bok-1

Overview
Namebok-1 (AEX93479.1)
Smed IDSMED30000419
Length (bp)678
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of bok-1 (SMED30000419) t-SNE clustered cells

Violin plots show distribution of expression levels for bok-1 (SMED30000419) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of bok-1 (SMED30000419) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for bok-1 (SMED30000419) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of bok-1 vs. Ensembl Human
Match: BOK (BCL2 family apoptosis regulator BOK [Source:HGNC Symbol;Acc:HGNC:1087])

HSP 1 Score: 72.0182 bits (175), Expect = 6.846e-15
Identity = 30/112 (26.79%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  202 NLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWN 537
             L  +  +LL++G+EL+   P +Y ++  QL         +T  A+L    H+  +G+ W K+ ++ A+A G  +DC+++ +  ++  ++D   EFV   L  W+  + GW 
Sbjct:   62 RLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTD-AFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 172          
BLAST of bok-1 vs. Ensembl Fly
Match: Debcl (gene:FBgn0029131 transcript:FBtr0086108)

HSP 1 Score: 68.9366 bits (167), Expect = 1.294e-13
Identity = 38/157 (24.20%), Postives = 81/157 (51.59%), Query Frame = 1
Query:   76 MNIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQI-IAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLF---CEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
            M+I N  + +C  YI  +L+   +++ K  + L  + +    ++   +   L  +G EL+R +P +Y++I  QL    +   E + +A +L     + L +S + W K+ ++ A+  GF +DC+++   + +  +ID  +E + ++L  W+    GW
Sbjct:   95 MDIINQGKCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVYWLIDNGGW 251          
BLAST of bok-1 vs. Ensembl Fly
Match: Buffy (gene:FBgn0040491 transcript:FBtr0088077)

HSP 1 Score: 63.5438 bits (153), Expect = 1.154e-11
Identity = 43/184 (23.37%), Postives = 87/184 (47.28%), Query Frame = 1
Query:   28 QLFHNIDWISRATD*P-MNIANSSRYICQVYISEKLK----------LRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQL---GAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWN 537
            +L + I W  +A   P  +I +  R +C  YI  +L+          L+ I S+ G   +  V++V    +Q++       G+EL+R +P +Y+ +  Q+     G +   +   L        L +  + W K+ ++ A+A G  +DC+++   E +  +++S SE + + L  W++   GW+
Sbjct:   72 KLSYTIGW--KAAQIPAQDIISQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRSILGSTSMGIVRDV-FPAVQVL-------GDELERMHPRIYNGVARQICRNPGGEFHTPDAVSLLLGAVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWS 245          
BLAST of bok-1 vs. Ensembl Zebrafish
Match: boka (BCL2 family apoptosis regulator BOK a [Source:NCBI gene;Acc:445218])

HSP 1 Score: 61.2326 bits (147), Expect = 4.940e-11
Identity = 36/159 (22.64%), Postives = 74/159 (46.54%), Query Frame = 1
Query:   79 NIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSG-------MNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
             + + S+ +C+ YI  +L    I   K E       +     L  ++ +LL +G+EL+   P++Y ++  QL      +  +   A+L     +  +G       + W K+ ++ A+A    +DC++     ++ T++D   EFV  +L +W+  + GW
Sbjct:   29 ELVSQSKVLCRDYIHSRLHRAGIGWSKPE-------HGSGGTLAEVSSVLLWLGDELEYLRPNVYRNVARQLNI-TIASENIVSDAFLAVAAEIFSTGSVCFFTGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLASWLKKRGGW 179          
BLAST of bok-1 vs. Ensembl Zebrafish
Match: boka (BCL2 family apoptosis regulator BOK a [Source:NCBI gene;Acc:445218])

HSP 1 Score: 60.8474 bits (146), Expect = 7.186e-11
Identity = 38/162 (23.46%), Postives = 74/162 (45.68%), Query Frame = 1
Query:   79 NIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQL-----GAGYYPNHELTRLAYLLFCEHLTKS-----GMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
             + + S+ +C+ YI  +L    I   K E       +     L  ++ +LL +G+EL+   P++Y ++  QL           +  L   A +   E+  K      G+ W K+ ++ A+A    +DC++     ++ T++D   EFV  +L +W+  + GW
Sbjct:   29 ELVSQSKVLCRDYIHSRLHRAGIGWSKPE-------HGSGGTLAEVSSVLLWLGDELEYLRPNVYRNVARQLNITIASENIVSDAFLAVAAEIFSTEYSRKGLEKHKGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLASWLKKRGGW 183          
BLAST of bok-1 vs. Ensembl Zebrafish
Match: bokb (BCL2 family apoptosis regulator BOK b [Source:NCBI gene;Acc:394160])

HSP 1 Score: 60.4622 bits (145), Expect = 7.682e-11
Identity = 29/99 (29.29%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  238 GNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
            G+EL+   P +Y +I  QL         ++  A+L     +   G+ W K+ A+ A+A G  +DC++     ++ T++DS  EFV  +L  W+  + GW
Sbjct:   78 GDELECMRPYVYRNIAKQLNISVSVEAVVSD-AFLSVATEVIAMGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKRGGW 175          
BLAST of bok-1 vs. Ensembl Zebrafish
Match: bcl2l1 (BCL2 like 1 [Source:ZFIN;Acc:ZDB-GENE-010730-1])

HSP 1 Score: 50.0618 bits (118), Expect = 5.241e-7
Identity = 23/114 (20.18%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  202 NLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLF---CEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
             L  + + L    NE +  Y   ++D+ +QL       H     AY  F    + + + G+NW ++  + A      ++C+++    ++G + +  + ++ N++  W+  Q GW
Sbjct:   85 GLDAVKEALRDSANEFELRYSRAFNDLSSQL-------HITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQSQGGW 191          
BLAST of bok-1 vs. Ensembl Zebrafish
Match: bcl2l1 (BCL2 like 1 [Source:ZFIN;Acc:ZDB-GENE-010730-1])

HSP 1 Score: 50.0618 bits (118), Expect = 5.241e-7
Identity = 23/114 (20.18%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  202 NLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLF---CEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
             L  + + L    NE +  Y   ++D+ +QL       H     AY  F    + + + G+NW ++  + A      ++C+++    ++G + +  + ++ N++  W+  Q GW
Sbjct:   85 GLDAVKEALRDSANEFELRYSRAFNDLSSQL-------HITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQSQGGW 191          
BLAST of bok-1 vs. Ensembl Xenopus
Match: plxna1 (plexin A1 [Source:Xenbase;Acc:XB-GENE-5819524])

HSP 1 Score: 73.1738 bits (178), Expect = 2.505e-15
Identity = 37/152 (24.34%), Postives = 74/152 (48.68%), Query Frame = 1
Query:   79 NIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
             + +  + IC+ +I  +L+   +   K E       N     L  I+   L++G+EL+   P +Y +I  QL         L+  A+L     +  +G+ W K+ ++ A+A G  +DC+++++  ++ T++D   EF+   L  W+  + GW
Sbjct:   26 ELVSQGKAICRDFIQARLQRAGLGWSKPEH---GKSNASAGRLAEISTTFLRLGDELEYMRPTVYRNIARQLNISLTSETILSD-AFLAVAAEIFTAGITWGKVVSLYAVAAGLAVDCVKQSQPALVLTIVDCLGEFIRKTLVTWLKRRGGW 173          
BLAST of bok-1 vs. Ensembl Xenopus
Match: BCL2 (B-cell CLL/lymphoma 2 [Source:NCBI gene;Acc:100485267])

HSP 1 Score: 47.7506 bits (112), Expect = 5.525e-6
Identity = 26/120 (21.67%), Postives = 54/120 (45.00%), Query Frame = 1
Query:  181 VQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNV 540
            +Q VP   LQ +++     G+E  R    LY     Q+    +      R+ +    E L   G+NW ++ A         ++ + R    ++ +++   +E+++++L NW+  Q GW+ 
Sbjct:  140 MQPVPPAVLQTLSR----AGDEFSR----LYQQDFRQISGLLHLTPSTVRVRFATVVEELFHDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIVGWMTEYLNSHLQNWIQEQGGWDA 251          
BLAST of bok-1 vs. Ensembl Mouse
Match: Bok (BCL2-related ovarian killer [Source:MGI Symbol;Acc:MGI:1858494])

HSP 1 Score: 72.0182 bits (175), Expect = 5.133e-15
Identity = 30/118 (25.42%), Postives = 63/118 (53.39%), Query Frame = 1
Query:  190 VPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYP--NHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWN 537
             P   L  +  +LL++G+EL++  P +Y ++  QL   + P  +  +   A+L    H+  +G+ W K+ ++ ++A G  +DC+++ +  ++  ++D   EFV   L  W+  + GW 
Sbjct:   59 APGGRLAEVCTVLLRLGDELEQIRPSVYRNVARQL---HIPLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 173          
BLAST of bok-1 vs. Ensembl Mouse
Match: Bok (BCL2-related ovarian killer [Source:MGI Symbol;Acc:MGI:1858494])

HSP 1 Score: 72.0182 bits (175), Expect = 5.133e-15
Identity = 30/118 (25.42%), Postives = 63/118 (53.39%), Query Frame = 1
Query:  190 VPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYP--NHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWN 537
             P   L  +  +LL++G+EL++  P +Y ++  QL   + P  +  +   A+L    H+  +G+ W K+ ++ ++A G  +DC+++ +  ++  ++D   EFV   L  W+  + GW 
Sbjct:   59 APGGRLAEVCTVLLRLGDELEQIRPSVYRNVARQL---HIPLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 173          
BLAST of bok-1 vs. Ensembl Mouse
Match: Bok (BCL2-related ovarian killer [Source:MGI Symbol;Acc:MGI:1858494])

HSP 1 Score: 55.8398 bits (133), Expect = 1.101e-9
Identity = 18/67 (26.87%), Postives = 38/67 (56.72%), Query Frame = 1
Query:  334 AYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
            A+L    H+  +G+ W K+ ++ ++A G  +DC+++ +  ++  ++D   EFV   L  W+  + GW
Sbjct:   15 AFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGW 81          
BLAST of bok-1 vs. UniProt/SwissProt
Match: sp|Q9I8I2|BOK_CHICK (Bcl-2-related ovarian killer protein OS=Gallus gallus OX=9031 GN=BOK PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.635e-16
Identity = 39/154 (25.32%), Postives = 79/154 (51.30%), Query Frame = 1
Query:   79 NIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYN--LQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
             + + ++ +C+ YI+ +L    +   K E       N P+    L  ++ +LL++G+EL+   P++Y +I  QL    +    +T  A+L     +  +G+ W K+ ++ A+A G  +DC++  +  ++ T++D   EFV   L  W+  + GW
Sbjct:   26 ELVSQAKALCRDYINSRLIRAGVSWSKPE------HNTPVPGGKLAEVSAILLRLGDELEYIRPNVYRNIARQLNISLHSETVVTD-AFLAVAAQIFTAGITWGKVVSLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFVRKTLVTWLKRRGGW 172          
BLAST of bok-1 vs. UniProt/SwissProt
Match: sp|Q9UMX3|BOK_HUMAN (Bcl-2-related ovarian killer protein OS=Homo sapiens OX=9606 GN=BOK PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.288e-14
Identity = 30/112 (26.79%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  202 NLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWN 537
             L  +  +LL++G+EL+   P +Y ++  QL         +T  A+L    H+  +G+ W K+ ++ A+A G  +DC+++ +  ++  ++D   EFV   L  W+  + GW 
Sbjct:   62 RLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTD-AFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 172          
BLAST of bok-1 vs. UniProt/SwissProt
Match: sp|Q792S6|BOK_RAT (Bcl-2-related ovarian killer protein OS=Rattus norvegicus OX=10116 GN=Bok PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.590e-14
Identity = 30/118 (25.42%), Postives = 63/118 (53.39%), Query Frame = 1
Query:  190 VPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYP--NHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWN 537
             P   L  +  +LL++G+EL++  P +Y ++  QL   + P  +  +   A+L    H+  +G+ W K+ ++ ++A G  +DC+++ +  ++  ++D   EFV   L  W+  + GW 
Sbjct:   59 APGGRLAEVCTVLLRLGDELEQIRPSVYRNVARQL---HIPLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 173          
BLAST of bok-1 vs. UniProt/SwissProt
Match: sp|O35425|BOK_MOUSE (Bcl-2-related ovarian killer protein OS=Mus musculus OX=10090 GN=Bok PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.590e-14
Identity = 30/118 (25.42%), Postives = 63/118 (53.39%), Query Frame = 1
Query:  190 VPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYP--NHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWN 537
             P   L  +  +LL++G+EL++  P +Y ++  QL   + P  +  +   A+L    H+  +G+ W K+ ++ ++A G  +DC+++ +  ++  ++D   EFV   L  W+  + GW 
Sbjct:   59 APGGRLAEVCTVLLRLGDELEQIRPSVYRNVARQL---HIPLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWT 173          
BLAST of bok-1 vs. UniProt/SwissProt
Match: sp|Q7T381|BOKB_DANRE (Bcl-2-related ovarian killer protein homolog B OS=Danio rerio OX=7955 GN=bokb PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 4.396e-10
Identity = 29/99 (29.29%), Postives = 51/99 (51.52%), Query Frame = 1
Query:  238 GNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
            G+EL+   P +Y +I  QL         ++  A+L     +   G+ W K+ A+ A+A G  +DC++     ++ T++DS  EFV  +L  W+  + GW
Sbjct:   75 GDELECMRPYVYRNIAKQLNISVSVEAVVSD-AFLSVATEVIAMGITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKRGGW 172          
BLAST of bok-1 vs. TrEMBL
Match: H2DL17 (Bok-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 3.022e-144
Identity = 199/200 (99.50%), Postives = 200/200 (100.00%), Query Frame = 1
Query:   76 MNIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPEEFNSLKLYLSKREIINDNSLKICAIIFVVLILLYFWLHDNQYL 675
            MNIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPE+FNSLKLYLSKREIINDNSLKICAIIFVVLILLYFWLHDNQYL
Sbjct:    1 MNIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPEKFNSLKLYLSKREIINDNSLKICAIIFVVLILLYFWLHDNQYL 200          
BLAST of bok-1 vs. TrEMBL
Match: A0A1I8J681 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.528e-25
Identity = 48/156 (30.77%), Postives = 87/156 (55.77%), Query Frame = 1
Query:   79 NIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPE 546
             +A   R +C+ YIS +L+   +++ K    L++     + +    ++ L  VG +L+  YPDLY ++  QL    + + ++ R  + +F E L   G++W K+ A+ AMA  F +DC+Q+  +E +  ++D F  FV+  LT+W+  Q GW +PE
Sbjct:   37 ELAEEGRRLCRAYISHRLQRSGLLTQKLADSLLSA--AAVTDGGPASQELRLVGEQLEAMYPDLYKNVHKQLNITMH-SEDVVRRTFAMFAEQLCSGGVHWGKIVALFAMAGAFAVDCVQQGRQEFVSRIVDCFGAFVAARLTDWLRKQGGWVIPE 189          
BLAST of bok-1 vs. TrEMBL
Match: A0A267FZV8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014893g1 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 2.868e-24
Identity = 47/156 (30.13%), Postives = 86/156 (55.13%), Query Frame = 1
Query:   79 NIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPE 546
             +A   R +C+ YI  +L+   +++ K    L++     + +    ++ L  VG +L+  YPDLY ++  QL    + + ++ R  + +F E L   G++W K+ A+ AMA  F +DC+Q+  +E +  ++D F  FV+  LT+W+  Q GW +PE
Sbjct:   98 ELAEEGRRLCRAYICHRLQRSGLLTQKLADSLLSA--AAVTDGGPASQELRLVGEQLEAMYPDLYKNVHKQLNITMH-SEDVVRRTFAMFAEQLCSGGVHWGKIVALFAMAGAFAVDCVQQGRQEFVSRIVDCFGAFVAARLTDWLRKQGGWVIPE 250          
BLAST of bok-1 vs. TrEMBL
Match: A0A1I8H8A7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 7.813e-18
Identity = 41/158 (25.95%), Postives = 81/158 (51.27%), Query Frame = 1
Query:   73 PMNIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPE 546
            P ++    + +C  Y++ +L+    ++ +    L      P      + + L  VG EL+  YPDL++++  QL    + + E++R  +++FC+ L +  ++W K+ A+ AMA  F  DC  +   +    ++D+F  FV+  L  W+  Q GW +P+
Sbjct:   89 PDDLVAEGKALCLEYVNHRLRRSGALTQRQLDAL-----GPPAEYSEVGEELRLVGEELETMYPDLFNNVHRQLNLAMH-SEEVSRRTFVMFCDQLCRDSIHWGKVVALFAMAGAFAADCASQGHLDYAQKIVDAFGAFVATRLCTWLTEQGGWIIPD 240          
BLAST of bok-1 vs. TrEMBL
Match: V8NNM4 (Bcl-2-related ovarian killer protein OS=Ophiophagus hannah OX=8665 GN=BOK PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.502e-17
Identity = 44/151 (29.14%), Postives = 79/151 (52.32%), Query Frame = 1
Query:   82 IANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
            + + ++ +C+ YI  +L    I   K E        VP+  L  ++ +LL++G+EL+   P+LY +I  QL    +    +T  A+L     +  SG+ W K+A++ A+A G  +DC++  +  ++ T++D   EFV   L  WM  + GW
Sbjct:   27 LVSQAKVLCRDYIHSRLIRAGIGWNKPEH----SSPVPVGKLAEVSSILLRLGDELEYIRPNLYRNIARQLNISLHSETVVTD-AFLAVATQIFSSGITWGKIASLYAVAAGLAVDCVRHAQPAMVHTIVDCLGEFVRKTLVTWMKRRGGW 172          
BLAST of bok-1 vs. Ensembl Cavefish
Match: boka (BCL2 family apoptosis regulator BOK [Source:NCBI gene;Acc:103021979])

HSP 1 Score: 69.707 bits (169), Expect = 3.002e-14
Identity = 36/153 (23.53%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   79 NIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWN 537
             + + S+ +C+ YI  +L    I   K +  L    +     L  ++ +LL +G+EL+   P++Y ++  QL      +  +   A+L     +  +G+ W K+ ++ A+A    +DC++     ++ T++D   EFV  +L +W+  + GW 
Sbjct:   29 ELVSQSKVLCRDYIHSRLNRAGIGWSKADHGLSAGGS-----LGEVSSVLLWLGDELEYLRPNVYRNVARQLNI-TVASESVVSDAFLAVAAEIFSTGVTWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLVSWLKRRGGWT 175          
BLAST of bok-1 vs. Ensembl Cavefish
Match: bcl2l1 (BCL2 like 1 [Source:ZFIN;Acc:ZDB-GENE-010730-1])

HSP 1 Score: 51.2174 bits (121), Expect = 1.630e-7
Identity = 24/114 (21.05%), Postives = 52/114 (45.61%), Query Frame = 1
Query:  202 NLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLF---CEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
             L  + + L    NE +  Y   +SD+ +QL       H     AY  F    + + + G+NW ++  + A      ++C+++    ++G + +  + ++ N++  W+  Q GW
Sbjct:   86 GLDAVKEALRDSANEFELRYSRAFSDLSSQL-------HITPATAYQSFESVMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGRIAEWMTVYLDNHIQPWIQEQGGW 192          
BLAST of bok-1 vs. Ensembl Sea Lamprey
Match: bcl2l1 (BCL2 like 1 [Source:ZFIN;Acc:ZDB-GENE-010730-1])

HSP 1 Score: 45.8246 bits (107), Expect = 9.903e-7
Identity = 20/109 (18.35%), Postives = 46/109 (42.20%), Query Frame = 1
Query:  214 IAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNV 540
            + + +   G+E +R Y   ++ +P QL      +    R  +    + L + G+NW ++ A  A       +C+ +    ++ +V    + ++ + L  W+    GW  
Sbjct:    1 VQRAMRASGDEFERRYRSAFAQLPAQLQV----SQATLRARFSDVLDELFRDGVNWGRVVAFFAFGGALCAECVDKELPGLVSSVATWMTSYLEDRLLWWIDDNGGWKA 105          
BLAST of bok-1 vs. Ensembl Nematostella
Match: EDO30802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZR6])

HSP 1 Score: 56.9954 bits (136), Expect = 2.098e-10
Identity = 27/107 (25.23%), Postives = 51/107 (47.66%), Query Frame = 1
Query:  214 IAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
            I+K   +VG  L+  YP LY+DI   + A +  +  +    +   C  + K G+NW ++ A+   A     +C + +    +  V +   EF + +L +W+  + GW
Sbjct:   48 ISKRAQEVGWMLEECYPRLYADISRHVNASF-TSETVVHDVFSSVCTEIVKDGVNWARIIAVYTFAGALATECYKDSRSVFVTEVSNWMYEFTALHLVDWIKKRGGW 153          
BLAST of bok-1 vs. Ensembl Nematostella
Match: EDO47196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN20])

HSP 1 Score: 54.6842 bits (130), Expect = 4.038e-10
Identity = 24/106 (22.64%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  226 LLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVP 543
            ++++G  L+ +YP LY ++   L      +  +    +  F   L + G++W K+ A+ A A     DC+ +   E++ +++++   +V ++L  W+    GW  P
Sbjct:    1 IIQIGELLETAYPYLYHNVSKHLKI-RLRSEVIVGDVFRTFGRELFRDGVSWAKVIALFAFAASMSEDCVMQGRPELVKSILNNVRAYVRDHLAVWIRNHGGWVSP 105          
BLAST of bok-1 vs. Ensembl Nematostella
Match: EDO30801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZR5])

HSP 1 Score: 53.1434 bits (126), Expect = 1.611e-9
Identity = 23/96 (23.96%), Postives = 45/96 (46.88%), Query Frame = 1
Query:  247 LDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
            L+  YP LY+DI   + A +  +  +    +   C  + K G+NW ++ A+   A     +C + +    +  V +   EF + +L +W+  + GW
Sbjct:    2 LEECYPRLYADISRHVNASF-TSETVVHDVFSSVCTEIVKDGVNWARIIAVYTFAGALATECYKDSRSVFVTEVSNWMYEFTALHLVDWIKKRGGW 96          
BLAST of bok-1 vs. Ensembl Nematostella
Match: EDO33714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRF5])

HSP 1 Score: 46.9802 bits (110), Expect = 3.260e-7
Identity = 21/103 (20.39%), Postives = 46/103 (44.66%), Query Frame = 1
Query:  226 LLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
            L  + + ++  YPDL+     +LG          R  +    + + ++G+NW ++ A+           I+    E++  V++    F+++NL +W+    GW
Sbjct:    1 LRSLASHMEAEYPDLFETACTKLGI----TPATARSTFFSVAKEIFQTGINWGRIVALFTFGGVVAHHFIESERPEMVPHVVEWIPSFIADNLLSWIMENGGW 99          
BLAST of bok-1 vs. Ensembl Nematostella
Match: EDO38185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDL6])

HSP 1 Score: 46.2098 bits (108), Expect = 4.133e-7
Identity = 22/97 (22.68%), Postives = 45/97 (46.39%), Query Frame = 1
Query:  247 LDRSYPDLYSDIPNQLGAGYYPNHELTRLA-YLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
            ++ +YP LY +I  QL   +  N E+     +   C+++  SG+ W ++ ++ A A    +DC Q  +  +   +     ++    L+ W+    GW
Sbjct:    1 MENAYPALYQNISEQLN--FRINLEIVVCGMFTCVCDNILASGITWARVVSLYAFAAALAVDCCQ-TDVRIAKNISKWMGQYTKKRLSGWVRENGGW 94          
BLAST of bok-1 vs. Ensembl Medaka
Match: boka (bcl-2-related ovarian killer protein homolog A [Source:NCBI gene;Acc:101173213])

HSP 1 Score: 64.3142 bits (155), Expect = 2.635e-12
Identity = 34/152 (22.37%), Postives = 70/152 (46.05%), Query Frame = 1
Query:   79 NIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGW 534
             + + ++ +C+ YI  +L    I   K E                ++ +LL +G EL+   P++Y ++  QL      +  +   A+L     +  +G+ W K+ ++ A+A    +DC++     ++ T++D   EF   +LT W+  + GW
Sbjct:   23 ELVSQAKALCREYIHSRLNRAGIGWSKPEHAQAGAGGALGE----VSSVLLWLGEELEYLRPNVYRNVARQLNI-TVASESIVSDAFLAVAADIFSTGITWGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFARKSLTVWLKKRGGW 169          
BLAST of bok-1 vs. Ensembl Medaka
Match: bokb (bcl-2-related ovarian killer protein homolog A [Source:NCBI gene;Acc:101160592])

HSP 1 Score: 61.6178 bits (148), Expect = 2.798e-11
Identity = 41/172 (23.84%), Postives = 81/172 (47.09%), Query Frame = 1
Query:   79 NIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWN------VPEEFNSLKLYLS 576
             +   S+ +C+ YI  +L    +   K E    +  N  +  + ++   LL +G+EL+   P LY ++  QL       + ++  A+L     +  +G+ W K+ +M A+A    +DC+++     +  ++DS  +FV   L +W+  + GW       V +E  S + +LS
Sbjct:   26 ELVTQSKALCRDYILSRLHQNGMGWSKAE-INFSPSNAALSEVTMV---LLCLGDELECIQPGLYRNVARQLNISVAMENVVSD-AFLGVATEIFSAGITWGKVVSMYAVAGALAVDCVRQGYLTTVHILVDSLGQFVRKFLVHWLKRRGGWAEITKCVVKKELTSEQPWLS 192          
BLAST of bok-1 vs. Ensembl Medaka
Match: ENSORLT00000046675.1 (bcl-2-like protein 1 [Source:NCBI gene;Acc:101165300])

HSP 1 Score: 52.7582 bits (125), Expect = 3.395e-8
Identity = 25/116 (21.55%), Postives = 53/116 (45.69%), Query Frame = 1
Query:  202 NLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLF---CEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNV 540
            ++  I   L    +E +R +   +SD+  QL       H     AY  F    + L K G+NW ++  +        ++C++RN  E++  + +  ++++   ++ W+H   GW+ 
Sbjct:   65 SMDAIKSTLKDSADEFERRFHQGFSDLSVQL-------HITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDC 173          
BLAST of bok-1 vs. Ensembl Medaka
Match: ENSORLT00000027320.1 (bcl-2-like protein 1 [Source:NCBI gene;Acc:101165300])

HSP 1 Score: 52.7582 bits (125), Expect = 3.634e-8
Identity = 25/116 (21.55%), Postives = 53/116 (45.69%), Query Frame = 1
Query:  202 NLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLF---CEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNV 540
            ++  I   L    +E +R +   +SD+  QL       H     AY  F    + L K G+NW ++  +        ++C++RN  E++  + +  ++++   ++ W+H   GW+ 
Sbjct:   62 SMDAIKSTLKDSADEFERRFHQGFSDLSVQL-------HITPDTAYQNFKRVLDELFKDGINWGRVVGLFVFGGALCVECVERNMGELVSRIAEWMTQYLDEQISPWIHSHGGWDC 170          
BLAST of bok-1 vs. Ensembl Medaka
Match: bcl2b (BCL2 apoptosis regulator [Source:NCBI gene;Acc:101163032])

HSP 1 Score: 49.6766 bits (117), Expect = 3.134e-7
Identity = 36/168 (21.43%), Postives = 74/168 (44.05%), Query Frame = 1
Query:   91 SSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEV-IGTVIDSFSEFVSNNLTNWMHMQNGWNVPEEFNSLKLYLSKREII 591
            S+R I + YI  KL  R  V       L   Q     + ++I  +L + G+EL+R Y   ++++  QL    Y      +  +    + L + G+NW ++ A         ++C    E    + ++ +  +E+++  L +W+    GW+       ++LY  ++E +
Sbjct:    5 SNRSIVEKYICHKLSKRGYVCG-----LNGGQRENASSPRLIRAVLREAGDELERLYQRDFTEMSRQL----YLTSTTAKTRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECASNEEMSTQVASIAEWMTEYLNGPLNSWIEENGGWDA-----FVELYDRQKETV 158          
BLAST of bok-1 vs. Planmine SMEST
Match: SMESG000021216.1 (SMESG000021216.1)

HSP 1 Score: 411.764 bits (1057), Expect = 1.809e-148
Identity = 200/200 (100.00%), Postives = 200/200 (100.00%), Query Frame = 1
Query:   76 MNIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPEEFNSLKLYLSKREIINDNSLKICAIIFVVLILLYFWLHDNQYL 675
            MNIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPEEFNSLKLYLSKREIINDNSLKICAIIFVVLILLYFWLHDNQYL
Sbjct:    1 MNIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKLLLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGMNWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPEEFNSLKLYLSKREIINDNSLKICAIIFVVLILLYFWLHDNQYL 200          
BLAST of bok-1 vs. Planmine SMEST
Match: SMESG000066862.1 (SMESG000066862.1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.155e-15
Identity = 45/146 (30.82%), Postives = 72/146 (49.32%), Query Frame = 1
Query:  232 KVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFC-EHLTKSGMN-----WVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQNGWNVPEEFNSLKL-YLSKREIINDNSLKICAIIFVVLILLY 648
            ++  +L+  YPDLY ++ +Q+G       +     +L F  E L KSG +     W K+ ++L +  G  +DC +  + + I  +ID+F   V+  L  W+  QNGWN+P E    K   L K  +I +  L I A I +V    Y
Sbjct:  101 EIAVQLESMYPDLYKNVASQMGINVGWEQQKISEVFLQFSNELLCKSGESEPQIYWAKIISLLCIGAGLAVDCAKNGKWDTIPKIIDTFDRIVAQILMTWIISQNGWNIPPELKPDKFSRLKKYFLIFNTFLAIFAAILLVAWRFY 246          
The following BLAST results are available for this feature:
BLAST of bok-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BOK6.846e-1526.79BCL2 family apoptosis regulator BOK [Source:HGNC S... [more]
back to top
BLAST of bok-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of bok-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Debcl1.294e-1324.20gene:FBgn0029131 transcript:FBtr0086108[more]
Buffy1.154e-1123.37gene:FBgn0040491 transcript:FBtr0088077[more]
back to top
BLAST of bok-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
boka4.940e-1122.64BCL2 family apoptosis regulator BOK a [Source:NCBI... [more]
boka7.186e-1123.46BCL2 family apoptosis regulator BOK a [Source:NCBI... [more]
bokb7.682e-1129.29BCL2 family apoptosis regulator BOK b [Source:NCBI... [more]
bcl2l15.241e-720.18BCL2 like 1 [Source:ZFIN;Acc:ZDB-GENE-010730-1][more]
bcl2l15.241e-720.18BCL2 like 1 [Source:ZFIN;Acc:ZDB-GENE-010730-1][more]
back to top
BLAST of bok-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
plxna12.505e-1524.34plexin A1 [Source:Xenbase;Acc:XB-GENE-5819524][more]
BCL25.525e-621.67B-cell CLL/lymphoma 2 [Source:NCBI gene;Acc:100485... [more]
back to top
BLAST of bok-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Bok5.133e-1525.42BCL2-related ovarian killer [Source:MGI Symbol;Acc... [more]
Bok5.133e-1525.42BCL2-related ovarian killer [Source:MGI Symbol;Acc... [more]
Bok1.101e-926.87BCL2-related ovarian killer [Source:MGI Symbol;Acc... [more]
back to top
BLAST of bok-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I8I2|BOK_CHICK1.635e-1625.32Bcl-2-related ovarian killer protein OS=Gallus gal... [more]
sp|Q9UMX3|BOK_HUMAN3.288e-1426.79Bcl-2-related ovarian killer protein OS=Homo sapie... [more]
sp|Q792S6|BOK_RAT3.590e-1425.42Bcl-2-related ovarian killer protein OS=Rattus nor... [more]
sp|O35425|BOK_MOUSE3.590e-1425.42Bcl-2-related ovarian killer protein OS=Mus muscul... [more]
sp|Q7T381|BOKB_DANRE4.396e-1029.29Bcl-2-related ovarian killer protein homolog B OS=... [more]
back to top
BLAST of bok-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2DL173.022e-14499.50Bok-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A1I8J6811.528e-2530.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FZV82.868e-2430.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H8A77.813e-1825.95Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V8NNM45.502e-1729.14Bcl-2-related ovarian killer protein OS=Ophiophagu... [more]
back to top
BLAST of bok-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
boka3.002e-1423.53BCL2 family apoptosis regulator BOK [Source:NCBI g... [more]
bcl2l11.630e-721.05BCL2 like 1 [Source:ZFIN;Acc:ZDB-GENE-010730-1][more]
back to top
BLAST of bok-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bcl2l19.903e-718.35BCL2 like 1 [Source:ZFIN;Acc:ZDB-GENE-010730-1][more]
back to top
BLAST of bok-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of bok-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO308022.098e-1025.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471964.038e-1022.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308011.611e-923.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337143.260e-720.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381854.133e-722.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of bok-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
boka2.635e-1222.37bcl-2-related ovarian killer protein homolog A [So... [more]
bokb2.798e-1123.84bcl-2-related ovarian killer protein homolog A [So... [more]
ENSORLT00000046675.13.395e-821.55bcl-2-like protein 1 [Source:NCBI gene;Acc:1011653... [more]
ENSORLT00000027320.13.634e-821.55bcl-2-like protein 1 [Source:NCBI gene;Acc:1011653... [more]
bcl2b3.134e-721.43BCL2 apoptosis regulator [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of bok-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000021216.11.809e-148100.00SMESG000021216.1[more]
SMESG000066862.11.155e-1530.82SMESG000066862.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000419
GenBankAEX93479.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000419 ID=SMED30000419|Name=bok-1|organism=Schmidtea mediterranea sexual|type=transcript|length=678bp
CAATAAGTGGCTTGCTGACATCGATATCAATTATTCCACAACATCGATTG
GATCTCCCGCGCAACTGATTGACCAATGAATATTGCAAACTCTTCCAGAT
ACATTTGTCAGGTTTATATCAGTGAGAAATTGAAACTTAGGAATATTGTT
TCGGTAAAAGGGGAGAAGTTTCTTATAACAGTTCAAAATGTACCAATTTA
CAATTTGCAAATTATCGCGAAATTGTTGCTAAAAGTAGGCAATGAACTCG
ATAGATCATATCCGGATTTATATAGTGATATACCAAATCAACTGGGGGCC
GGCTATTATCCAAACCATGAACTGACGAGGTTAGCATATTTGTTATTTTG
TGAACATTTGACAAAATCCGGCATGAATTGGGTGAAAATGGCAGCAATGT
TAGCAATGGCTAATGGATTCGTTATGGATTGTATTCAACGCAATGAAGAG
GAGGTTATTGGGACAGTGATTGACAGTTTCTCGGAATTCGTTTCCAACAA
CCTTACCAATTGGATGCACATGCAAAACGGATGGAATGTGCCAGAAGAAT
TTAATTCTTTGAAATTATATTTATCGAAAAGAGAAATTATAAATGATAAT
TCTTTGAAGATTTGTGCAATAATATTTGTTGTTTTAATTTTATTATATTT
CTGGTTGCATGACAACCAGTACTTGTAA
back to top

protein sequence of SMED30000419-orf-1

>SMED30000419-orf-1 ID=SMED30000419-orf-1|Name=SMED30000419-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=201bp
MNIANSSRYICQVYISEKLKLRNIVSVKGEKFLITVQNVPIYNLQIIAKL
LLKVGNELDRSYPDLYSDIPNQLGAGYYPNHELTRLAYLLFCEHLTKSGM
NWVKMAAMLAMANGFVMDCIQRNEEEVIGTVIDSFSEFVSNNLTNWMHMQ
NGWNVPEEFNSLKLYLSKREIINDNSLKICAIIFVVLILLYFWLHDNQYL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036834Blc2-like_sf
IPR026309BOK
IPR026298Blc2_fam
IPR002475Bcl2-like
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00337bclneu2coord: 51..153
e-value: 2.5E-9
score: 47.0
NoneNo IPR availableTMHMMTMhelixcoord: 175..194
IPR036834Blc2-like superfamilyGENE3DG3DSA:1.10.437.10coord: 1..189
e-value: 5.1E-25
score: 89.8
IPR036834Blc2-like superfamilySUPERFAMILYSSF56854Bcl-2 inhibitors of programmed cell deathcoord: 4..154
IPR026298Blc2 familyPFAMPF00452Bcl-2coord: 51..153
e-value: 3.8E-13
score: 50.0
IPR026298Blc2 familyPANTHERPTHR11256BCL-2 RELATEDcoord: 2..163
IPR026309Bcl-2-related ovarian killer proteinPANTHERPTHR11256:SF48BCL-2-RELATED OVARIAN KILLER PROTEINcoord: 2..163
IPR002475Bcl2-likePROSITEPS50062BCL2_FAMILYcoord: 51..155
score: 14.645