Synaptotagmin-4

Overview
NameSynaptotagmin-4
Smed IDSMED30000412
Length (bp)1549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin-4 (SMED30000412) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin-4 (SMED30000412) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000412

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000412h1SMcG0003212 SmedASXL_009362SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30000412h1SMcG0003212 dd_Smed_v4_22061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000412h1SMcG0003212 dd_Smed_v4_22061_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin-4 vs. Ensembl Human
Match: SYT7 (synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514])

HSP 1 Score: 72.4034 bits (176), Expect = 6.153e-13
Identity = 62/253 (24.51%), Postives = 124/253 (49.01%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T    +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  180 LGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 425          
BLAST of Synaptotagmin-4 vs. Ensembl Human
Match: SYT7 (synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514])

HSP 1 Score: 72.0182 bits (175), Expect = 7.118e-13
Identity = 62/253 (24.51%), Postives = 124/253 (49.01%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T    +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  136 LGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 381          
BLAST of Synaptotagmin-4 vs. Ensembl Human
Match: SYT7 (synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514])

HSP 1 Score: 71.2478 bits (173), Expect = 1.628e-12
Identity = 62/253 (24.51%), Postives = 124/253 (49.01%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T    +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  255 LGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 500          
BLAST of Synaptotagmin-4 vs. Ensembl Human
Match: SYT7 (synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514])

HSP 1 Score: 71.633 bits (174), Expect = 1.653e-12
Identity = 62/253 (24.51%), Postives = 124/253 (49.01%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T    +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  344 LGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 589          
BLAST of Synaptotagmin-4 vs. Ensembl Human
Match: SYT7 (synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514])

HSP 1 Score: 70.8626 bits (172), Expect = 1.893e-12
Identity = 62/253 (24.51%), Postives = 124/253 (49.01%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T    +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  211 LGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 456          
BLAST of Synaptotagmin-4 vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 80.8777 bits (198), Expect = 2.466e-16
Identity = 74/287 (25.78%), Postives = 139/287 (48.43%), Query Frame = 1
Query:  541 PVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDY--KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKS---LGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSK 1383
            P+  + P      N  Y + VNN   P S       + G++HF +E+  +++ + V+++   D+      G    ++ + + P   +   T+ I +T+NP + E   FS I  ++L   TL L + D+     +  +G++++ L+ +      D      IE+ L   +K D+    LG I  S         + +++++ + LK +++  SS+PY  I L      L  ++TS KYKT +P +NE   F I + H +E + L + V+   +++KN+ IGE+   SK
Sbjct:   47 PILSSKPITVQPTNSDYYEPVNNGTLPLSSSGALIKQYGNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFS-IPFNELHSKTLMLVVYDYDRLSKDDKMGQLSVPLESIDFGITTD------IERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKI-EPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSK 325          
BLAST of Synaptotagmin-4 vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4XQZ9])

HSP 1 Score: 66.2402 bits (160), Expect = 1.599e-11
Identity = 62/218 (28.44%), Postives = 103/218 (47.25%), Query Frame = 1
Query:  649 GSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFL-LEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFL 1299
            G ++F + F K+ +T+HV ++E  D+ +    G    ++   L     ++  +K     +NP F E  +F   S  KL  +TL L++ D+     +  +GEI L L+ +  E+S V      Y +    P    D + G I +SL       K+ VS++K + L A +     + Y  + +V    KL  R+TSVK  T  P++NE   F+I  K  L
Sbjct:  103 GRINFSVAFEKECSTLHVHLMEAVDLPVKDFTGSSDPYVRAFLLQDPGQSERSKVHRRNLNPTFNETLSFRGHSMKKLHDMTLVLQVMDYDRFSSDDPIGEILLPLKHVKFESSPV------YWKHLQRPTVSKD-ACGEIMISLCYLPTSGKITVSIIKARDLHAKDRTRHYDTYVKMWMVQQGNKLEKRKTSVKPHTPSPIFNESFAFSIPVKQVL 313          
BLAST of Synaptotagmin-4 vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 63.929 bits (154), Expect = 1.667e-10
Identity = 64/236 (27.12%), Postives = 115/236 (48.73%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRI-FYIEKFLSPVKKSDK-----SLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVF 1329
            LGS+   + +      + + ++  K++      G    ++  +L PG+ K   L++KTI  T+NP + EE ++  I+E   E   L + + D +D  G   +GE  ++L+ L   +D + K+   Y+E  L PV +  K       G I V L  N+++  L +++ +   L  ++    S+PYC + L    +K    +TS K +T +P WNE + F +  K  L    L+I V+
Sbjct:  684 LGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLD-RDRIGSDFLGETRIALKKL---NDNEMKKFNLYLESAL-PVPQQTKEEENEDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVPFKD-LPKKTLQIGVY 913          
BLAST of Synaptotagmin-4 vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 63.929 bits (154), Expect = 1.703e-10
Identity = 64/236 (27.12%), Postives = 115/236 (48.73%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRI-FYIEKFLSPVKKSDK-----SLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVF 1329
            LGS+   + +      + + ++  K++      G    ++  +L PG+ K   L++KTI  T+NP + EE ++  I+E   E   L + + D +D  G   +GE  ++L+ L   +D + K+   Y+E  L PV +  K       G I V L  N+++  L +++ +   L  ++    S+PYC + L    +K    +TS K +T +P WNE + F +  K  L    L+I V+
Sbjct:  750 LGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLD-RDRIGSDFLGETRIALKKL---NDNEMKKFNLYLESAL-PVPQQTKEEENEDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVPFKD-LPKKTLQIGVY 979          
BLAST of Synaptotagmin-4 vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 63.929 bits (154), Expect = 1.875e-10
Identity = 64/236 (27.12%), Postives = 115/236 (48.73%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRI-FYIEKFLSPVKKSDK-----SLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVF 1329
            LGS+   + +      + + ++  K++      G    ++  +L PG+ K   L++KTI  T+NP + EE ++  I+E   E   L + + D +D  G   +GE  ++L+ L   +D + K+   Y+E  L PV +  K       G I V L  N+++  L +++ +   L  ++    S+PYC + L    +K    +TS K +T +P WNE + F +  K  L    L+I V+
Sbjct:  675 LGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLD-RDRIGSDFLGETRIALKKL---NDNEMKKFNLYLESAL-PVPQQTKEEENEDRGKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFVVPFKD-LPKKTLQIGVY 904          
BLAST of Synaptotagmin-4 vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089139)

HSP 1 Score: 76.2554 bits (186), Expect = 4.938e-15
Identity = 71/251 (28.29%), Postives = 121/251 (48.21%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTG 1395
            +G +HF +E+  Q  T+ + +L+ K++    + G    ++ + L P     L TK    T+NPR+ E   F      KL+   L+L + D+     +  +GE+ L L       D   K+ F+  K L P  K DK  G +  SL  +     L ++++K + LKA ++N  S+PY  + L   + ++  R+T +   T +PV+NE   FN+  +   E   L + V     + +NE IG I    K+G+G
Sbjct:   15 VGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLC----QVDFAGKQSFW--KALKPPAK-DKC-GELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRE-CSLDVMVMDFDNIGRNELIGRILLAGKNGSG 256          
BLAST of Synaptotagmin-4 vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0343990)

HSP 1 Score: 75.0998 bits (183), Expect = 3.385e-14
Identity = 71/251 (28.29%), Postives = 122/251 (48.61%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTG 1395
            +G +HF +E+  Q  T+ + +L+ K++    + G    ++ + L P     L TK    T+NPR+ E   F      KL+   L+L + D+     +  +GE+ L L  +    D   K+ F+  K L P  K DK  G +  SL  +     L ++++K + LKA ++N  S+PY  + L   + ++  R+T +   T +PV+NE   FN+  +   E   L + V     + +NE IG I    K+G+G
Sbjct:  148 VGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV----DFAGKQSFW--KALKPPAK-DKC-GELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRE-CSLDVMVMDFDNIGRNELIGRILLAGKNGSG 389          
BLAST of Synaptotagmin-4 vs. Ensembl Fly
Match: Syt7 (gene:FBgn0039900 transcript:FBtr0089137)

HSP 1 Score: 75.0998 bits (183), Expect = 3.385e-14
Identity = 71/251 (28.29%), Postives = 122/251 (48.61%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTG 1395
            +G +HF +E+  Q  T+ + +L+ K++    + G    ++ + L P     L TK    T+NPR+ E   F      KL+   L+L + D+     +  +GE+ L L  +    D   K+ F+  K L P  K DK  G +  SL  +     L ++++K + LKA ++N  S+PY  + L   + ++  R+T +   T +PV+NE   FN+  +   E   L + V     + +NE IG I    K+G+G
Sbjct:  148 VGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQV----DFAGKQSFW--KALKPPAK-DKC-GELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRE-CSLDVMVMDFDNIGRNELIGRILLAGKNGSG 389          
BLAST of Synaptotagmin-4 vs. Ensembl Fly
Match: Syt4 (gene:FBgn0028400 transcript:FBtr0081578)

HSP 1 Score: 67.3958 bits (163), Expect = 1.360e-11
Identity = 66/275 (24.00%), Postives = 132/275 (48.00%), Query Frame = 1
Query:  643 KLGSLHFIIEFSKQKNTIHVSMLEVKDISI-----------TYIRGGCKF----HICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSP--VKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHF----LENICLKIKVFSKGRLTKNE-IGEIEF--PSKSGTG 1395
            KLG+++F + +  ++N + VS++  + +             T + G  +     ++ + L P     + T+ + +T NP + E+ TF  ++ + L+ ++L+  +  +     +  +GE+   L  + E  D+  K    I K + P  +K   +  G + +SL       +L V +LK + L  +++   ++PY  I L+ +  ++  ++T VK +T  PV+NE   F+I         LE + L++ +    R+TKNE IG +E   P+ S T 
Sbjct:  179 KLGTIYFKLRYLAERNALMVSIIRCRGLPCKGGSSGTGDIPTGMNGRTQAATDPYVKLQLLPDKQHKVKTRVVRNTRNPVYDEDFTFYGLNMNDLQNMSLHFVILSFDRYSRDDVIGEVVCPLTSI-EIGDIS-KEALSISKEIQPRSLKIRAQGRGELLISLCWQPAAGRLTVVLLKARNLPRMDVTGLADPYVKIYLLYNGQRIAKKKTHVKKRTLSPVFNESFAFDIPAAEGAGASLEGVSLELMLLDWDRVTKNEVIGRLELGGPNSSSTA 451          
BLAST of Synaptotagmin-4 vs. Ensembl Fly
Match: Sytalpha (gene:FBgn0261089 transcript:FBtr0303255)

HSP 1 Score: 58.9214 bits (141), Expect = 5.445e-9
Identity = 56/239 (23.43%), Postives = 105/239 (43.93%), Query Frame = 1
Query:  649 GSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLS-VNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVS-SNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEI 1359
            G+LH  + +      ++V +LE +++      G    +  + L P       T+    T+NP F E+  F  ++   ++  T+ + L D+        +G   L L  L    D+ ++   +     +  +     LG I VSL+ +   +  ++V +         +  NSS+PY  + L+     K+  R+T V+  T +PV+NE + F++  K  L+N  L+  V   G L  +EI
Sbjct:  210 GNLHVSLGYDPVGGLLNVRLLEAQNLQPRQFSGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFE-VTAGVIDKRTVEILLYDFDAYSRHVCIGGSKLHLANL----DLSEQLKLWTPLSSASAQDMKVDLGDIMVSLAYLPSAERLMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGGKKIKKRKTGVQRGTLNPVYNEALAFDVA-KETLKNCVLEFTVVHDGLLGSSEI 442          
BLAST of Synaptotagmin-4 vs. Ensembl Zebrafish
Match: syt7a (synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-090601-5])

HSP 1 Score: 82.0333 bits (201), Expect = 1.978e-16
Identity = 72/267 (26.97%), Postives = 128/267 (47.94%), Query Frame = 1
Query:  604 NNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            ++ E P S+    KLG + F + +S Q  T+ V +L+ +D+      G     + I L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L      + V+  ++    K L P      S G + VSL  N     + V+++K + LKA+++  +S+PY  + L+  + ++  ++T    +  +PV+NE   F++   H L    + I V  K RL++N+ IG+I    KSG G++
Sbjct:  104 DDHEGPVSE----KLGRIQFSLGYSFQDTTLTVKILKGQDLPAKDFSGTSDPFVKIYLLPDRKHKLETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPL------NKVELGQLKSFWKDLKPCSDGSGSRGDLLVSLCYNPTANTITVNIIKARNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVTIKRCLNPVFNESFPFDVPA-HVLRETTIIITVMDKDRLSRNDVIGKIYLSWKSGPGEV 359          
BLAST of Synaptotagmin-4 vs. Ensembl Zebrafish
Match: syt7a (synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-090601-5])

HSP 1 Score: 79.7221 bits (195), Expect = 2.300e-15
Identity = 72/267 (26.97%), Postives = 128/267 (47.94%), Query Frame = 1
Query:  604 NNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            ++ E P S+    KLG + F + +S Q  T+ V +L+ +D+      G     + I L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L      + V+  ++    K L P      S G + VSL  N     + V+++K + LKA+++  +S+PY  + L+  + ++  ++T    +  +PV+NE   F++   H L    + I V  K RL++N+ IG+I    KSG G++
Sbjct:  330 DDHEGPVSE----KLGRIQFSLGYSFQDTTLTVKILKGQDLPAKDFSGTSDPFVKIYLLPDRKHKLETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPL------NKVELGQLKSFWKDLKPCSDGSGSRGDLLVSLCYNPTANTITVNIIKARNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVTIKRCLNPVFNESFPFDVP-AHVLRETTIIITVMDKDRLSRNDVIGKIYLSWKSGPGEV 585          
BLAST of Synaptotagmin-4 vs. Ensembl Zebrafish
Match: syt7b (synaptotagmin VIIb [Source:ZFIN;Acc:ZDB-GENE-090601-6])

HSP 1 Score: 78.5666 bits (192), Expect = 4.278e-15
Identity = 69/254 (27.17%), Postives = 124/254 (48.82%), Query Frame = 1
Query:  643 KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            KLG + F + +S Q +T+ V +L+ +D+      G     + + L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L      + V+   +  + K L P      S G + VSL  N     + VS++K + LKA+++  +S+PY  + L++ + ++  ++T V  +  +PV+NE   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  220 KLGRIQFSVGYSFQDSTLTVKILKGQDLPAKDFSGTSDPFVKLYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRTLYLQVLDYDRFSRNDPIGEVSIPL------NKVELVPMQTLWKELKPCSDGSGSRGDLLVSLCYNPTANIITVSIIKARNLKAMDIGGTSDPYVKVWLMNKDKRVEKKKTVVMKRCLNPVFNESFPFDVPA-HVLRETTIVITVMDKDRLSRNDVIGKIYLSWKSGPAEV 466          
BLAST of Synaptotagmin-4 vs. Ensembl Zebrafish
Match: doc2b (double C2-like domains, beta [Source:ZFIN;Acc:ZDB-GENE-090615-1])

HSP 1 Score: 72.0182 bits (175), Expect = 7.550e-13
Identity = 83/295 (28.14%), Postives = 136/295 (46.10%), Query Frame = 1
Query:  457 EDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRAS-------VQNFRYLKLVNNK--EDPFSQGKDYK----LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFY--IEKFLSPVKKSDKSL---GSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNI 1281
            EDE++  S   L       AG L       K  GP+  +        Q F    LV +K  E+P  +G D      LG+L F + + ++ N +H ++ + K +      G    ++ ++L PG+ K   L TKT+ +T+NP + E  T+  I++  +   TL + +CD         +GE  + L+ L      +  + F   +EK L   K  DKSL   G I +SL  + +K  L+V +++   L A++ N  S+PY    L     K    +T+VK KT +P +NE   + I
Sbjct:  279 EDEVIDHSRTLLTPPALSRAGSLRSSSTSQKSEGPQADANRDEDDLDQAFGATALVASKKEEEPDVEGYDSDDSTTLGTLDFSLLYDQENNALHCTINKAKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPVWSETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRIPLKKL----KPNQTKNFSNCLEKQLPIDKTDDKSLEERGRIMISLKYSSQKSGLVVGIIRCAHLAAMDANGFSDPYVKTYLKPDENKKSKHKTAVKKKTLNPEFNEEFFYEI 569          
BLAST of Synaptotagmin-4 vs. Ensembl Zebrafish
Match: doc2b (double C2-like domains, beta [Source:ZFIN;Acc:ZDB-GENE-090615-1])

HSP 1 Score: 67.3958 bits (163), Expect = 2.417e-11
Identity = 84/304 (27.63%), Postives = 139/304 (45.72%), Query Frame = 1
Query:  457 EDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRAS-------VQNFRYLKLVNNK--EDPFSQGKDYK----LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKF---------HICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFY--IEKFLSPVKKSDKSL---GSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNI 1281
            EDE++  S   L       AG L       K  GP+  +        Q F    LV +K  E+P  +G D      LG+L F + + ++ N +H ++ + K + +   + G K          ++ ++L PG+ K   L TKT+ +T+NP + E  T+  I++  +   TL + +CD         +GE  + L+ L      +  + F   +EK L   K  DKSL   G I +SL  + +K  L+V +++   L A++ N  S+PY    L     K    +T+VK KT +P +NE   + I
Sbjct:  279 EDEVIDHSRTLLTPPALSRAGSLRSSSTSQKSEGPQADANRDEDDLDQAFGATALVASKKEEEPDVEGYDSDDSTTLGTLDFSLLYDQENNALHCTINKAK-LPVPRYKKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPVWSETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRIPLKKL----KPNQTKNFSNCLEKQLPIDKTDDKSLEERGRIMISLKYSSQKSGLVVGIIRCAHLAAMDANGFSDPYVKTYLKPDENKKSKHKTAVKKKTLNPEFNEEFFYEI 577          
BLAST of Synaptotagmin-4 vs. Ensembl Xenopus
Match: RPH3A (rabphilin 3A [Source:NCBI gene;Acc:100487950])

HSP 1 Score: 70.0922 bits (170), Expect = 2.131e-12
Identity = 59/217 (27.19%), Postives = 111/217 (51.15%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYI--EKFLSPVKKSD-KSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNI 1281
            LGSL F + + ++ N++H  +++ K +      G    ++ ++L PG+ K   L TKT+ +T NP + E   +  I++ +L+  TL + +CD    E ++G  E     +F L+    + K+ F +  E+ +   +  D +  G I VSL  N ++  L+V +++   L A++ N  S+P+  + L     K    +T +K KT +P +NE   + I
Sbjct:   89 LGSLEFSLFYDQENNSLHCGIIKAKGLKPMDSNGLADPYVKLHLLPGASKANKLRTKTLRNTRNPIWNETLVYHGITDEELQRKTLRISVCD----EDKFGHNEFIGETRFSLKKLKPNQKKSFNVCLERVIPNDRGGDVEERGKILVSLMYNTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKAKNKTQIKKKTLNPEFNEEFFYEI 301          
BLAST of Synaptotagmin-4 vs. Ensembl Xenopus
Match: ivns1abp (influenza virus NS1A binding protein [Source:Xenbase;Acc:XB-GENE-949332])

HSP 1 Score: 67.0106 bits (162), Expect = 2.270e-11
Identity = 65/219 (29.68%), Postives = 109/219 (49.77%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYI--EKFLSPVKKSDKSL---GSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNI 1281
            LG+L F + + ++ N +H ++ + K +      G    ++ ++L PG+ K   L TKT+ +T+NP + E  T+  I++  +   TL + +CD         +GE  + L+ L      +  + F I  EK L   K  DKSL   G I +SL  + +K  LLV +++   L A++ N  S+PY    L     K    +T+VK KT +P +NE   + I
Sbjct:  109 LGTLDFSLLYDQENNALHCTINKAKGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRIPLKKL----KPNQTKNFSICLEKQLPIDKTEDKSLEERGRILISLKYSSQKSGLLVGIIRCAHLAAMDANGYSDPYVKTYLKPDEDKKSKHKTAVKKKTLNPEFNEEFCYEI 323          
BLAST of Synaptotagmin-4 vs. Ensembl Xenopus
Match: slc35e1 (solute carrier family 35 member E1 [Source:Xenbase;Acc:XB-GENE-996454])

HSP 1 Score: 65.855 bits (159), Expect = 7.504e-11
Identity = 66/251 (26.29%), Postives = 117/251 (46.61%), Query Frame = 1
Query:  640 YKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKF-------HICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEI 1368
            Y+LG LHF  ++    N ++V ++E +D+       G +        ++ I L P    +  T     T NP F+E  TF  I   + +  TL L + D+        +G++ + L      ++VD  +  +  K + P  +++  LG + +SL+      +L V +++ K L   +++  S+P+  I+LV       T++TS    T DP +NE   F + Q+  LEN+ L   V+     T N+ IG I
Sbjct:  174 YQLGMLHFSTQYDLLHNYLNVRVIEARDLPPPISYDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQNPVFEERYTF-EIQFLEAQRRTLLLTIVDFDKFSRHCVIGKVAMPL------NEVDLVKGGHWWKAIIPSSQNEVELGELLLSLNYLPSAGRLNVDIIRAKQLLQTDMSQGSDPFVKIQLVHGLKLAKTKKTSCMRGTIDPFYNESFSFKVPQEE-LENVSLVFTVYGHNMKTSNDFIGRI 416          
BLAST of Synaptotagmin-4 vs. Ensembl Xenopus
Match: slc35e1 (solute carrier family 35 member E1 [Source:Xenbase;Acc:XB-GENE-996454])

HSP 1 Score: 65.4698 bits (158), Expect = 8.525e-11
Identity = 66/251 (26.29%), Postives = 117/251 (46.61%), Query Frame = 1
Query:  640 YKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKF-------HICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEI 1368
            Y+LG LHF  ++    N ++V ++E +D+       G +        ++ I L P    +  T     T NP F+E  TF  I   + +  TL L + D+        +G++ + L      ++VD  +  +  K + P  +++  LG + +SL+      +L V +++ K L   +++  S+P+  I+LV       T++TS    T DP +NE   F + Q+  LEN+ L   V+     T N+ IG I
Sbjct:  183 YQLGMLHFSTQYDLLHNYLNVRVIEARDLPPPISYDGSRQDMAHSNPYVKICLLPDQKNSKQTGVKRKTQNPVFEERYTF-EIQFLEAQRRTLLLTIVDFDKFSRHCVIGKVAMPL------NEVDLVKGGHWWKAIIPSSQNEVELGELLLSLNYLPSAGRLNVDIIRAKQLLQTDMSQGSDPFVKIQLVHGLKLAKTKKTSCMRGTIDPFYNESFSFKVPQEE-LENVSLVFTVYGHNMKTSNDFIGRI 425          
BLAST of Synaptotagmin-4 vs. Ensembl Xenopus
Match: syt4 (synaptotagmin 4 [Source:NCBI gene;Acc:447980])

HSP 1 Score: 64.6994 bits (156), Expect = 1.479e-10
Identity = 66/260 (25.38%), Postives = 124/260 (47.69%), Query Frame = 1
Query:  625 SQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDI-SITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKS-GTG 1395
            S  K  KLG+L F +E++ +K    V++ E + + ++         +I + + P     + T+ +  T++P F E  TF  I  S+++ L L+  +  +     +  +GE++    F L   ++ D R+    +      +     G + +SL        L V VLK + L   E++  S+PY  + L  +  ++  ++T VK  T + V+NE  +F+I  +  LE+I ++  V    R ++NE IG +   S + GTG
Sbjct:  146 SLDKQDKLGTLFFALEYNFEKKAFVVNIKEARSLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYSQVQDLVLHFIILSFDRFSRDDVIGEVS----FPLSGIELSDGRVLMNREINKRNVRKSAGRGELLISLCYQSTTNTLTVVVLKARHLPKAEVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEG-LEDISVEFLVMDSDRGSRNEVIGRLILGSSADGTG 400          
BLAST of Synaptotagmin-4 vs. Ensembl Mouse
Match: Doc2b (double C2, beta [Source:MGI Symbol;Acc:MGI:1100497])

HSP 1 Score: 68.9366 bits (167), Expect = 4.581e-12
Identity = 65/219 (29.68%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYI--EKFLSPVKKSDKSL---GSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNI 1281
            LG+L F + + ++ N +H ++ + K +      G    ++ ++L PG+ K   L TKT+ +T+NP + E  T+  I++  +   TL + +CD         +GE  + L+ L      +  + F I  EK L   K  DKSL   G I +SL  + +K+ LLV +++   L A++ N  S+PY    L     K    +T+VK KT +P +NE   + I
Sbjct:  127 LGTLDFSLLYDQENNALHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPSWNETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRVPLKKL----KPNHTKTFSICLEKQLPVDKAEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLKPDVDKKSKHKTAVKKKTLNPEFNEEFCYEI 341          
BLAST of Synaptotagmin-4 vs. Ensembl Mouse
Match: Syt7 (synaptotagmin VII [Source:MGI Symbol;Acc:MGI:1859545])

HSP 1 Score: 68.9366 bits (167), Expect = 5.681e-12
Identity = 63/253 (24.90%), Postives = 125/253 (49.41%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T  K +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  180 LGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 425          
BLAST of Synaptotagmin-4 vs. Ensembl Mouse
Match: Syt7 (synaptotagmin VII [Source:MGI Symbol;Acc:MGI:1859545])

HSP 1 Score: 68.5514 bits (166), Expect = 6.077e-12
Identity = 63/253 (24.90%), Postives = 125/253 (49.41%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T  K +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  136 LGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 381          
BLAST of Synaptotagmin-4 vs. Ensembl Mouse
Match: Syt7 (synaptotagmin VII [Source:MGI Symbol;Acc:MGI:1859545])

HSP 1 Score: 68.1662 bits (165), Expect = 1.396e-11
Identity = 63/253 (24.90%), Postives = 125/253 (49.41%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T  K +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  344 LGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 589          
BLAST of Synaptotagmin-4 vs. Ensembl Mouse
Match: Syt7 (synaptotagmin VII [Source:MGI Symbol;Acc:MGI:1859545])

HSP 1 Score: 67.781 bits (164), Expect = 1.638e-11
Identity = 63/253 (24.90%), Postives = 125/253 (49.41%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T  K +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  300 LGRIQFSVGYNFQESTLTVKVMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRVLYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTKKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 545          
BLAST of Synaptotagmin-4 vs. UniProt/SwissProt
Match: sp|K8FE10|SYT2_CAEEL (Synaptotagmin 2 OS=Caenorhabditis elegans OX=6239 GN=snt-2 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 3.137e-15
Identity = 74/287 (25.78%), Postives = 139/287 (48.43%), Query Frame = 1
Query:  541 PVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDY--KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKS---LGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSK 1383
            P+  + P      N  Y + VNN   P S       + G++HF +E+  +++ + V+++   D+      G    ++ + + P   +   T+ I +T+NP + E   FS I  ++L   TL L + D+     +  +G++++ L+ +      D      IE+ L   +K D+    LG I  S         + +++++ + LK +++  SS+PY  I L      L  ++TS KYKT +P +NE   F I + H +E + L + V+   +++KN+ IGE+   SK
Sbjct:   47 PILSSKPITVQPTNSDYYEPVNNGTLPLSSSGALIKQYGNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNGMSDPYVKVYVLPERKQKFETRIIRNTLNPTYNETFQFS-IPFNELHSKTLMLVVYDYDRLSKDDKMGQLSVPLESIDFGITTD------IERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKI-EPHMIEKVHLIVSVWDYDKMSKNDFIGEVTLGSK 325          
BLAST of Synaptotagmin-4 vs. UniProt/SwissProt
Match: sp|O43581|SYT7_HUMAN (Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3)

HSP 1 Score: 72.0182 bits (175), Expect = 3.418e-12
Identity = 62/253 (24.51%), Postives = 124/253 (49.01%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            LG + F + ++ Q++T+ V +++ +++      G     + I L P     L TK     +NP + E   F      K+    L L++ D+        +GE+++ L  +    D+   + F+  K L P      S G + +SL  N     ++V+++K + LKA+++  +S+PY  + L+  + ++  ++T    +  +P++NE   F+I  +   E   + I V  K +L++N+ IG+I    KSG G++
Sbjct:  136 LGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSIPLNKV----DLTQMQTFW--KDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTII-ITVMDKDKLSRNDVIGKIYLSWKSGPGEV 381          
BLAST of Synaptotagmin-4 vs. UniProt/SwissProt
Match: sp|Q14184|DOC2B_HUMAN (Double C2-like domain-containing protein beta OS=Homo sapiens OX=9606 GN=DOC2B PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.905e-11
Identity = 65/219 (29.68%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYI--EKFLSPVKKSDKSL---GSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNI 1281
            LG+L F + + ++ N +H ++ + K +      G    ++ ++L PG+ K   L TKT+ +T+NP + E  T+  I++  +   TL + +CD         +GE  + L+ L      +  + F I  EK L   K  DKSL   G I +SL  + +K+ LLV +++   L A++ N  S+PY    L     K    +T+VK KT +P +NE   + I
Sbjct:  127 LGTLDFSLLYDQENNALHCTITKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPLKKL----KPNHTKTFSICLEKQLPVDKTEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEI 341          
BLAST of Synaptotagmin-4 vs. UniProt/SwissProt
Match: sp|P70169|DOC2B_MOUSE (Double C2-like domain-containing protein beta OS=Mus musculus OX=10090 GN=Doc2b PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 3.204e-11
Identity = 65/219 (29.68%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYI--EKFLSPVKKSDKSL---GSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNI 1281
            LG+L F + + ++ N +H ++ + K +      G    ++ ++L PG+ K   L TKT+ +T+NP + E  T+  I++  +   TL + +CD         +GE  + L+ L      +  + F I  EK L   K  DKSL   G I +SL  + +K+ LLV +++   L A++ N  S+PY    L     K    +T+VK KT +P +NE   + I
Sbjct:  127 LGTLDFSLLYDQENNALHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPSWNETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRVPLKKL----KPNHTKTFSICLEKQLPVDKAEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLKPDVDKKSKHKTAVKKKTLNPEFNEEFCYEI 341          
BLAST of Synaptotagmin-4 vs. UniProt/SwissProt
Match: sp|P70610|DOC2B_RAT (Double C2-like domain-containing protein beta OS=Rattus norvegicus OX=10116 GN=Doc2b PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 3.472e-11
Identity = 65/219 (29.68%), Postives = 110/219 (50.23%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYI--EKFLSPVKKSDKSL---GSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNI 1281
            LG+L F + + ++ N +H ++ + K +      G    ++ ++L PG+ K   L TKT+ +T+NP + E  T+  I++  +   TL + +CD         +GE  + L+ L      +  + F I  EK L   K  DKSL   G I +SL  + +K+ LLV +++   L A++ N  S+PY    L     K    +T+VK KT +P +NE   + I
Sbjct:  127 LGTLDFSLLYDQENNALHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPSWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPLKKL----KPNHTKTFSICLEKQLPVDKAEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLKPDVDKKSKHKTAVKKKTLNPEFNEEFCYEI 341          
BLAST of Synaptotagmin-4 vs. TrEMBL
Match: A0A210QKS0 (Synaptotagmin-11 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT14686 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.597e-17
Identity = 77/275 (28.00%), Postives = 141/275 (51.27%), Query Frame = 1
Query:  595 KLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIR-GGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSP--VKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKLFQ 1407
            K V  +E    + K  KLG+LHF +E+   K  + V++L   D+       GGC  ++ + L P       T+ +  T++P + E  TF  ISE++++ +TL+  +  +     +  +GE+     + L   D   K I ++ K ++P  +K   +  G + VSL       +L V VLK + L  +++   S+PY  I L+ +  ++  ++T VK +T +PV+NE  +F++     L+NI L+  +    R+TKNE IG +E  +++ + +L  
Sbjct:  137 KEVCMREKQIDENKIQKLGNLHFSVEYDSLKTALLVTILRAVDLPQRDPSLGGCDPYVKLQLLPDKRHKCKTRVLRKTLSPTYDETFTFYGISENQIQGITLHFVVLSFDRFSRDEIIGEV----VYPLHGVDPTQKEI-HLTKEINPRHLKFQMQGRGDLLVSLCYQPAANRLTVVVLKARNLPKMDITGLSDPYVKIYLLYNGQRIAKKKTHVKKRTLNPVFNESFLFDVPYNEGLQNISLEFLLLDWDRVTKNEVIGRLEIGARTSSQQLHH 406          
BLAST of Synaptotagmin-4 vs. TrEMBL
Match: A0A2T7P7C6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11893 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.817e-16
Identity = 77/258 (29.84%), Postives = 128/258 (49.61%), Query Frame = 1
Query:  619 PFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSG 1389
            P  +G D+KLG + F + +  Q  T+ + ++   D+    + G    ++ I L P     L TK     +NP + E   F     +KL   TL L++ D+     +  +GE  + L      +D+    + +  KFL P K +   LG + +SL       +L V V+K K LKA ++  SS+PY  I L    TK+  ++TS+K ++ +PV+NE  IF I  +   E + L++ V    +L +NE IG++   S+SG
Sbjct:   26 PIVEGVDFKLGRIQFGLMYDFQNLTLTLRIIRAVDLPAKDVTGTSDPYVKILLLPDKKHKLLTKVKKRNLNPHWNECFLFEGWPHNKLLEKTLYLQVIDYDRFSRDDPIGETYIPLN----ETDLSQSPVVW--KFLQPCKDTRGKLGELLLSLCYQPNIGRLTVIVMKAKELKAKDITGSSDPYVKIWLHFGGTKIEKKKTSIKMRSLNPVYNESFIFEIPWEKIREAM-LEVSVMDFDKLGRNELIGKVILGSRSG 276          
BLAST of Synaptotagmin-4 vs. TrEMBL
Match: A0A2C9K9K8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078264 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.217e-16
Identity = 76/260 (29.23%), Postives = 132/260 (50.77%), Query Frame = 1
Query:  613 EDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSG 1389
            + P+ +G DYKLGSL   + +  Q  T+ + +++ KD+    + G    ++ I L P     L TK     +NP + E   F     +KL   TL L++ D+     +  +GE  + L      ++VD  +   + K+L P K S   LG + +SL       +L V+V+K K LKA ++  SS+PY  I L    T++  ++T++K ++ +P++NE  IF+I  +   E   L++ V    ++ +NE IG +    +SG
Sbjct:  121 QGPYVEGVDYKLGSLQLGLIYDFQSLTLTLRIIKAKDLPAKDVTGTSDPYVKIMLLPDKKHKLLTKVKKKNLNPHWNECFLFEGWPHNKLLEKTLYLQVIDYDRFSRDDPIGETYIPL------NEVDLSQSPVLWKYLQPCKDSRGKLGELLLSLCYQPNIGRLTVTVMKAKDLKAKDITGSSDPYVKIWLSFGATRVEKKKTNIKMRSLNPIYNESFIFDIPWEKIRE-ANLEVSVMDFDKVGRNELIGRVVLGCRSG 373          
BLAST of Synaptotagmin-4 vs. TrEMBL
Match: A0A2C9K9K5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078264 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 5.407e-16
Identity = 76/260 (29.23%), Postives = 132/260 (50.77%), Query Frame = 1
Query:  613 EDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSG 1389
            + P+ +G DYKLGSL   + +  Q  T+ + +++ KD+    + G    ++ I L P     L TK     +NP + E   F     +KL   TL L++ D+     +  +GE  + L      ++VD  +   + K+L P K S   LG + +SL       +L V+V+K K LKA ++  SS+PY  I L    T++  ++T++K ++ +P++NE  IF+I  +   E   L++ V    ++ +NE IG +    +SG
Sbjct:  123 QGPYVEGVDYKLGSLQLGLIYDFQSLTLTLRIIKAKDLPAKDVTGTSDPYVKIMLLPDKKHKLLTKVKKKNLNPHWNECFLFEGWPHNKLLEKTLYLQVIDYDRFSRDDPIGETYIPL------NEVDLSQSPVLWKYLQPCKDSRGKLGELLLSLCYQPNIGRLTVTVMKAKDLKAKDITGSSDPYVKIWLSFGATRVEKKKTNIKMRSLNPIYNESFIFDIPWEKIRE-ANLEVSVMDFDKVGRNELIGRVVLGCRSG 375          
BLAST of Synaptotagmin-4 vs. TrEMBL
Match: A0A2C9K9K2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078264 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.058e-16
Identity = 76/260 (29.23%), Postives = 132/260 (50.77%), Query Frame = 1
Query:  613 EDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSG 1389
            + P+ +G DYKLGSL   + +  Q  T+ + +++ KD+    + G    ++ I L P     L TK     +NP + E   F     +KL   TL L++ D+     +  +GE  + L      ++VD  +   + K+L P K S   LG + +SL       +L V+V+K K LKA ++  SS+PY  I L    T++  ++T++K ++ +P++NE  IF+I  +   E   L++ V    ++ +NE IG +    +SG
Sbjct:  133 QGPYVEGVDYKLGSLQLGLIYDFQSLTLTLRIIKAKDLPAKDVTGTSDPYVKIMLLPDKKHKLLTKVKKKNLNPHWNECFLFEGWPHNKLLEKTLYLQVIDYDRFSRDDPIGETYIPL------NEVDLSQSPVLWKYLQPCKDSRGKLGELLLSLCYQPNIGRLTVTVMKAKDLKAKDITGSSDPYVKIWLSFGATRVEKKKTNIKMRSLNPIYNESFIFDIPWEKIRE-ANLEVSVMDFDKVGRNELIGRVVLGCRSG 385          
BLAST of Synaptotagmin-4 vs. Ensembl Cavefish
Match: syt7b (synaptotagmin 7 [Source:NCBI gene;Acc:103028935])

HSP 1 Score: 80.8777 bits (198), Expect = 8.324e-16
Identity = 69/254 (27.17%), Postives = 124/254 (48.82%), Query Frame = 1
Query:  643 KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            KLG + F + +S Q +T+ V +L+ +D+      G     + I L P     L TK     +NP + E   F      K+   +L L++ D+        +GE+++ L  +    D+   + F+ E  L P      S G + VSL  N     + V+++K + LKA+++  +S+PY  + L+  + ++  ++T V  +  +PV+NE   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  336 KLGRIQFSVGYSFQDSTLTVKILKGQDLPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRSLYLQVLDYDRFSRNDPIGEVSIPLNKI----DLAHMQTFWKE--LKPCSDGSGSRGDLLVSLCYNPTANIITVNIIKARNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVVMKRCLNPVFNESFPFDVP-AHVLRETTIVITVMDKDRLSRNDVIGKIYLSWKSGPAEV 582          
BLAST of Synaptotagmin-4 vs. Ensembl Cavefish
Match: syt7b (synaptotagmin 7 [Source:NCBI gene;Acc:103028935])

HSP 1 Score: 80.1073 bits (196), Expect = 1.708e-15
Identity = 69/254 (27.17%), Postives = 124/254 (48.82%), Query Frame = 1
Query:  643 KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            KLG + F + +S Q +T+ V +L+ +D+      G     + I L P     L TK     +NP + E   F      K+   +L L++ D+        +GE+++ L  +    D+   + F+ E  L P      S G + VSL  N     + V+++K + LKA+++  +S+PY  + L+  + ++  ++T V  +  +PV+NE   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  387 KLGRIQFSVGYSFQDSTLTVKILKGQDLPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRSLYLQVLDYDRFSRNDPIGEVSIPLNKI----DLAHMQTFWKE--LKPCSDGSGSRGDLLVSLCYNPTANIITVNIIKARNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVVMKRCLNPVFNESFPFDVP-AHVLRETTIVITVMDKDRLSRNDVIGKIYLSWKSGPAEV 633          
BLAST of Synaptotagmin-4 vs. Ensembl Cavefish
Match: syt7a (synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-090601-5])

HSP 1 Score: 78.5666 bits (192), Expect = 4.591e-15
Identity = 70/266 (26.32%), Postives = 129/266 (48.50%), Query Frame = 1
Query:  607 NKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            + E P S+    KLG + F + +S Q +T+ V +++ +D+      G     + I L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L  +    ++   + F+ E  L P      S G + +SL  N     + V+++KG+ LKA+++  +S+PY  + L+  + ++  ++T    +  +PV+NE   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  297 DHEGPISE----KLGRIQFSVGYSFQDSTLTVKIMKGQDLPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPLNKV----ELGHNQTFWKE--LKPCSDGSGSRGDLLLSLCYNPTANTITVNIIKGRNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVTIKRCLNPVFNESFPFDVP-AHVLRETTIIITVMDKDRLSRNDVIGKIYLSWKSGPAEV 551          
BLAST of Synaptotagmin-4 vs. Ensembl Cavefish
Match: syt7a (synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-090601-5])

HSP 1 Score: 77.7962 bits (190), Expect = 1.231e-14
Identity = 70/266 (26.32%), Postives = 129/266 (48.50%), Query Frame = 1
Query:  607 NKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            + E P S+    KLG + F + +S Q +T+ V +++ +D+      G     + I L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L  +    ++   + F+ E  L P      S G + +SL  N     + V+++KG+ LKA+++  +S+PY  + L+  + ++  ++T    +  +PV+NE   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  515 DHEGPISE----KLGRIQFSVGYSFQDSTLTVKIMKGQDLPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPLNKV----ELGHNQTFWKE--LKPCSDGSGSRGDLLLSLCYNPTANTITVNIIKGRNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVTIKRCLNPVFNESFPFDVP-AHVLRETTIIITVMDKDRLSRNDVIGKIYLSWKSGPAEV 769          
BLAST of Synaptotagmin-4 vs. Ensembl Cavefish
Match: syt11b (synaptotagmin-11-like [Source:NCBI gene;Acc:103021300])

HSP 1 Score: 63.5438 bits (153), Expect = 1.934e-10
Identity = 64/250 (25.60%), Postives = 118/250 (47.20%), Query Frame = 1
Query:  619 PFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDI-SITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDK--RIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNN-SSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE 1356
            PF+   +   G+L   ++++  K  + V++LE + + ++    G    ++ + + P     + T+ +  T+ P F E  TF  +  S L  LTL+  +  +     +  +GE       L+  +DVD    R+ +I + +S       S G + VSLS      +L V VLK + L  L++   S NPY  + +     ++  ++T VK  T +PV+NE  I+++     L +I ++  V    R TKN+
Sbjct:  149 PFTPADEQNRGTLSLAVDYNFPKKALVVTVLEAQGLPAVDGQAGSADPYVKMTILPDKKHRVKTRVLRRTLEPVFDETFTFYGVPYSSLPELTLHFLVLSFDRFSRDDVIGET------LVPLADVDPSTGRV-HITQQISKRSMQCVSRGELLVSLSYQPVSHRLSVVVLKARHLPKLDITGLSGNPYVKVNVFYGRKRIAKKKTHVKKCTLNPVFNESFIYDVPAD-LLPDISIEFLVMDFDRTTKNQ 390          
BLAST of Synaptotagmin-4 vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 78.9518 bits (193), Expect = 2.171e-16
Identity = 64/243 (26.34%), Postives = 118/243 (48.56%), Query Frame = 1
Query:  643 KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEI 1368
            +LG + F + +    + + + +L+ + +      G     + I L P     L T+     +NP + E  TF     +KL   TL +++ D+        +GE+ + L    E  D+    + + +  L P KK    LG + VSL       +++V V+K   LKA++L  SS+PY  + ++  + +L  ++T++K +T DPVWNE  IF++     + ++     V    R+T+NE IG++
Sbjct:    2 QLGKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSGTSDPFVKIMLLPDKKHKLETRVKRKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPL----ENIDLGPVTLTFTKDLL-PCKKDRVPLGDLLVSLMYQPTNNRIIVVVMKANKLKAMDLTGSSDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDK-IRDLTFVFNVMDYDRITQNELIGQV 238          
BLAST of Synaptotagmin-4 vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 67.781 bits (164), Expect = 2.327e-12
Identity = 73/252 (28.97%), Postives = 121/252 (48.02%), Query Frame = 1
Query:  607 NKEDPFSQ-GKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEI 1359
            N ED  S      K+G ++F +++S   NT+ V ++  +DI      G    ++ I L P   K   TK    T+NP F E+  F NI  S++    L ++L D+        +GE  L L  +  AS++++ R+            S   LG I  SL       KL +++++ K LK+++L   S+PY  I LV    K+  ++T+VK +T +P +NE   F +  +  +E   L I V    R+ K+E+
Sbjct:   70 NSEDYHSDLSSGVKIGRINFTLDYSFTDNTLTVGIIRAEDIPAKDFSGSSDPYVKIMLLPDKKKKYETKVHRKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARLPLIDVDLASNINEWRVLTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSLKSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVAFEK-IEQTSLIISVLDYDRVGKSEM 320          
BLAST of Synaptotagmin-4 vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 64.6994 bits (156), Expect = 1.515e-11
Identity = 65/231 (28.14%), Postives = 116/231 (50.22%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKT--LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYG-VGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVF 1329
            LG L F + + K  + + V + + K +      G    ++ ++L PG+ K+  L + T   T+NP F E  T+  I+E ++   TL L++ D +D+ G    +GE +++L+ L        KR    +   SP       LG I ++L  N ++  L V+V++  GL +++ N  S+PY    L     K   RRT+++ KT +P +NE  +++I   H L    L++ V+
Sbjct:   19 LGLLEFTLRYQKLDSRLDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFD-EDTIGRNDFIGETSINLKLLNSNPTQTFKRSLIPKALDSP----HSPLGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAH-HELAKKSLEVTVW 243          
BLAST of Synaptotagmin-4 vs. Ensembl Nematostella
Match: EDO28994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4W7])

HSP 1 Score: 46.9802 bits (110), Expect = 9.085e-7
Identity = 22/70 (31.43%), Postives = 42/70 (60.00%), Query Frame = 1
Query: 1162 SNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEI 1368
            S+PY  + ++  + +L  ++T++K +T DPVWNE  IF++     + ++     V    R+T+NE IG++
Sbjct:    2 SDPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIFDVPLDK-IRDLTFVFNVMDYDRITQNELIGQV 70          
BLAST of Synaptotagmin-4 vs. Ensembl Medaka
Match: syt7b (synaptotagmin-7 [Source:NCBI gene;Acc:101166118])

HSP 1 Score: 81.6481 bits (200), Expect = 4.770e-16
Identity = 69/254 (27.17%), Postives = 127/254 (50.00%), Query Frame = 1
Query:  643 KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            KLG + F + +S Q +T+ V +L+ +++      G     + + L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L  L    D+ + + F+ E  L P      S G + VSL  N     + VS++K + LKA+++  +S+PY  + L++ + ++  ++T+V  +  +PV+N+   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  289 KLGRIQFSVGYSFQDSTLTVKILKGQELPAKDFSGTSDPFVKLYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRTLYLQVLDYDRFSRNDPIGEVSIPLNKL----DLANMQTFWKE--LKPCSDGSGSRGDLLVSLCYNPTANIITVSIIKARNLKAMDIGGTSDPYVKVWLMNKDKRVEKKKTAVMKRCLNPVFNDSFPFDVP-AHVLRETTIIITVMDKDRLSRNDVIGKIYLSWKSGPAEV 535          
BLAST of Synaptotagmin-4 vs. Ensembl Medaka
Match: syt7b (synaptotagmin-7 [Source:NCBI gene;Acc:101166118])

HSP 1 Score: 81.6481 bits (200), Expect = 4.974e-16
Identity = 69/254 (27.17%), Postives = 127/254 (50.00%), Query Frame = 1
Query:  643 KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            KLG + F + +S Q +T+ V +L+ +++      G     + + L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L  L    D+ + + F+ E  L P      S G + VSL  N     + VS++K + LKA+++  +S+PY  + L++ + ++  ++T+V  +  +PV+N+   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  259 KLGRIQFSVGYSFQDSTLTVKILKGQELPAKDFSGTSDPFVKLYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRTLYLQVLDYDRFSRNDPIGEVSIPLNKL----DLANMQTFWKE--LKPCSDGSGSRGDLLVSLCYNPTANIITVSIIKARNLKAMDIGGTSDPYVKVWLMNKDKRVEKKKTAVMKRCLNPVFNDSFPFDVP-AHVLRETTIIITVMDKDRLSRNDVIGKIYLSWKSGPAEV 505          
BLAST of Synaptotagmin-4 vs. Ensembl Medaka
Match: syt7b (synaptotagmin-7 [Source:NCBI gene;Acc:101166118])

HSP 1 Score: 81.6481 bits (200), Expect = 5.138e-16
Identity = 69/254 (27.17%), Postives = 127/254 (50.00%), Query Frame = 1
Query:  643 KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            KLG + F + +S Q +T+ V +L+ +++      G     + + L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L  L    D+ + + F+ E  L P      S G + VSL  N     + VS++K + LKA+++  +S+PY  + L++ + ++  ++T+V  +  +PV+N+   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  336 KLGRIQFSVGYSFQDSTLTVKILKGQELPAKDFSGTSDPFVKLYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRTLYLQVLDYDRFSRNDPIGEVSIPLNKL----DLANMQTFWKE--LKPCSDGSGSRGDLLVSLCYNPTANIITVSIIKARNLKAMDIGGTSDPYVKVWLMNKDKRVEKKKTAVMKRCLNPVFNDSFPFDVP-AHVLRETTIIITVMDKDRLSRNDVIGKIYLSWKSGPAEV 582          
BLAST of Synaptotagmin-4 vs. Ensembl Medaka
Match: syt7a (synaptotagmin-7-like [Source:NCBI gene;Acc:101169108])

HSP 1 Score: 78.9518 bits (193), Expect = 1.765e-15
Identity = 72/267 (26.97%), Postives = 127/267 (47.57%), Query Frame = 1
Query:  604 NNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            ++ E P S+    KLG + F I +S Q  T+ V +L+ +D+      G     + I L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L  +    ++   + F+ E  L P        G + VSL  N     + V+++K + LKA+++  +S+PY  + L+  + ++  ++T V     +PV+NE   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  115 DDGEGPISE----KLGRIQFSIGYSFQNTTLTVKVLKGQDLPAKDFSGTSDPFVKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVRERTLYLQVLDYDRFSRNDPIGEVSIPLNKV----ELGQMKTFWKE--LKPCSDGSGRRGELLVSLCYNPTANTITVNIIKARNLKAMDIGGTSDPYVKVWLMHKDKRVEKKKTVVIKCCLNPVFNESFPFDVPA-HVLRETTIVITVMDKDRLSRNDVIGKIYLSWKSGPAEV 370          
BLAST of Synaptotagmin-4 vs. Ensembl Medaka
Match: syt7b (synaptotagmin-7 [Source:NCBI gene;Acc:101166118])

HSP 1 Score: 79.7221 bits (195), Expect = 2.294e-15
Identity = 69/254 (27.17%), Postives = 127/254 (50.00%), Query Frame = 1
Query:  643 KLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFPSKSGTGKL 1401
            KLG + F + +S Q +T+ V +L+ +++      G     + + L P     L TK     +NP + E   F      K+   TL L++ D+        +GE+++ L  L    D+ + + F+ E  L P      S G + VSL  N     + VS++K + LKA+++  +S+PY  + L++ + ++  ++T+V  +  +PV+N+   F++   H L    + I V  K RL++N+ IG+I    KSG  ++
Sbjct:  403 KLGRIQFSVGYSFQDSTLTVKILKGQELPAKDFSGTSDPFVKLYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRTLYLQVLDYDRFSRNDPIGEVSIPLNKL----DLANMQTFWKE--LKPCSDGSGSRGDLLVSLCYNPTANIITVSIIKARNLKAMDIGGTSDPYVKVWLMNKDKRVEKKKTAVMKRCLNPVFNDSFPFDVP-AHVLRETTIIITVMDKDRLSRNDVIGKIYLSWKSGPAEV 649          
BLAST of Synaptotagmin-4 vs. Planmine SMEST
Match: SMESG000038432.1 (SMESG000038432.1)

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 445/445 (100.00%), Postives = 445/445 (100.00%), Query Frame = 1
Query:  163 MIPPRVNSTIYTPLSSKNLILISFAGVVXXXXXXXXXXXXYRKLKSNKDFDICCLEFIKQFSMSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGTGKLFQNGTPFNXXXXXXXXXXXIKQISRLDPERLL 1497
            MIPPRVNSTIYTPLSSKNLILISFAGVVISICILIIFIIIYRKLKSNKDFDICCLEFIKQFSMSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGTGKLFQNGTPFNLLSLLWLCQSLIKQISRLDPERLL
Sbjct:    1 MIPPRVNSTIYTPLSSKNLILISFAGVVISICILIIFIIIYRKLKSNKDFDICCLEFIKQFSMSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGTGKLFQNGTPFNLLSLLWLCQSLIKQISRLDPERLL 445          
BLAST of Synaptotagmin-4 vs. Planmine SMEST
Match: SMESG000038432.1 (SMESG000038432.1)

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 440/445 (98.88%), Postives = 440/445 (98.88%), Query Frame = 1
Query:  163 MIPPRVNSTIYTPLSSKNLILISFAGVVXXXXXXXXXXXXYRKLKSNKDFDICCLEFIKQFSMSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGTGKLFQNGTPFNXXXXXXXXXXXIKQISRLDPERLL 1497
            MIPPRVNSTIYTPLSSKNLILISFAGVVISICILIIFIIIYRKLKSNKDFDICCLEFIKQFSMSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGT     NGTPFNLLSLLWLCQSLIKQISRLDPERLL
Sbjct:    1 MIPPRVNSTIYTPLSSKNLILISFAGVVISICILIIFIIIYRKLKSNKDFDICCLEFIKQFSMSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGT-----NGTPFNLLSLLWLCQSLIKQISRLDPERLL 440          
BLAST of Synaptotagmin-4 vs. Planmine SMEST
Match: SMESG000038432.1 (SMESG000038432.1)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 378/383 (98.69%), Postives = 378/383 (98.69%), Query Frame = 1
Query:  349 MSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGTGKLFQNGTPFNXXXXXXXXXXXIKQISRLDPERLL 1497
            MSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGT     NGTPFNLLSLLWLCQSLIKQISRLDPERLL
Sbjct:    1 MSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGT-----NGTPFNLLSLLWLCQSLIKQISRLDPERLL 378          
BLAST of Synaptotagmin-4 vs. Planmine SMEST
Match: SMESG000038432.1 (SMESG000038432.1)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 362/383 (94.52%), Postives = 363/383 (94.78%), Query Frame = 1
Query:  349 MSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLGSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGTGKLFQNGTPFNXXXXXXXXXXXIKQISRLDPERLL 1497
            MSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFL              E F+S  K   KSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGTGKLFQNGTPFNLLSLLWLCQSLIKQISRLDPERLL
Sbjct:    1 MSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEEDEMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNKEDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFL--------------EIFISCQK---KSLGSIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIGEIEFPSKSGTGKLFQNGTPFNLLSLLWLCQSLIKQISRLDPERLL 366          
BLAST of Synaptotagmin-4 vs. Planmine SMEST
Match: SMESG000009083.1 (SMESG000009083.1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.959e-11
Identity = 72/264 (27.27%), Postives = 128/264 (48.48%), Query Frame = 1
Query:  646 LGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFHICINLTPG-SHKT-LSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLCDWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSL-----GSIFVSLSVNMXXXXXXXXXXXXXXXXXXELNNSSNPYCLIKLVSSNTKLGTRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNE-IGEIEFP--SKSGTGKLFQ 1407
            LG L++ I      + + +++   KD+    I G    ++  +L PG +HKT L TKT   T+NP + E+  +  I+   ++  TL L + D +D+ G   +GE  L   FL + +  ++    +      P+ K +  L     G I +SL  N K   + V++++   L  ++ N  S+P+C I L     ++  R+T  K  T +P +NE  +  + Q  + E   L+I V+   R   N+ IG ++F   +K   GKL++
Sbjct:  328 LGILNYKIFHDSALSQLVITICNGKDLKSMDINGLSDPYVKCHLLPGKTHKTKLRTKTCYRTLNPIWNEKLVYHGINRIDMDSKTLRLAVLD-EDTIGFDWIGEYRL---FLPDLNSDEEYNFSHNLLQRQPIAKDNDDLVDHERGKILISLLFNDKNSTIQVTIVRCTELAPMDCNGFSDPFCKIYLKPDKIRITKRKTQTKKMTLNPYFNEEFVIELDQGWYKEKT-LEISVWDYDRGPTNDFIGVVKFHFRAKGDRGKLWK 586          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT76.153e-1324.51synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514... [more]
SYT77.118e-1324.51synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514... [more]
SYT71.628e-1224.51synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514... [more]
SYT71.653e-1224.51synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514... [more]
SYT71.893e-1224.51synaptotagmin 7 [Source:HGNC Symbol;Acc:HGNC:11514... [more]
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-22.466e-1625.78Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-61.599e-1128.44SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4... [more]
rbf-11.667e-1027.12Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-11.703e-1027.12Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
rbf-11.875e-1027.12Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syt74.938e-1528.29gene:FBgn0039900 transcript:FBtr0089139[more]
Syt73.385e-1428.29gene:FBgn0039900 transcript:FBtr0343990[more]
Syt73.385e-1428.29gene:FBgn0039900 transcript:FBtr0089137[more]
Syt41.360e-1124.00gene:FBgn0028400 transcript:FBtr0081578[more]
Sytalpha5.445e-923.43gene:FBgn0261089 transcript:FBtr0303255[more]
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt7a1.978e-1626.97synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
syt7a2.300e-1526.97synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
syt7b4.278e-1527.17synaptotagmin VIIb [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
doc2b7.550e-1328.14double C2-like domains, beta [Source:ZFIN;Acc:ZDB-... [more]
doc2b2.417e-1127.63double C2-like domains, beta [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPH3A2.131e-1227.19rabphilin 3A [Source:NCBI gene;Acc:100487950][more]
ivns1abp2.270e-1129.68influenza virus NS1A binding protein [Source:Xenba... [more]
slc35e17.504e-1126.29solute carrier family 35 member E1 [Source:Xenbase... [more]
slc35e18.525e-1126.29solute carrier family 35 member E1 [Source:Xenbase... [more]
syt41.479e-1025.38synaptotagmin 4 [Source:NCBI gene;Acc:447980][more]
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Doc2b4.581e-1229.68double C2, beta [Source:MGI Symbol;Acc:MGI:1100497... [more]
Syt75.681e-1224.90synaptotagmin VII [Source:MGI Symbol;Acc:MGI:18595... [more]
Syt76.077e-1224.90synaptotagmin VII [Source:MGI Symbol;Acc:MGI:18595... [more]
Syt71.396e-1124.90synaptotagmin VII [Source:MGI Symbol;Acc:MGI:18595... [more]
Syt71.638e-1124.90synaptotagmin VII [Source:MGI Symbol;Acc:MGI:18595... [more]
back to top
BLAST of Synaptotagmin-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|K8FE10|SYT2_CAEEL3.137e-1525.78Synaptotagmin 2 OS=Caenorhabditis elegans OX=6239 ... [more]
sp|O43581|SYT7_HUMAN3.418e-1224.51Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE... [more]
sp|Q14184|DOC2B_HUMAN2.905e-1129.68Double C2-like domain-containing protein beta OS=H... [more]
sp|P70169|DOC2B_MOUSE3.204e-1129.68Double C2-like domain-containing protein beta OS=M... [more]
sp|P70610|DOC2B_RAT3.472e-1129.68Double C2-like domain-containing protein beta OS=R... [more]
back to top
BLAST of Synaptotagmin-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QKS02.597e-1728.00Synaptotagmin-11 OS=Mizuhopecten yessoensis OX=657... [more]
A0A2T7P7C61.817e-1629.84Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2C9K9K85.217e-1629.23Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9K9K55.407e-1629.23Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9K9K27.058e-1629.23Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt7b8.324e-1627.17synaptotagmin 7 [Source:NCBI gene;Acc:103028935][more]
syt7b1.708e-1527.17synaptotagmin 7 [Source:NCBI gene;Acc:103028935][more]
syt7a4.591e-1526.32synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
syt7a1.231e-1426.32synaptotagmin VIIa [Source:ZFIN;Acc:ZDB-GENE-09060... [more]
syt11b1.934e-1025.60synaptotagmin-11-like [Source:NCBI gene;Acc:103021... [more]
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO437042.171e-1626.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317462.327e-1228.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419331.515e-1128.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289949.085e-731.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt7b4.770e-1627.17synaptotagmin-7 [Source:NCBI gene;Acc:101166118][more]
syt7b4.974e-1627.17synaptotagmin-7 [Source:NCBI gene;Acc:101166118][more]
syt7b5.138e-1627.17synaptotagmin-7 [Source:NCBI gene;Acc:101166118][more]
syt7a1.765e-1526.97synaptotagmin-7-like [Source:NCBI gene;Acc:1011691... [more]
syt7b2.294e-1527.17synaptotagmin-7 [Source:NCBI gene;Acc:101166118][more]
back to top
BLAST of Synaptotagmin-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038432.10.000e+0100.00SMESG000038432.1[more]
SMESG000038432.10.000e+098.88SMESG000038432.1[more]
SMESG000038432.10.000e+098.69SMESG000038432.1[more]
SMESG000038432.10.000e+094.52SMESG000038432.1[more]
SMESG000009083.11.959e-1127.27SMESG000009083.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000412 ID=SMED30000412|Name=Synaptotagmin-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1549bp
AATCTTGATTACTTTTTAAAAATATTTACAAACTTGAGCTTTATTTTTAG
CTTTTGTTGATATGCTTTTGTTTTAATGGTCAACTGTTGAATAATAATAC
CAGTTCAGTCTGATGTTTCTCATTTGGAACCTTGGAACTTTTCATCACTA
CTTTGTTTCTCGATGATCCCACCGAGAGTTAACAGCACAATTTATACTCC
TTTGAGTTCGAAAAATTTAATTTTAATTTCATTTGCAGGAGTTGTAATAT
CGATTTGCATTTTAATAATTTTTATAATTATTTATCGAAAGTTGAAATCA
AATAAAGATTTTGACATATGTTGCCTCGAATTTATCAAACAGTTTTCGAT
GTCTCCTTCATCAGACGAAAGAAAAAGCAAAGTTACTGTCAACAATAAAA
TCAACAAAAGCTTTTCGATGAGAAGCTTCAAAAGTACCGATTGCTTGGAT
TCTGAAGAAGACGAAATGATGAGAAAATCCTATTTGAGTTTGGTTCGTCA
GCAAAGAAAAACGGCAGGTTTTCTCAGTGTGCCAGAAAAACCGGTAAAGG
AAACTGGACCAAGAAGAGCCTCTGTTCAGAATTTTCGATATTTGAAATTG
GTAAACAACAAAGAAGACCCATTTTCCCAAGGAAAAGATTATAAATTAGG
AAGTTTGCATTTTATCATTGAATTTAGTAAGCAGAAAAATACCATTCACG
TTAGTATGTTGGAGGTGAAAGATATTTCAATCACTTATATCAGGGGGGGC
TGTAAATTTCATATCTGTATAAATCTCACCCCGGGTTCACATAAAACCTT
GTCTACGAAAACGATTTGTCACACTATTAATCCTAGATTTCAAGAGGAAA
AGACTTTCAGCAACATTTCTGAAAGCAAATTGGAGTATTTGACATTAAAC
TTAAAATTATGCGACTGGAAAGATTCTGAAGGAGAATATGGAGTCGGAGA
AATAAATCTTTCGTTGCAATTTCTGTTGGAGGCCAGCGATGTAGATGACA
AACGAATATTTTATATAGAGAAATTTTTATCTCCTGTCAAAAAAAGTGAC
AAGTCACTTGGATCTATTTTTGTTTCATTGTCAGTAAATATGAAAAAAGA
AAAATTATTAGTTTCTGTTTTGAAGGGGAAAGGTTTGAAGGCACTCGAAT
TAAACAATTCATCAAATCCCTATTGTTTGATAAAGTTAGTCTCTTCCAAT
ACCAAACTTGGAACTCGAAGAACCTCAGTCAAGTACAAAACTACTGATCC
AGTTTGGAATGAGCCAATTATATTTAATATCACTCAAAAACATTTTCTAG
AAAATATTTGTTTAAAAATTAAAGTTTTTAGTAAAGGGAGACTGACTAAA
AATGAAATCGGAGAGATAGAGTTTCCCTCTAAATCTGGAACTGGGAAACT
ATTTCAGAATGGCACTCCCTTCAATCTTCTTAGTCTCTTGTGGTTGTGTC
AAAGTTTAATAAAACAGATTTCAAGATTAGATCCAGAGAGATTATTAAAC
TTTTATTTTATCATTACCAATATATTTATTTAATACTATTAGTCTCAAG
back to top

protein sequence of SMED30000412-orf-1

>SMED30000412-orf-1 ID=SMED30000412-orf-1|Name=SMED30000412-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=457bp
MIPPRVNSTIYTPLSSKNLILISFAGVVISICILIIFIIIYRKLKSNKDF
DICCLEFIKQFSMSPSSDERKSKVTVNNKINKSFSMRSFKSTDCLDSEED
EMMRKSYLSLVRQQRKTAGFLSVPEKPVKETGPRRASVQNFRYLKLVNNK
EDPFSQGKDYKLGSLHFIIEFSKQKNTIHVSMLEVKDISITYIRGGCKFH
ICINLTPGSHKTLSTKTICHTINPRFQEEKTFSNISESKLEYLTLNLKLC
DWKDSEGEYGVGEINLSLQFLLEASDVDDKRIFYIEKFLSPVKKSDKSLG
SIFVSLSVNMKKEKLLVSVLKGKGLKALELNNSSNPYCLIKLVSSNTKLG
TRRTSVKYKTTDPVWNEPIIFNITQKHFLENICLKIKVFSKGRLTKNEIG
EIEFPSKSGTGKLFQNGTPFNLLSLLWLCQSLIKQISRLDPERLLNFYFI
ITNIFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 177..278
e-value: 20.0
score: 5.1
coord: 314..422
e-value: 1.6E-11
score: 54.2
IPR000008C2 domainPFAMPF00168C2coord: 179..272
e-value: 6.8E-4
score: 19.9
coord: 314..408
e-value: 8.2E-14
score: 51.8
IPR000008C2 domainPROSITEPS50004C2coord: 314..403
score: 14.156
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 290..417
e-value: 1.1E-25
score: 92.0
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 156..280
e-value: 4.6E-13
score: 51.2
NoneNo IPR availablePANTHERPTHR10024:SF227SYNAPTOTAGMIN 1coord: 27..407
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 27..407
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 294..408
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 158..272
NoneNo IPR availableTMHMMTMhelixcoord: 19..41