+ N   ++  +  + +A+  +R  ++  P     + NLA                  LV I  ++L++     NR  S+ P+ + LY    N    + +R+    LD  + L + A + P  LKA G
Sbjct:   42 PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERAALVAAGDMEGAVQAYVSALQYNPDLY--------------------------------CVRSDL--GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIW-LAIHHFEKAVTLDPNF---LDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSE---AEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFAD-AHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLDK-----NRLPSVHPHHSMLYPLSHNFRKAIAERHGNLCLDKINALHKPAYEHPKDLKASG 515          

HSP 2 Score: 72.7886 bits (177), Expect = 2.359e-12
Identity = 79/345 (22.90%), Postives = 133/345 (38.55%), Query Frame = 2
Query: 3374 KAYINRGLVYLE------LGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +AY N G VY E       GD++ A+  ++ A    P+   V   +G     L  L+EA   + + ++  P F +A  + G VF   N+     LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN        A V  +   ++ A+     AI +QP                                     P AY N          + +A EC+   +   P       NLA +   Q  +EE+++   +++ + P  A  + N A+VL    + QEA + +   +RI+P         G+   +  D  GAL+ Y  ++ I
Sbjct:   80 EAYSNLGNVYKERAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVF---NAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPH-----------------------------------FPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQI 386          

HSP 3 Score: 55.8398 bits (133), Expect = 4.047e-7
Identity = 81/377 (21.49%), Postives = 141/377 (37.40%), Query Frame = 2
Query: 1484 RPN-AFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL--AAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQM----NKYEDAIK----------DINRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            +PN A   S  G ++   G +  A      A++++P+ + AY     +         A+      L    N+ + + + A +Y   G I LAI    +AI L P   +AY   A   ++ G    A E YN  +RL P +  ++  + L  +  EQ  +  A + +   L  +P    A  +  +   +  + Q+AL  +   I + P    AY   G  L++      ++D                   +G L   T+            I  N     AH NL  I+ + G+  +++    + L   P +  AY C      Q+      Y++ +K          D NR   + P  S  Y L  +F  A+ +
Sbjct:  149 QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSL--NNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE------MQDV------------------QGALQCYTR-----------AIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAY-CNLAHCLQIVCDWTDYDERMKKLVSIVADQLDKNRLPSVHPHHSMLYPLSHNFRKAIAE 487          

HSP 4 Score: 55.4546 bits (132), Expect = 4.713e-7
Identity = 100/490 (20.41%), Postives = 194/490 (39.59%), Query Frame = 2
Query: 1736 TGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQL-AAKDFSSVLRHYPS----NTEAWLHR---GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRL----------RLGKMKQGI---LDLNRALAINPRLYQAYLARATLFGFKNQYTKAI 3115
            +GD   A  +  Q  R  PD++      + ++ Q    RL    +   + ++ N  LA     L  +  E+  L AA D    ++ Y S    N + +  R   G     L + ++A   +   I   PN  +A+   GC+   + E +LAI  F  ++ L+ +  +  +Y+  G +    + F  A+  +   +  + +    H NL  +Y+E+G  + ++      +   P +  AY   A A  +     +A +  N A+ L P  ++      +     G +E A    R+A E+         NL     QQ  +   L HY +AI       R  P+ A   + +G T  + +  + A+  +T  ++            P  A+ +  +A  + +  N  ++  ++   +K+ P+  +AY +   C            R+ K+   +   LD NR  +++P         + L+   + + KAI
Sbjct:   24 SGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCR--RLDRSAHFSTLAIKQNPMLAEAYSNLGNVYKERAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD--AYINLGNVLKEARIFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGNVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEEAVQLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAI-------RISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQ----------INPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLDKNRLPSVHPH-------HSMLYPLSHNFRKAI 485          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Medaka
Match: ttc13 (tetratricopeptide repeat domain 13 [Source:NCBI gene;Acc:101171797])

HSP 1 Score: 77.411 bits (189), Expect = 9.718e-14
Identity = 57/232 (24.57%), Postives = 111/232 (47.84%), Query Frame = 2
Query: 2888 LKNYKKSQLAF---SATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINP--RLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDP 3568
            L++ K + LA    +  + + PN  E Y  +      LG++ + + DL +A+ + P  RLY+    R TL      Y  A+ +    L ++     A LY+G+  +       AI+ F EA+K+ ++ I A+ +    +  E  ++E A++ +   L+++     H ++   RG++    G +Q AL +F R   ++P +    Y+ G+ H  +    E I+  T+ + +DP
Sbjct:  158 LQDIKNADLALYELNRVIALEPNWPEVYEQRAEILSPLGRISEALSDLTKAIQLQPSARLYR---HRGTLLFISEDYVAAMEDFQRSLELKKNQPIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFIDAYKSLGQAYR-ELGDFESAMESFQKALMMNQN---HIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDP 382          

HSP 2 Score: 73.9442 bits (180), Expect = 1.108e-12
Identity = 62/248 (25.00%), Postives = 115/248 (46.37%), Query Frame = 2
Query: 1838 NGEGRLALEDYNQIIRLQPNNCLAMMKHGLYY-----LNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLA-IRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            NG    A++ ++ +++  P    A+   G+ Y      +I+   LA  + + V+   P+  E +  R    + L +  +AL+D +  I L P+  L Y  RG LL  +E Y+A + DF     LE  +   ++ +Y+G+ Y       EAI  F+  +    D   A+ +LG  Y E GDFE +++     L  +  +I++   R    +     ++A+ +  R + L P       ++G  ++AMG+
Sbjct:  122 NGLYDEAIKHFSLLLQNDPELVSAIYGRGIAYGKKSLQDIKNADLALYELNRVIALEPNWPEVYEQRAEILSPLGRISEALSDLTKAIQLQPSARL-YRHRGTLLFISEDYVAAMEDFQ--RSLELKKNQPIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFIDAYKSLGQAYRELGDFESAMESFQKALMMNQNHIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEPYNEVCQYMKGLSHVAMGQ 366          

HSP 3 Score: 72.4034 bits (176), Expect = 3.462e-12
Identity = 64/258 (24.81%), Postives = 119/258 (46.12%), Query Frame = 2
Query: 3527 EAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKT--VESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAP 4294
            EAI+ F+  L +DP+ + A   RG   + Y   + +D+   D      +  Y L+ ++ L                        PN     + RA +   +  ++ AL DL +AI++QP S+ LY +RG +  +  D + AM+D+ +++ +   + PIA    G  Y H   L++A+E F++   ++SD +D   + +L   Y      E ++E   +++ ++ N       R  +L+     QEA  +F  CL++ P
Sbjct:  127 EAIKHFSLLLQNDPELVSAIYGRG---IAYGKKSLQDIKNAD------LALYELNRVIAL-----------------------EPNWPEVYEQRAEILSPLGRISEALSDLTKAIQLQP-SARLYRHRGTLLFISEDYVAAMEDFQRSLELKKNQ-PIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFID--AYKSLGQAYRELGDFESAMESFQKALMMNQNHIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEP 348          

HSP 4 Score: 63.929 bits (154), Expect = 1.295e-9
Identity = 68/262 (25.95%), Postives = 110/262 (41.98%), Query Frame = 2
Query: 1652 AIEDLNLILKKDKNYVLAYKSRAGIYA--STGDIS---LAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDF-----SIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADP 2407
            AI+  +L+L+ D   V A   R   Y   S  DI    LA+  L++ I L P+  E Y +RAE+    G    AL D  + I+LQP+  L   +  L +++ E +  A +DF   L    +   A L++G  Y      ++A+  F   + L  +   AY   G      + Y  + DF     S    L  ++ +I S   RG++        EA+ +F+  +             GL +   G F + +K  T  +  DP
Sbjct:  128 AIKHFSLLLQNDPELVSAIYGRGIAYGKKSLQDIKNADLALYELNRVIALEPNWPEVYEQRAEILSPLGRISEALSDLTKAIQLQPSARLYRHRGTLLFIS-EDYVAAMEDFQRSLELKKNQPIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFIDAYKSLG------QAYRELGDFESAMESFQKALMMNQNHIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDP 382          

HSP 5 Score: 53.9138 bits (128), Expect = 1.378e-6
Identity = 49/209 (23.44%), Postives = 99/209 (47.37%), Query Frame = 2
Query: 1379 IEPVLDEVDEEFRGALFETL---LEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYP 1996
            +EP   EV E+ R  +   L    E + +++K ++   +P+A L   RG L       VAA +D   ++ ++ +  IA   + L +     ++ AIE     LK   +++ AYKS    Y   GD   A+ +  +A+ ++ +  ++   R  +   +G  + AL ++ + ++L+P N +     GL ++ + Q+    K  + V+ + P
Sbjct:  177 LEPNWPEVYEQ-RAEILSPLGRISEALSDLTKAIQ--LQPSARLYRHRGTLLFISEDYVAAMEDFQRSLELKKNQPIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFIDAYKSLGQAYRELGDFESAMESFQKALMMNQNHIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDP 382          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Medaka
Match: ttc13 (tetratricopeptide repeat domain 13 [Source:NCBI gene;Acc:101171797])

HSP 1 Score: 77.0258 bits (188), Expect = 1.111e-13
Identity = 57/232 (24.57%), Postives = 111/232 (47.84%), Query Frame = 2
Query: 2888 LKNYKKSQLAF---SATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINP--RLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDP 3568
            L++ K + LA    +  + + PN  E Y  +      LG++ + + DL +A+ + P  RLY+    R TL      Y  A+ +    L ++     A LY+G+  +       AI+ F EA+K+ ++ I A+ +    +  E  ++E A++ +   L+++     H ++   RG++    G +Q AL +F R   ++P +    Y+ G+ H  +    E I+  T+ + +DP
Sbjct:  158 LQDIKNADLALYELNRVIALEPNWPEVYEQRAEILSPLGRISEALSDLTKAIQLQPSARLYR---HRGTLLFISEDYVAAMEDFQRSLELKKNQPIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFIDAYKSLGQAYR-ELGDFESAMESFQKALMMNQN---HIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDP 382          

HSP 2 Score: 73.559 bits (179), Expect = 1.214e-12
Identity = 62/248 (25.00%), Postives = 115/248 (46.37%), Query Frame = 2
Query: 1838 NGEGRLALEDYNQIIRLQPNNCLAMMKHGLYY-----LNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLA-IRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGK 2563
            NG    A++ ++ +++  P    A+   G+ Y      +I+   LA  + + V+   P+  E +  R    + L +  +AL+D +  I L P+  L Y  RG LL  +E Y+A + DF     LE  +   ++ +Y+G+ Y       EAI  F+  +    D   A+ +LG  Y E GDFE +++     L  +  +I++   R    +     ++A+ +  R + L P       ++G  ++AMG+
Sbjct:  122 NGLYDEAIKHFSLLLQNDPELVSAIYGRGIAYGKKSLQDIKNADLALYELNRVIALEPNWPEVYEQRAEILSPLGRISEALSDLTKAIQLQPSARL-YRHRGTLLFISEDYVAAMEDFQ--RSLELKKNQPIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFIDAYKSLGQAYRELGDFESAMESFQKALMMNQNHIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEPYNEVCQYMKGLSHVAMGQ 366          

HSP 3 Score: 72.4034 bits (176), Expect = 3.426e-12
Identity = 64/258 (24.81%), Postives = 119/258 (46.12%), Query Frame = 2
Query: 3527 EAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKT--VESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAP 4294
            EAI+ F+  L +DP+ + A   RG   + Y   + +D+   D      +  Y L+ ++ L                        PN     + RA +   +  ++ AL DL +AI++QP S+ LY +RG +  +  D + AM+D+ +++ +   + PIA    G  Y H   L++A+E F++   ++SD +D   + +L   Y      E ++E   +++ ++ N       R  +L+     QEA  +F  CL++ P
Sbjct:  127 EAIKHFSLLLQNDPELVSAIYGRG---IAYGKKSLQDIKNAD------LALYELNRVIAL-----------------------EPNWPEVYEQRAEILSPLGRISEALSDLTKAIQLQP-SARLYRHRGTLLFISEDYVAAMEDFQRSLELKKNQ-PIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFID--AYKSLGQAYRELGDFESAMESFQKALMMNQNHIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEP 348          

HSP 4 Score: 63.5438 bits (153), Expect = 1.431e-9
Identity = 66/257 (25.68%), Postives = 110/257 (42.80%), Query Frame = 2
Query: 1652 AIEDLNLILKKDKNYVLAYKSRAGIYA--STGDIS---LAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADP 2407
            AI+  +L+L+ D   V A   R   Y   S  DI    LA+  L++ I L P+  E Y +RAE+    G    AL D  + I+LQP+  L   +  L +++ E +  A +DF   L    +   A L++G  Y      ++A+  F   + L  +   AY   G   R+   + +  + S    L  ++ +I S   RG++        EA+ +F+  +             GL +   G F + +K  T  +  DP
Sbjct:  128 AIKHFSLLLQNDPELVSAIYGRGIAYGKKSLQDIKNADLALYELNRVIALEPNWPEVYEQRAEILSPLGRISEALSDLTKAIQLQPSARLYRHRGTLLFIS-EDYVAAMEDFQRSLELKKNQPIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFIDAYKSLGQAYRELGDFESAME-SFQKALMMNQNHIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDP 382          

HSP 5 Score: 53.9138 bits (128), Expect = 1.330e-6
Identity = 49/209 (23.44%), Postives = 99/209 (47.37%), Query Frame = 2
Query: 1379 IEPVLDEVDEEFRGALFETL---LEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYP 1996
            +EP   EV E+ R  +   L    E + +++K ++   +P+A L   RG L       VAA +D   ++ ++ +  IA   + L +     ++ AIE     LK   +++ AYKS    Y   GD   A+ +  +A+ ++ +  ++   R  +   +G  + AL ++ + ++L+P N +     GL ++ + Q+    K  + V+ + P
Sbjct:  177 LEPNWPEVYEQ-RAEILSPLGRISEALSDLTKAIQ--LQPSARLYRHRGTLLFISEDYVAAMEDFQRSLELKKNQPIAMLYKGLTYFHRGMLKEAIETFKEALKLKSDFIDAYKSLGQAYRELGDFESAMESFQKALMMNQNHIQSLQLRGMMLYHHGSLQEALGNFKRCLQLEPYNEVCQYMKGLSHVAMGQFYEGIKAQTKVMLNDP 382          
BLAST of TPR_REGION domain-containing protein vs. Ensembl Medaka
Match: DNAJC7 (dnaJ homolog subfamily C member 7 [Source:NCBI gene;Acc:101160690])

HSP 1 Score: 74.3294 bits (181), Expect = 4.447e-13
Identity = 77/352 (21.88%), Postives = 143/352 (40.62%), Query Frame = 2
Query: 2333 GLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLA---RATLFGFKNQYTKAILNCN---------EVLSIEPRCLRA----YLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIV 3340
            G  Y+ K D+  +  Y T  + A P     Y  RA     + ++ +A++D  +A+ L       ++  G  +L++G    AA C ++  E+  +  ++  ++    + L+ Y++  D                            K       +C+++           P       L A C   L  Y ++Q   S  ++++  +A+A Y +G C      + + +    +AL + P   +A LA      L   K +  +   NC+         E L+I+P  ++     Y  R     K+K +  AI D T+AIK+D   I A+  RA C+  + + YE+A++DY  V
Sbjct:   49 GNAYYSKKDYPAAFNYYTKAIDASPKTASYYGNRAATLMMLCRFREALEDSQQAVRLDDGFMKGHLREGKCHLSLGNAMAAARCFQKVLELEPSNKEAQQEKKNATTLLE-YERMADFSFD------------------------KRDFRKVVYCMDRAIA------LAPTCQRFKILKAECLALLGRYPEAQSVASDILRMDATNADALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHEKARLACRNAKALKAKKEEGNQVFKNCSYDAAYQLYTEALAIDPNNIKTNAKLYCNRATAGAKLKKFDQAIDDCTKAIKLDDTYIKAYLRRAQCY-MDTELYEEAVRDYEKV 368          

HSP 2 Score: 53.9138 bits (128), Expect = 1.193e-6
Identity = 80/332 (24.10%), Postives = 123/332 (37.05%), Query Frame = 2
Query: 1643 IQMAIEDLNLILKKDK--NYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTA-----YAKLQQWQDALTDFSAVIH-------LDPN-NYLAYFKRGCLL---RKAEPYLAIRDFSIXXXXXXXXXNI--MSYMYRGILYATTKQFSEAI---VDFEV--VICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRA----YPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYL 2551
            I M +E  + I  +D        +K +   Y S  D   A +  ++AI  SP  +  Y  RA         R ALED  Q +RL        ++ G  +L++     AA+ F  VL   PSN EA   +  A     Y ++  +     DF  V++       L P        K  CL    R  E      D        +    +  +   Y   +    + F +A+    D E   + C N     A    G   F+   ++ + +  T  LA DP  I+     Y  RA A  ++ K++ AI D  +AI L       Y+ R   Y+
Sbjct:   22 IDMPVEPESQIRSQDDLDRQAEIFKEQGNAYYSKKDYPAAFNYYTKAIDASPKTASYYGNRAATLMMLCRFREALEDSQQAVRLDDGFMKGHLREGKCHLSLGNAMAAARCFQKVLELEPSNKEAQQEKKNATTLLEYERMADFSFDKRDFRKVVYCMDRAIALAPTCQRFKILKAECLALLGRYPEAQSVASDILRMDATNADALYVRGLCLYYEDCIDKAVQFFVQALRMAPDHEKARLACRNAKALKAKKEEGNQVFKNCSYDAAYQLYTEALAIDPNNIKTNAKLYCNRATAGAKLKKFDQAIDDCTKAIKLDDTYIKAYLRRAQCYM 353          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000071973.1 (SMESG000071973.1)

HSP 1 Score: 2878.97 bits (7462), Expect = 0.000e+0
Identity = 1422/1423 (99.93%), Postives = 1423/1423 (100.00%), Query Frame = 2
Query:  122 KDVSASSVERIEKAAERIISQKNEIEKWRTKANEMLNLTSEIEIVGTFISPSEPKIIDIWQPLAPRLFMSQNQVTNVLCPKYNPNIFEPTIEEVSKQNTFENFTSEDLTLSNEASFCNEIDLEALETKERLLSRKINSVECLADERIDENKFSKIIHQRKRCTSVPNRHWLEEDSLIVHLEYHQIMDEINIQRQKIRALKNTSEINEDINEKKPLEEDEKIFNDNFDSGILTTNVENEYKTHQSVKSIEDDCSSPAKNALRAGQNYIYYXXXXXXXXXXXXXXNIARISDIERFLGQPPNKLDKTKSFENIRIELKRIRSCXXXXXXXXXXXXXXXXADIHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            KDVSASSVERIEKAAERIISQKNEIEKWRTKANEMLNLTSEIEIVGTFISPSEPKIIDIWQPLAPRLFMSQNQVTNVLCPKYNPNIFEPTIEEVSKQNTFENFTSEDLTLSNEASFCNEIDLEALETKERLLSRKINSVECLADERIDENKFSKIIHQRKRCTSVPNRHWLEEDSLIVHLEYHQIMDEINIQRQKIRALKNTSEINEDINEKKPLEEDEKIFNDNFDSGILTTNVENEYKTHQSVKSIEDDCSSPAKNALRAGQNYIYYPPKKRSKSKPKKSKNIARISDIERFLGQPPNKLDKTKSFENIRIELKRIRSCKSREKSDLKKSLSKSLADIHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSISLLLESSEENIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGW+NLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI
Sbjct:  452 KDVSASSVERIEKAAERIISQKNEIEKWRTKANEMLNLTSEIEIVGTFISPSEPKIIDIWQPLAPRLFMSQNQVTNVLCPKYNPNIFEPTIEEVSKQNTFENFTSEDLTLSNEASFCNEIDLEALETKERLLSRKINSVECLADERIDENKFSKIIHQRKRCTSVPNRHWLEEDSLIVHLEYHQIMDEINIQRQKIRALKNTSEINEDINEKKPLEEDEKIFNDNFDSGILTTNVENEYKTHQSVKSIEDDCSSPAKNALRAGQNYIYYPPKKRSKSKPKKSKNIARISDIERFLGQPPNKLDKTKSFENIRIELKRIRSCKSREKSDLKKSLSKSLADIHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPIPDHIIDLTSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVDEEFRGALFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSISLLLESSEENIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWINLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 1874          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000002813.1 (SMESG000002813.1)

HSP 1 Score: 97.4413 bits (241), Expect = 5.534e-20
Identity = 109/478 (22.80%), Postives = 187/478 (39.12%), Query Frame = 2
Query: 2885 ELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYL-------YRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPD 4297
            +L NY+K++       K++PN++           +L K+ +       A+  NP++ +AY     +F  K Q  +AI    + L ++P  + AY+         G L   I  Y L +    E   + +  +   F         K  Y KAI+ Y    +          A+ N G ++   GD+  A+H F +A  + PN L     +G    + K    A+  +T+ L  D       +  GN+   Y      DLA   Y   +E+     DA  NL    + +G   +A   +  A+  +PN    L+  A +  +      A+    +A+ I P+ ++ + N   + QL      A+  Y +AI I       AY N G  +     L  A++C+++ ++  P       NLA VY     + E+I     ++ + PN                 Y EA  +   CL+I  D
Sbjct:   23 QLGNYEKAEKYCLEIWKLDPNNSAILLFLSSVYFQLKKLDKSAFFCQLAIKQNPQMAEAYSNLGNVFKEKGQLIEAISFYKQALQLKPNFIDAYINLASAFVAAGNLDNAISTYILVLNHNPELYHVRSE-LGNLFKALGKLEEAKSCYLKAIETYPAFAV----------AWSNVGCIFNAQGDIWLAIHHFEKAVTLDPNFLDAHVNLGHVFKEAKIFDRAVAAYTKALTLDSD---NPILHGNLACVYYEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANIKREQGLNEEAMNLYKKALEIYPEFAVAHSNLASMLQLQGHLQSALNHYREAIKISP-NFADAYSNMGNTFKELQDLPNAVQCYQRAIQIKPTFADAHSNLASVYKDTGNINEAIGSYTTALKIKPN-----------------YPEAFCNLTHCLQIVCD 468          

HSP 2 Score: 79.337 bits (194), Expect = 2.127e-14
Identity = 102/434 (23.50%), Postives = 175/434 (40.32%), Query Frame = 2
Query: 3101 YTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCM----QMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            Y KA   C E+  ++P      L+   + +++K    +      AIK +     A+ N    F  EK    +AI  Y   L +         AYIN    ++  G++ NA+  +I      P   +V   +G     L  L+EA   + + ++  P F +A  + G +F   N+     LA   +   + +D   LDA VNLG   +    F +A   +T A+    +S+ P+    + C+     + DL  A+    +AI +QP     Y N     +   + + A K YN A+ +       +  N   +       E+A+  ++K +E  P       NLA +   Q  L+ ++ +   +I +SPN A  Y N  N   +LQ    A   +   ++I P               TG+   A+  Y T++ I
Sbjct:   27 YEKAEKYCLEIWKLDPNNSAILLFLSSVYFQLKKLDKSAFFCQLAIKQNPQMAEAYSNLGNVFK-EKGQLIEAISFYKQALQLKPNF---IDAYINLASAFVAAGNLDNAISTYILVLNHNPELYHVRSELGNLFKALGKLEEAKSCYLKAIETYPAFAVAWSNVGCIF---NAQGDIWLAIHHFEKAVTLDPNFLDAHVNLGHVFKEAKIFDRAVAAYTKALTL--DSDNPILHGNLACVYYEQGLYDL--AIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHAD-SLNNLANIKREQGLNEEAMNLYKKALEIYPEFAVAHSNLASMLQLQGHLQSALNHYREAIKISPNFADAYSNMGNTFKELQDLPNAVQCYQRAIQIKPTFADAHSNLASVYKDTGNINEAIGSYTTALKI 448          

HSP 3 Score: 71.2478 bits (173), Expect = 6.072e-12
Identity = 81/356 (22.75%), Postives = 147/356 (41.29%), Query Frame = 2
Query: 3344 LISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEA-------IRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +IS AL   ++ Y        +LG+ + A    +    + PN+  +L  +   + +LK L ++       +  +P+   A  + GNVF +         A   Y   L++    +DA +NL     A G    A   + + +  +P           V  ++ +L  AL  L EA       I   P  ++ + N G ++    D  +A+  + KA+ +       A+ N G V+      ++A+  + K +  D  +     NLA VY  Q   + +I+   ++I L PN    Y N AN L +     EAE  + + LR+ P+    L    + + + G +  A+  YK ++ I
Sbjct:   10 MISQALSFAHREY--------QLGNYEKAEKYCLEIWKLDPNNSAILLFLSSVYFQLKKLDKSAFFCQLAIKQNPQMAEAYSNLGNVFKE---KGQLIEAISFYKQALQLKPNFIDAYINLASAFVAAGNLDNAISTYILVLNHNPELYH-------VRSELGNLFKALGKLEEAKSCYLKAIETYPAFAVAWSNVGCIFNAQGDIWLAIHHFEKAVTLDP-NFLDAHVNLGHVFKEAKIFDRAVAAYTKALTLDSDNPILHGNLACVYYEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANIKREQGLNEEAMNLYKKALEI 346          

HSP 4 Score: 68.1662 bits (165), Expect = 4.923e-11
Identity = 91/445 (20.45%), Postives = 169/445 (37.98%), Query Frame = 2
Query: 1670 LILKKDKNYVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI-------SHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSVA-LLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWC 2980
            L +K++     AY +   ++   G +  AIS   QA++L P+  +AY   A  +   G    A+  Y  ++   P       + G  +  + + + A   +   +  YP+   AW + G  +        A+  F   + LDPN   A+   G + ++A                                   K F  A+  +   +  + D    H NL  +Y+E+G ++ ++      +   P +  AY   A A  +     +A K  N A+ L P+ ++      +     G  E A    ++A EI         NL      Q  + S L HY +AI       +  P+ A   + +G T  + +   +A+  +   + Q+KP      +    +NL    A  Y +  N  ++  +++  +KI PN+ EA+ +   C
Sbjct:   70 LAIKQNPQMAEAYSNLGNVFKEKGQLIEAISFYKQALQLKPNFIDAYINLASAFVAAGNLDNAISTYILVLNHNPELYHVRSELGNLFKALGKLEEAKSCYLKAIETYPAFAVAWSNVGCIFNAQGDIWLAIHHFEKAVTLDPNFLDAHVNLGHVFKEA-----------------------------------KIFDRAVAAYTKALTLDSDNPILHGNLACVYYEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANIKREQGLNEEAMNLYKKALEIYPEFAVAHSNLASMLQLQGHLQSALNHYREAI-------KISPNFADAYSNMGNTFKELQDLPNAVQCYQRAI-QIKPT-----FADAHSNL----ASVYKDTGNINEAIGSYTTALKIKPNYPEAFCNLTHC 462          

HSP 5 Score: 63.5438 bits (153), Expect = 1.200e-9
Identity = 102/460 (22.17%), Postives = 182/460 (39.57%), Query Frame = 2
Query: 2222 MYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEIS-------HNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSV--ALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKF 3574
            ++   +Y   K+  ++    ++ I  N  M  A+ NLG ++ EKG   +++ +    L   P +I AY   A A+      ++AI      ++  P+  +     G+ + A+GK+E A  C  +A E          N+G     Q  +   + H+++A+          P+   A +N LG    +AK +  A+ ++T  L  L   N     P    NL    A  Y E   Y  +  ++   +++ PN  +AY +        G + +     N AL +NP    +    A +   +    +A+    + L I P    A+     +         A+  + EAIKI  N   A+ N    F  E ++   A+Q Y   + I         A+ N   VY + G++  A+  +  A  I+PN     Y    C     NL   +++     D+D + 
Sbjct:   49 LFLSSVYFQLKKLDKSAFFCQLAIKQNPQMAEAYSNLGNVFKEKGQLIEAISFYKQALQLKPNFIDAYINLASAFVAAGNLDNAISTYILVLNHNPELYHVRSELGNLFKALGKLEEAKSCYLKAIETYPAFAVAWSNVGCIFNAQGDIWLAIHHFEKAVTL-------DPNFLDAHVN-LGHVFKEAKIFDRAVAAYTKAL-TLDSDN-----PILHGNL----ACVYYEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLEAEKCYNTALRLNPNHADSLNNLANIKREQGLNEEAMNLYKKALEIYPEFAVAHSNLASMLQLQGHLQSALNHYREAIKISPNFADAYSNMGNTFK-ELQDLPNAVQCYQRAIQIKPTF---ADAHSNLASVYKDTGNINEAIGSYTTALKIKPN-----YPEAFC-----NLTHCLQIVCDWADYDTRM 476          

HSP 6 Score: 53.5286 bits (127), Expect = 1.386e-6
Identity = 99/473 (20.93%), Postives = 188/473 (39.75%), Query Frame = 2
Query: 2345 FEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKPSV-ALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLV---ARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAI---NPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYL-YRGVLKYKIKAYSLAIKDFTEAIKIDANCI-----LAFFNRAVCFNAEKKN-YEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQ 3721
            ++ G++EK+ KY       DP         +  YFQ+ K + +      AI   P  +  Y   G+ +   G++  A    +QA ++  N   + +  A       + D AI   ++     P +  + + LG       + ++A + +      LK    Y  +    +N+  +       +L + +++K+       V ++PN  +A+ + G          + +    +AL +   NP L+      A ++  +  Y  AI +  + + ++P    AY      LK K      A K +  A++++ N       LA   R    N E  N Y+KA++ Y    +          A+ N   +    G +Q+AL+ +  A  I PN       +G    +L++L  A++ + R +   P F  A  +  +V+ D  + N    A   Y + L+I   + +A  NL  C Q
Sbjct:   22 YQLGNYEKAEKYCLEIWKLDPNNSAILLFLSSVYFQLKKLDKSAFFCQLAIKQNPQMAEAYSNLGNVFKEKGQLIEAISFYKQALQLKPNFIDAYINLASAFVAAGNLDNAISTYILVLNHNPELYHVRSELGNLFKALGKLEEAKSCY------LKAIETYPAFAVAWSNVGCIFNAQGDIWLAIHHFEKA-------VTLDPNFLDAHVNLGHVFKEAKIFDRAVAAYTKALTLDSDNPILHGNL---ACVYYEQGLYDLAIDSYRKAIELQPNFPDAYCNLANALKEKGNVLE-AEKCYNTALRLNPNHADSLNNLANIKREQGLNEEAMNLYKKALEIYPEFAV----------AHSNLASMLQLQGHLQSALNHYREAIKISPNFADAYSNMGNTFKELQDLPNAVQCYQRAIQIKPTFADAHSNLASVYKDTGNINE---AIGSYTTALKIKPNYPEAFCNLTHCLQ 464          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000004465.1 (SMESG000004465.1)

HSP 1 Score: 95.5153 bits (236), Expect = 7.116e-20
Identity = 107/434 (24.65%), Postives = 177/434 (40.78%), Query Frame = 2
Query: 2840 PGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKK------NYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKE-AIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLA 4120
            P    +  L++  Y +++   KS       +K NP  AEAY + G      G++ + I +   AL I P     YL  A  F        AI     VL+  P         G L   +     A   + +AI+      +A+ N    FNA+ +      ++EKA+      L           AY+N G V+ E      A+  +++A  + PN+  +++    C +  +NL E AI  + R ++  P F  A  +  N   +    +    A + YN+ L +   H D+L NL   ++ Q   ++A  ++  A+E +P         A +      LN AL    EAIRI P  +  Y N G   + M+D   AM+ Y +AI I       A+ N   +Y     +  A+  ++  ++  P     + NLA
Sbjct:   44 PHNTAILLLLSSIYFQMRKLDKSGFFCQLAIKQNPQMAEAYSNLGNVLKEKGQLAEAIENYKHALRIKPEFIDGYLNLAAAFVAAGHMESAISTYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSEIWLAIHHFEKAVSLDPNFL----------DAYLNLGNVFKEARIFDRAVTAYLKALNLAPNNA-IIHGNLACVYYEQNLVELAIDTYKRAIELQPNFPDAYCNLANALKEKGKVSE---AEECYNTALRLQPTHADSLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASMLQLQGKLNEALMHYREAIRISPNFADAYSNMGNTLKEMQDINGAMQCYQRAIQINPTFAD-AHSNLASIYKDTGNINDAISSYKTALKIKPNYHDAFCNLA 462          

HSP 2 Score: 78.9518 bits (193), Expect = 1.350e-14
Identity = 97/431 (22.51%), Postives = 173/431 (40.14%), Query Frame = 2
Query: 3098 QYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
             Y +A  +C ++  IEP      L    + ++++    +      AIK +     A+ N       EK    +AI++Y   L I          Y+N    ++  G +++A+  ++      P+  YV   +G     L  L EA   + + ++  P+F +A  + G VF   N+ +   LA   +   + +D   LDA +NLG   +    F +A   +  A+   PN+       A V  + + +  A+     AI +QP     Y N     +       A + YN A+ +       +  N   +       E+A++ + + +E  P       NLA +   Q KL E++ +   +I +SPN A  Y N  N L ++Q    A   +   ++I P               TG+   A+  YKT++ I
Sbjct:   28 HYERAEKHCIDLWKIEPHNTAILLLLSSIYFQMRKLDKSGFFCQLAIKQNPQMAEAYSNLGNVLK-EKGQLAEAIENYKHALRIKPEF---IDGYLNLAAAFVAAGHMESAISTYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVF---NAQSEIWLAIHHFEKAVSLDPNFLDAYLNLGNVFKEARIFDRAVTAYLKALNLAPNNAIIHGNLACVYYEQNLVELAIDTYKRAIELQPNFPDAYCNLANALKEKGKVSEAEECYNTALRLQPTHAD-SLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASMLQLQGKLNEALMHYREAIRISPNFADAYSNMGNTLKEMQDINGAMQCYQRAIQINPTFADAHSNLASIYKDTGNINDAISSYKTALKI 450          

HSP 3 Score: 74.3294 bits (181), Expect = 3.769e-13
Identity = 83/366 (22.68%), Postives = 153/366 (41.80%), Query Frame = 2
Query: 3314 KAIQDYSIVLLISDALHLHYKAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNLKEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEIDSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCMQMSDLNGALKDLNEA-------IRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAIIIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLALVYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFCSCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYI 4390
            +AIQ+    + + +  H  Y+A           G  + A    I    I+P++  +L ++   + +++ L ++       +  +P+   A  + GNV  +         A ++Y   L I    +D  +NL     A G  + A   + + +  +P+          V   + +L  AL  L+EA       I   PQ ++ + N G V+    +  +A+  + KA+ +       AY N G V+      ++A+  + K +   P +     NLA VY  QN +E +I+   R+I L PN    Y N AN L +  +  EAE  + + LR+ P     L    + + +   S  A++ Y  ++ I
Sbjct:    5 QAIQNGMTTMQVLELAHREYQA-----------GHYERAEKHCIDLWKIEPHNTAILLLLSSIYFQMRKLDKSGFFCQLAIKQNPQMAEAYSNLGNVLKEKGQLAE---AIENYKHALRIKPEFIDGYLNLAAAFVAAGHMESAISTYMIVLNNNPD-------LYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSEIWLAIHHFEKAVSLDP-NFLDAYLNLGNVFKEARIFDRAVTAYLKALNLAPNNAIIHGNLACVYYEQNLVELAIDTYKRAIELQPNFPDAYCNLANALKEKGKVSEAEECYNTALRLQPTHADSLNNLANIKREQCHSEEAMQLYVRALEI 348          

HSP 4 Score: 59.6918 bits (143), Expect = 1.312e-8
Identity = 89/399 (22.31%), Postives = 161/399 (40.35%), Query Frame = 2
Query: 2282 EVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLR---GDFYLAMGKMEMAAICVRQAAEIS-------HNLG-----QSPVQQALVH---------SFLQHY-------------DQAIDALLVATRGKPSVALLNL-LGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLARATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKDFTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALH 3364
            ++ I  N  M  A+ NLG +  EKG   ++++     L   P +I  Y   A A+      E AI      ++  PD    Y +R   G+ + A+G+++ A  C  +A E          NLG     QS +  A+ H         +FL  Y             D+A+ A L A    P+ A+++  L     +    + AI ++   +E L+P      +P    NL    A    E     +++  ++  +++ P HA++  +    +      ++ +    RAL I P    A+   A++   + +  +A+++  E + I P    AY   G    +++  + A++ +  AI+I+     A  N A  +  +  N   AI  Y   L I    H
Sbjct:   71 QLAIKQNPQMAEAYSNLGNVLKEKGQLAEAIENYKHALRIKPEFIDGYLNLAAAFVAAGHMESAISTYMIVLNNNPD---LYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSEIWLAIHHFEKAVSLDPNFLDAYLNLGNVFKEARIFDRAVTAYLKALNLAPNNAIIHGNLACVYYEQNLVELAIDTYKRAIE-LQPN-----FPDAYCNL----ANALKEKGKVSEAEECYNTALRLQPTHADSLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASMLQLQGKLNEALMHYREAIRISPNFADAYSNMGNTLKEMQDINGAMQCYQRAIQINPTFADAHSNLASIYK-DTGNINDAISSYKTALKIKPNYH 455          

HSP 5 Score: 58.151 bits (139), Expect = 3.906e-8
Identity = 85/433 (19.63%), Postives = 159/433 (36.72%), Query Frame = 2
Query: 1775 AIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLR-KAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQSPVQQALVHSFLQHYDQAIDALLVATRGKP--SVALLNLLGTTQMKAKRWKDAITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFSATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAY 3064
            AI+ +P  +EAYS    + ++ G+   A+E+Y   +R++P      +     ++     + A   +  VL + P         G  +  L +  +A + +   I   P   +A+   GC+   ++E +LAI  F                                    E  +  + +   A++NLG ++ E   F+++V      L   P     +   A  Y++ N  E AI    RAI L P+  + Y    +     GK+  A  C   A  +      S    A +     H ++A+   + A    P  +VA  NL    Q++ K   +A+  +   +             P  A+    +     E+++   +   +   ++INP  A+A+ +        G +   I     AL I P  + A+
Sbjct:   73 AIKQNPQMAEAYSNLGNVLKEKGQLAEAIENYKHALRIKPEFIDGYLNLAAAFVAAGHMESAISTYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSEIWLAIHHF------------------------------------EKAVSLDPNFLDAYLNLGNVFKEARIFDRAVTAYLKALNLAPNNAIIHGNLACVYYEQNLVELAIDTYKRAIELQPNFPDAYCNLANALKEKGKVSEAEECYNTALRLQPTHADSLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASMLQLQGK-LNEALMHYREAIR----------ISPNFADAYSNMGNTLKEMQDINGAMQCYQRAIQINPTFADAHSNLASIYKDTGNINDAISSYKTALKIKPNYHDAF 458          

HSP 6 Score: 53.1434 bits (126), Expect = 1.549e-6
Identity = 69/386 (17.88%), Postives = 144/386 (37.31%), Query Frame = 2
Query: 1472 ENYQRPNAFLLSRRGALYRKMGYLVAASKDINDAISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKN----------------------------------YVLAYKSRAGIYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYNQIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPN-----NYLAYFKRGCLLRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAHVNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPD 2512
            +N Q   A+  S  G + ++ G L  A ++   A+ I+P+ I  Y       +    ++ AI    ++L  + +                                  + +A+ +   ++ +  +I LAI +  +A+ L P+  +AY     ++++      A+  Y + + L PNN +        Y      +LA   +   +   P+  +A+ +   A  +  +  +A   ++  + L P      N LA  KR     +    L +R   I      +  N+ S +          + +EA++ +   I  + +   A+ N+G    E  D   +++     +  +PT+  A+   A  Y       DAI     A+ + P+
Sbjct:   76 QNPQMAEAY--SNLGNVLKEKGQLAEAIENYKHALRIKPEFIDGYLNLAAAFVAAGHMESAISTYMIVLNNNPDLYYVRSDLGNLFKALGRLDEAKSCYLKAIETCPQFAVAWSNLGCVFNAQSEIWLAIHHFEKAVSLDPNFLDAYLNLGNVFKEARIFDRAVTAYLKALNLAPNNAIIHGNLACVYYEQNLVELAIDTYKRAIELQPNFPDAYCNLANALKEKGKVSEAEECYNTALRLQPTHADSLNNLANIKREQCHSEEAMQLYVRALEIYPEFAVAHSNLASML------QLQGKLNEALMHYREAIRISPNFADAYSNMGNTLKEMQDINGAMQCYQRAIQINPTFADAHSNLASIYKDTGNINDAISSYKTALKIKPN 453          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000040140.1 (SMESG000040140.1)

HSP 1 Score: 58.151 bits (139), Expect = 5.225e-8
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 2
Query: 1922 GLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLA 2113
            GL Y+  + W+ A +D S  L+  PSN +A   R + Y+++   QDA+TD   +I L PNN  A
Sbjct:  259 GLVYMKQKNWEEAIRDLSITLKKDPSNIKALQRRASCYSEIHNLQDAITDCRKIIKLSPNNKFA 322          
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000009124.1 (SMESG000009124.1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.844e-7
Identity = 54/217 (24.88%), Postives = 90/217 (41.47%), Query Frame = 2
Query: 1994 PSNTEAWLHRGTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCL-LRKAEPYLAIRDFSIXXXXXXXXXNIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAH---VNLGLI---------YFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDAIKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEI 2605
            P + + +L  GT      Q  DAL  +   +  DPNNYL Y++R  + L   +   AI D S SLLL+ +   I +   R  LY    + SEA  D  +++    +   A    VN+G I         Y+E   FE ++ Y+   +            RA +Y +    + AI D   A+ L  D  +  +         G  + + + +R+  ++
Sbjct:   28 PGDVDKYLQTGTRLLAAGQLLDALVQYDKAVEGDPNNYLIYYRRATVFLAMGKTKSAIEDLSNSLLLKPNF--IPARTQRANLYLKQGKLSEAKEDINLLLQHKPEDVEAQKMLVNIGEIAEAIEMAKTYYENNRFEDAIGYLNKVMETTTLSEYLREMRANSYLKSGDNQKAINDFRYAVKLSNDDRDGILRLSKLLYETGNADQSLVEIRECLKL 242          
The following BLAST results are available for this feature:
BLAST of TPR_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC61.340e-2738.56tetratricopeptide repeat domain 6 [Source:HGNC Sym... [more]
TTC61.744e-12938.50tetratricopeptide repeat domain 6 [Source:HGNC Sym... [more]
TTC61.429e-11339.20tetratricopeptide repeat domain 6 [Source:HGNC Sym... [more]
TTC61.132e-7636.41tetratricopeptide repeat domain 6 [Source:HGNC Sym... [more]
TTC61.132e-7636.41tetratricopeptide repeat domain 6 [Source:HGNC Sym... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ogt-16.281e-1623.86UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
ogt-16.281e-1623.86UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
ogt-12.990e-1523.96UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
F38B6.61.028e-623.67Protein O-mannosyl-transferase TMTC1 [Source:UniP... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sxc8.011e-1923.83gene:FBgn0261403 transcript:FBtr0086085[more]
sxc8.011e-1923.83gene:FBgn0261403 transcript:FBtr0086084[more]
sxc8.011e-1923.83gene:FBgn0261403 transcript:FBtr0086086[more]
CG50381.513e-1023.53gene:FBgn0038324 transcript:FBtr0083089[more]
P58IPK1.753e-831.48gene:FBgn0037718 transcript:FBtr0082074[more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc65.271e-738.05tetratricopeptide repeat domain 6 [Source:ZFIN;Acc... [more]
ogt.13.886e-2022.76O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
ogt.14.523e-2022.73O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
ogt.15.600e-2022.76O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
ogt.16.986e-2022.73O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbx21.490e-9728.16T-box 2 [Source:Xenbase;Acc:XB-GENE-1018115][more]
tbx21.091e-8635.64T-box 2 [Source:Xenbase;Acc:XB-GENE-1018115][more]
tbx23.111e-7036.84T-box 2 [Source:Xenbase;Acc:XB-GENE-1018115][more]
eno46.119e-2123.18enolase 4 [Source:Xenbase;Acc:XB-GENE-1009720][more]
eno44.991e-2023.14enolase 4 [Source:Xenbase;Acc:XB-GENE-1009720][more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttc64.548e-1436.54tetratricopeptide repeat domain 6 [Source:MGI Symb... [more]
Ogt1.201e-1922.92O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
Ogt3.917e-1923.90O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
Ttc131.172e-1223.91tetratricopeptide repeat domain 13 [Source:MGI Sym... [more]
Dnajc76.174e-1220.74DnaJ heat shock protein family (Hsp40) member C7 [... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86TZ1|TTC6_HUMAN5.435e-7636.41Tetratricopeptide repeat protein 6 OS=Homo sapiens... [more]
sp|Q9M8Y0|SEC_ARATH7.624e-2123.90Probable UDP-N-acetylglucosamine--peptide N-acetyl... [more]
sp|Q27HV0|OGT1_PIG5.732e-1922.92UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
sp|P81436|OGT1_RABIT7.027e-1922.92UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
sp|O15294|OGT1_HUMAN7.332e-1922.92UDP-N-acetylglucosamine--peptide N-acetylglucosami... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JZA60.000e+041.34uncharacterized protein LOC106177489 OS=Lingula un... [more]
A0A267G8180.000e+036.57TPR_REGION domain-containing protein OS=Macrostomu... [more]
K1PHE80.000e+041.32Tetratricopeptide repeat protein 6 OS=Crassostrea ... [more]
A0A267EN220.000e+036.52TPR_REGION domain-containing protein OS=Macrostomu... [more]
A0A267F2Y60.000e+036.48TPR_REGION domain-containing protein OS=Macrostomu... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc62.659e-3339.91tetratricopeptide repeat domain 6 [Source:ZFIN;Acc... [more]
ttc63.979e-3339.91tetratricopeptide repeat domain 6 [Source:ZFIN;Acc... [more]
ttc62.403e-3339.91tetratricopeptide repeat domain 6 [Source:ZFIN;Acc... [more]
ttc62.349e-3339.91tetratricopeptide repeat domain 6 [Source:ZFIN;Acc... [more]
ttc63.067e-2040.02tetratricopeptide repeat domain 6 [Source:ZFIN;Acc... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTC68.700e-14340.24tetratricopeptide repeat domain 6 [Source:HGNC Sym... [more]
ogt.19.327e-1722.98O-linked N-acetylglucosamine (GlcNAc) transferase,... [more]
bbs41.397e-622.18Bardet-Biedl syndrome 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ift882.238e-620.52intraflagellar transport 88 homolog [Source:ZFIN;A... [more]
ENSPMAT00000007591.15.258e-627.11pep scaffold:Pmarinus_7.0:GL480573:24572:27393:-1 ... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403442.962e-2943.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470733.405e-2023.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434841.962e-1025.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339655.481e-1024.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437881.713e-822.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ogt.11.718e-1923.79O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
ogt.11.525e-1523.22O-linked N-acetylglucosamine (GlcNAc) transferase ... [more]
ttc139.718e-1424.57tetratricopeptide repeat domain 13 [Source:NCBI ge... [more]
ttc131.111e-1324.57tetratricopeptide repeat domain 13 [Source:NCBI ge... [more]
DNAJC74.447e-1321.88dnaJ homolog subfamily C member 7 [Source:NCBI gen... [more]
back to top
BLAST of TPR_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071973.10.000e+099.93SMESG000071973.1[more]
SMESG000002813.15.534e-2022.80SMESG000002813.1[more]
SMESG000004465.17.116e-2024.65SMESG000004465.1[more]
SMESG000040140.15.225e-839.06SMESG000040140.1[more]
SMESG000009124.12.844e-724.88SMESG000009124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000421 ID=SMED30000421|Name=TPR_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4485bp
TGAATTGTGCGTACTCGCATCTATGGGCACGATTGGATTTTGTGAATTTG
CATTGAGTATTTACGAAAAATTCGATTTTCTGGAAATTTCTTTTGCGTAA
TCGCTTCAATGGAAATAGAGGAAAGATGTTAGTGCATCTTCTGTTGAAAG
AATCGAAAAGGCTGCTGAAAGAATAATCAGTCAGAAAAATGAAATTGAAA
AATGGAGAACGAAGGCTAATGAAATGTTAAATCTAACTTCCGAAATCGAA
ATAGTTGGAACTTTTATTAGTCCAAGTGAACCGAAAATTATTGACATTTG
GCAACCTTTAGCACCGAGATTGTTTATGTCCCAAAATCAAGTGACAAATG
TGTTATGCCCTAAATATAATCCAAATATCTTTGAACCGACCATTGAAGAA
GTTTCAAAACAAAATACTTTCGAAAACTTCACTAGCGAGGATTTAACTTT
ATCAAATGAAGCCAGTTTTTGTAATGAAATTGATCTGGAAGCTTTGGAAA
CTAAAGAAAGACTTTTGTCAAGAAAGATCAACAGCGTTGAATGCCTGGCT
GACGAAAGGATTGATGAAAACAAGTTTTCGAAAATAATTCATCAGAGGAA
ACGTTGCACAAGTGTTCCAAATCGCCACTGGTTAGAAGAGGACAGTTTGA
TAGTGCATTTGGAATATCACCAAATCATGGACGAGATTAATATTCAAAGA
CAGAAAATTCGAGCTTTAAAAAATACTTCAGAAATTAACGAAGACATAAA
TGAAAAAAAGCCTTTAGAAGAAGACGAAAAGATTTTTAATGATAATTTTG
ATAGTGGGATCTTGACAACAAATGTGGAAAACGAGTATAAAACCCATCAA
AGTGTTAAGAGTATAGAAGATGACTGTTCCTCGCCTGCCAAAAATGCTCT
GAGAGCTGGACAAAATTATATTTATTACCCTCCAAAAAAAAGATCAAAGT
CAAAACCGAAAAAGTCGAAAAATATTGCACGAATTTCTGATATTGAGAGA
TTTCTCGGTCAACCACCAAATAAGTTGGATAAAACTAAATCTTTTGAAAA
TATTCGCATTGAATTAAAGCGAATTCGAAGCTGCAAGAGCCGAGAAAAAT
CTGATTTGAAGAAGTCTCTTTCAAAAAGTTTGGCGGATATTCACAATTTT
GAAGATTGGTCTAAAAATAGAGGATACAAGAAAGAAAGTAACGCGAGAGA
CTGGATAACCGTAATATGGGACCAGTGGTTTGATGAAATATACCCCCCTA
TTCCAGATCATATAATTGATTTAACCTCGGATAAGCCTTCCGAAACTCCT
TATAAAAATGAATTGCTGAATAGAGAACCAACTTCGGTGTCTGCAATTCA
GAATGAAATATTAGATTTACCTGAAAATATTGAACCGGTATTAGATGAAG
TTGACGAAGAATTTAGAGGAGCCTTGTTTGAAACTTTGCTTGAAGAAGTC
AAAAACATTTCAAAAGACATGGAAAATTACCAAAGACCAAATGCATTTCT
ATTGTCTCGCAGAGGAGCTTTATATAGAAAAATGGGATATTTGGTGGCGG
CATCTAAAGATATTAATGATGCGATATCCATAGAGCCTGATCTGATCATA
GCCTACTGGGAGAGGCATTTATTGCATTTAGTTTGTAATAAAATCCAAAT
GGCTATCGAAGATTTGAACTTGATCTTGAAAAAAGATAAAAACTATGTAC
TTGCCTACAAATCGCGTGCTGGAATCTATGCCTCAACCGGGGACATTTCT
TTGGCGATTTCTAATCTTTCCCAAGCAATACGATTATCGCCTGATGATTC
CGAAGCGTACTCAAAACGAGCTGAACTTTATGAGCAAAATGGAGAGGGTA
GATTAGCTCTTGAAGATTATAATCAAATAATTCGCTTGCAACCAAACAAT
TGTCTAGCAATGATGAAACATGGACTTTATTATTTAAATATTGAACAGTG
GCAACTTGCCGCCAAAGACTTTTCTAGTGTCTTGCGACATTATCCCAGCA
ACACAGAAGCTTGGCTTCATCGGGGTACAGCTTACGCTAAACTCCAACAA
TGGCAAGATGCTTTGACTGATTTTTCAGCCGTTATTCATCTGGATCCGAA
TAATTATTTAGCCTATTTCAAACGAGGGTGTCTCCTAAGAAAAGCAGAAC
CGTATCTCGCTATCCGTGATTTTAGTATCAGTCTTTTGTTAGAATCATCG
GAAGAAAATATAATGTCTTATATGTACCGAGGCATCCTTTATGCAACAAC
AAAACAATTTTCTGAGGCTATTGTTGACTTTGAAGTGGTGATTTGTTTTA
ATAAAGATATGTGTTTTGCTCACGTCAATTTGGGTTTAATTTATTTCGAA
AAAGGAGATTTTGAAAAATCTGTTAAATACATGACATCCGGACTGGCGGC
TGATCCTACGTACATTAGAGCTTATCCTTGTAGGGCTGAGGCCTATTTTC
AAATGAATAAATATGAGGACGCCATCAAAGATATCAATCGAGCTATTCAT
TTATTTCCGGACCGATCCAATTTCTATATGCTTCGGGGGGATTTTTATTT
AGCAATGGGCAAAATGGAAATGGCAGCTATTTGTGTTAGACAAGCTGCTG
AAATAAGTCATAACTTGGGGCAAAGTCCAGTTCAACAAGCTCTGGTACAT
TCGTTTTTACAACATTATGATCAAGCAATAGATGCCCTACTTGTTGCAAC
TCGAGGAAAGCCAAGCGTAGCGTTGTTGAATTTGTTGGGAACAACACAAA
TGAAAGCCAAACGCTGGAAAGATGCAATAACATCATTTACCTTTTGTTTG
GAACAGCTTAAACCTAAGAACCAGTACAAACCATGGCCGCCGGGTGCTGC
AAATTTAAATTTTTTGGTAGCTCGATGTTATTTAGAGCTTAAAAATTATA
AAAAATCTCAACTTGCTTTCAGTGCAACTGTAAAAATTAATCCAAATCAT
GCAGAGGCATATTACCATCAAGGTTGGTGTCGGTTACGTCTTGGAAAAAT
GAAGCAGGGCATATTAGATTTGAATAGGGCTTTAGCAATAAATCCAAGGC
TTTATCAGGCTTATTTGGCTAGGGCGACATTATTTGGCTTTAAAAACCAA
TATACTAAAGCCATTTTAAATTGCAATGAAGTTTTGTCCATTGAACCGAG
ATGTCTGAGAGCATATTTGTATAGAGGAGTTCTCAAGTACAAAATAAAAG
CTTATTCTCTTGCAATTAAAGACTTCACTGAAGCCATTAAAATTGATGCT
AATTGCATTTTGGCATTTTTTAATAGAGCTGTTTGTTTTAATGCGGAGAA
AAAAAATTATGAAAAAGCTATTCAAGATTATAGTATTGTTCTTTTAATCA
GTGATGCTTTACATTTGCATTACAAAGCATATATCAATCGCGGATTAGTC
TATCTTGAATTGGGGGATGTACAAAATGCGCTGCACGATTTTATTCGAGC
GCAAGCCATACAGCCGAATGATCTTTATGTGCTTTATGTTGTTGGTGTAT
GTCATCACAAATTGAAAAATCTCAAAGAAGCAATTCGAGTATTCACTCGA
TGTCTTGATCATGATCCCAAATTCATTTTAGCAAAGGTATCCCGTGGAAA
TGTTTTTATGGACTACAATTCTTCCAACAGTCGTGACCTCGCTGCCAAAG
ACTATAATTCAGTTCTCGAAATTGATTCTTATCATTTGGATGCTTTGGTT
AATTTAGGATTTTGTAGGCAGGCTCAAGGAAAGTTTAAGAAAGCTTGGGA
TATATTCACAATGGCTATTGAAAAGCATCCTAATTCGGAGCGACCGTTGG
ATGGTAGAGCCATTGTGTGTATGCAGATGTCTGATTTGAATGGGGCCTTA
AAAGACCTAAATGAAGCTATTAGAATTCAGCCTCAATCATCTATGTTATA
CATTAATCGAGGAGTAGTTTATCAATTGATGCGGGATAAAATTATGGCCA
TGAAAGATTACAATAAAGCTATTATTATTGGTGGTCTCAAATGTCCGATA
GCTTATTTTAACGCTGGTTGTGTATATATTCACAATTTTCAATTGGAACA
AGCCCTGGAGTGTTTTAGGAAAACAGTTGAGAGTGATCCATTAGATGAGG
CTGGATGGGTCAATTTGGCTTTAGTCTATATTTTTCAGAATAAATTAGAG
GAATCCATTGAATATATAAATAGATCTATTTCGTTGTCACCAAATTCGGC
ATATTTGTATTTTAACCGAGCCAACGTTCTATTTGATTTGCAACGTTATC
AAGAAGCTGAACTTGATTTTTGTTCATGTCTCAGAATTGCTCCGGATGAT
CCTCATGTGCTTAAAGCTAGAGGGGATTGTAGAAGTAAAACAGGCGACTC
TTTGGGTGCGTTAGAAGATTATAAGACTTCTGTTTATATTAGTAGCAGTG
TATCAAGAATGCGTCGTTAAAATAACTGTTGTAAAATTTTCGTGATTGGT
TTTTATTTTAATAATTATCTGATTTCTTAAAAAAA
back to top

protein sequence of SMED30000421-orf-1

>SMED30000421-orf-1 ID=SMED30000421-orf-1|Name=SMED30000421-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1399bp
MLNLTSEIEIVGTFISPSEPKIIDIWQPLAPRLFMSQNQVTNVLCPKYNP
NIFEPTIEEVSKQNTFENFTSEDLTLSNEASFCNEIDLEALETKERLLSR
KINSVECLADERIDENKFSKIIHQRKRCTSVPNRHWLEEDSLIVHLEYHQ
IMDEINIQRQKIRALKNTSEINEDINEKKPLEEDEKIFNDNFDSGILTTN
VENEYKTHQSVKSIEDDCSSPAKNALRAGQNYIYYPPKKRSKSKPKKSKN
IARISDIERFLGQPPNKLDKTKSFENIRIELKRIRSCKSREKSDLKKSLS
KSLADIHNFEDWSKNRGYKKESNARDWITVIWDQWFDEIYPPIPDHIIDL
TSDKPSETPYKNELLNREPTSVSAIQNEILDLPENIEPVLDEVDEEFRGA
LFETLLEEVKNISKDMENYQRPNAFLLSRRGALYRKMGYLVAASKDINDA
ISIEPDLIIAYWERHLLHLVCNKIQMAIEDLNLILKKDKNYVLAYKSRAG
IYASTGDISLAISNLSQAIRLSPDDSEAYSKRAELYEQNGEGRLALEDYN
QIIRLQPNNCLAMMKHGLYYLNIEQWQLAAKDFSSVLRHYPSNTEAWLHR
GTAYAKLQQWQDALTDFSAVIHLDPNNYLAYFKRGCLLRKAEPYLAIRDF
SISLLLESSEENIMSYMYRGILYATTKQFSEAIVDFEVVICFNKDMCFAH
VNLGLIYFEKGDFEKSVKYMTSGLAADPTYIRAYPCRAEAYFQMNKYEDA
IKDINRAIHLFPDRSNFYMLRGDFYLAMGKMEMAAICVRQAAEISHNLGQ
SPVQQALVHSFLQHYDQAIDALLVATRGKPSVALLNLLGTTQMKAKRWKD
AITSFTFCLEQLKPKNQYKPWPPGAANLNFLVARCYLELKNYKKSQLAFS
ATVKINPNHAEAYYHQGWCRLRLGKMKQGILDLNRALAINPRLYQAYLAR
ATLFGFKNQYTKAILNCNEVLSIEPRCLRAYLYRGVLKYKIKAYSLAIKD
FTEAIKIDANCILAFFNRAVCFNAEKKNYEKAIQDYSIVLLISDALHLHY
KAYINRGLVYLELGDVQNALHDFIRAQAIQPNDLYVLYVVGVCHHKLKNL
KEAIRVFTRCLDHDPKFILAKVSRGNVFMDYNSSNSRDLAAKDYNSVLEI
DSYHLDALVNLGFCRQAQGKFKKAWDIFTMAIEKHPNSERPLDGRAIVCM
QMSDLNGALKDLNEAIRIQPQSSMLYINRGVVYQLMRDKIMAMKDYNKAI
IIGGLKCPIAYFNAGCVYIHNFQLEQALECFRKTVESDPLDEAGWVNLAL
VYIFQNKLEESIEYINRSISLSPNSAYLYFNRANVLFDLQRYQEAELDFC
SCLRIAPDDPHVLKARGDCRSKTGDSLGALEDYKTSVYISSSVSRMRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019734TPR_repeat
IPR011990TPR-like_helical_dom_sf
IPR013026TPR-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 148..168
NoneNo IPR availablePFAMPF13414TPR_11coord: 501..540
e-value: 2.2E-7
score: 30.4
NoneNo IPR availablePFAMPF13432TPR_16coord: 1297..1360
e-value: 1.8E-4
score: 22.1
coord: 738..792
e-value: 1.4E-5
score: 25.6
coord: 883..941
e-value: 2.3E-6
score: 28.1
coord: 565..627
e-value: 1.4E-6
score: 28.8
coord: 1055..1115
e-value: 8.6E-6
score: 26.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 229..249
NoneNo IPR availablePANTHERPTHR44858FAMILY NOT NAMEDcoord: 1049..1385
coord: 861..954
coord: 954..1043
coord: 460..658
coord: 656..859
IPR019734Tetratricopeptide repeatSMARTSM00028tpr_5coord: 424..457
e-value: 7.0
score: 15.6
coord: 978..1011
e-value: 0.0095
score: 25.1
coord: 492..525
e-value: 0.075
score: 22.2
coord: 1084..1117
e-value: 0.0053
score: 26.0
coord: 560..593
e-value: 38.0
score: 9.8
coord: 876..909
e-value: 7.0
score: 15.6
coord: 731..764
e-value: 1.3E-4
score: 31.4
coord: 832..866
e-value: 39.0
score: 9.8
coord: 1360..1393
e-value: 88.0
score: 6.7
coord: 1326..1359
e-value: 2.0E-4
score: 30.7
coord: 526..559
e-value: 6.1E-5
score: 32.4
coord: 594..627
e-value: 2.5E-6
score: 37.0
coord: 1050..1083
e-value: 6.2E-6
score: 35.7
coord: 1223..1256
e-value: 10.0
score: 15.0
coord: 458..491
e-value: 94.0
score: 6.4
coord: 1155..1188
e-value: 0.15
score: 21.1
coord: 663..696
e-value: 130.0
score: 5.3
coord: 765..798
e-value: 7.9
score: 15.4
coord: 1012..1046
e-value: 36.0
score: 10.1
coord: 697..730
e-value: 0.0097
score: 25.1
coord: 1189..1222
e-value: 3.2
score: 16.8
coord: 944..977
e-value: 0.2
score: 20.7
coord: 910..943
e-value: 0.0023
score: 27.2
coord: 1292..1325
e-value: 0.0051
score: 26.0
coord: 1258..1291
e-value: 0.05
score: 22.7
IPR019734Tetratricopeptide repeatPFAMPF13181TPR_8coord: 699..729
e-value: 0.0015
score: 18.6
coord: 1260..1289
e-value: 0.021
score: 15.0
IPR019734Tetratricopeptide repeatPFAMPF13174TPR_6coord: 1156..1188
e-value: 0.02
score: 15.5
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 1155..1188
score: 9.204
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 424..457
score: 7.788
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 560..593
score: 7.434
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 1050..1083
score: 11.594
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 1223..1256
score: 5.93
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 876..909
score: 8.555
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 697..730
score: 9.558
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 1326..1359
score: 8.437
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 526..559
score: 10.856
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 1189..1222
score: 6.903
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 944..977
score: 6.549
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 1258..1291
score: 10.266
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 765..798
score: 6.815
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 492..525
score: 9.765
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 594..627
score: 12.184
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 663..696
score: 7.139
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 1084..1117
score: 9.086
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 731..764
score: 10.532
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 978..1011
score: 8.408
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 910..943
score: 8.939
IPR019734Tetratricopeptide repeatPROSITEPS50005TPRcoord: 1292..1325
score: 10.237
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 937..988
e-value: 1.3E-6
score: 30.3
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 1257..1395
e-value: 2.3E-28
score: 101.1
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 989..1084
e-value: 7.6E-19
score: 69.9
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 1085..1170
e-value: 2.8E-10
score: 42.2
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 1171..1256
e-value: 2.3E-17
score: 65.1
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 563..655
e-value: 2.3E-17
score: 65.5
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 656..829
e-value: 2.0E-30
score: 107.7
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 830..936
e-value: 8.6E-14
score: 53.6
IPR011990Tetratricopeptide-like helical domain superfamilyGENE3DG3DSA:1.25.40.10coord: 351..562
e-value: 1.3E-24
score: 88.8
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 421..510
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 874..1133
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 661..859
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 1137..1370
IPR011990Tetratricopeptide-like helical domain superfamilySUPERFAMILYSSF48452TPR-likecoord: 491..693
IPR013026Tetratricopeptide repeat-containing domainPROSITEPS50293TPR_REGIONcoord: 424..1393
score: 141.24