Dynamin-1

Overview
NameDynamin-1
Smed IDSMED30000411
Length (bp)2688
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynamin-1 (SMED30000411) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynamin-1 (SMED30000411) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynamin-1 (SMED30000411) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynamin-1 (SMED30000411) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000411

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000411SMESG000021502.1 dd_Smed_v4_2160_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000411SMESG000021502.1 dd_Smed_v4_2160_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000411SMESG000021502.1 dd_Smed_v4_2160_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000411SMESG000021502.1 dd_Smed_v4_2160_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000411SMESG000021502.1 dd_Smed_v4_2160_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000411SMESG000021502.1 SMED30000411smed_20140614PMID:24950970
Talbot et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 979.163 bits (2530), Expect = 0.000e+0
Identity = 507/781 (64.92%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ ATTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALK++KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PD+AFEA VK++++KLKEPS+KCVD+VV EL   I  C+EK+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 978.393 bits (2528), Expect = 0.000e+0
Identity = 507/781 (64.92%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ ATTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALK++KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PD+AFEA VK++++KLKEPS+KCVD+VV EL   I  C+EK+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 978.393 bits (2528), Expect = 0.000e+0
Identity = 507/781 (64.92%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ ATTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALK++KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PD+AFEA VK++++KLKEPS+KCVD+VV EL   I  C+EK+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 978.008 bits (2527), Expect = 0.000e+0
Identity = 503/781 (64.40%), Postives = 621/781 (79.51%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ ATTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALK++KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PDMAFE IVK++++K++EP +KCVD+V+ ELI  +  CT+K+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ       +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ-------VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 760          
BLAST of Dynamin-1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 977.622 bits (2526), Expect = 0.000e+0
Identity = 504/781 (64.53%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ ATTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALK++KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PDMAFE IVK++++K++EP +KCVD+V+ ELI  +  CT+K+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 461/780 (59.10%), Postives = 589/780 (75.51%), Query Frame = 1
Query:   79 NYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAE-IETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNK--LGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDET-EPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPS 2403
            N GM+ LI V+NR+QDAF  L   ++  LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQLI    EYAEFLH    +F DF+ VR+EIE +T+R+TG+NKGIS  PINLRV+SPNVLNLTLIDLPG+TKV VGDQP +IE QIR MIL +I  E CLILAV+PANSDLA SDALK++KEVDP G+RTIGV+TKLDLMDEGTDAR+IL+NKL  LRRGYVG+VNR Q+DI G+KDIR AL AERKFFI+H SY+H+ADR+GT+YLQ  LNQQLTNHIRD+LP L++S++ ++ ++E++V   K+ +P DP  KTKAL+  V  F     +SIEGS A+ + T ELSGGA IN++FHERFP+E++K            +E DE+E+R++I YAI+N HGIR G+F PDMAFEAI K++I +LKEPS+KCVDLVV EL  +I  C + M  YPRLR+E+ER+    +R  E  AK QI  ++D +LAY+NTNH DF   +N + K + G+  K  LGNQ       +IR+GWL+L NV+ +R GSKD +F+L SDSLSW+KDDE+ EKK+ + L+G+KLKDI GGFMS+   FALF P+ KN+YKDYKQLEL   N + +DAWKASFLRAGVYP K +  E    ++ +  +I  DPQLERQVETIRNLV+SYM+I++K+ +DLVPK +M +I+++   F+K E+LA++Y   D + LMEES+ E  +RE +LR + A K+AL II+EV+  T+    P     D+R P PS
Sbjct:    5 NQGMQALIPVINRVQDAFSQLGTSVSFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRKTKALLQMVTQFNADIERSIEGSSAKLVSTNELSGGARINRLFHERFPFEIVK------------MEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVDLVVNELANVIRQCADTMARYPRLRDELERIVVSHMREREQIAKQQIGLIVDYELAYMNTNHEDFIGFSNAEAKASQGQSAKKNLGNQ-------VIRKGWLSLSNVSFVR-GSKDNWFVLMSDSLSWYKDDEEKEKKYMLPLDGVKLKDIEGGFMSRNHKFALFYPDGKNIYKDYKQLELGCTNLDEIDAWKASFLRAGVYPEKQKAQEDESQQEMEDTSI--DPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLIVNQTGEFMKDELLAHLYQCGDTDALMEESQIEAQKREEMLRMYHACKEALRIISEVNMSTLGDQPPPLPMSDYR-PHPS 761          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 885.56 bits (2287), Expect = 0.000e+0
Identity = 461/780 (59.10%), Postives = 589/780 (75.51%), Query Frame = 1
Query:   79 NYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAE-IETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNK--LGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDET-EPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPS 2403
            N GM+ LI V+NR+QDAF  L   ++  LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQLI    EYAEFLH    +F DF+ VR+EIE +T+R+TG+NKGIS  PINLRV+SPNVLNLTLIDLPG+TKV VGDQP +IE QIR MIL +I  E CLILAV+PANSDLA SDALK++KEVDP G+RTIGV+TKLDLMDEGTDAR+IL+NKL  LRRGYVG+VNR Q+DI G+KDIR AL AERKFFI+H SY+H+ADR+GT+YLQ  LNQQLTNHIRD+LP L++S++ ++ ++E++V   K+ +P DP  KTKAL+  V  F     +SIEGS A+ + T ELSGGA IN++FHERFP+E++K            +E DE+E+R++I YAI+N HGIR G+F PDMAFEAI K++I +LKEPS+KCVDLVV EL  +I  C + M  YPRLR+E+ER+    +R  E  AK QI  ++D +LAY+NTNH DF   +N + K + G+  K  LGNQ       +IR+GWL+L NV+ +R GSKD +F+L SDSLSW+KDDE+ EKK+ + L+G+KLKDI GGFMS+   FALF P+ KN+YKDYKQLEL   N + +DAWKASFLRAGVYP K +  E    ++ +  +I  DPQLERQVETIRNLV+SYM+I++K+ +DLVPK +M +I+++   F+K E+LA++Y   D + LMEES+ E  +RE +LR + A K+AL II+EV+  T+    P     D+R P PS
Sbjct:    5 NQGMQALIPVINRVQDAFSQLGTSVSFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRKTKALLQMVTQFNADIERSIEGSSAKLVSTNELSGGARINRLFHERFPFEIVK------------MEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVDLVVNELANVIRQCADTMARYPRLRDELERIVVSHMREREQIAKQQIGLIVDYELAYMNTNHEDFIGFSNAEAKASQGQSAKKNLGNQ-------VIRKGWLSLSNVSFVR-GSKDNWFVLMSDSLSWYKDDEEKEKKYMLPLDGVKLKDIEGGFMSRNHKFALFYPDGKNIYKDYKQLELGCTNLDEIDAWKASFLRAGVYPEKQKAQEDESQQEMEDTSI--DPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLIVNQTGEFMKDELLAHLYQCGDTDALMEESQIEAQKREEMLRMYHACKEALRIISEVNMSTLGDQPPPLPMSDYR-PHPS 761          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 426.787 bits (1096), Expect = 1.580e-137
Identity = 242/522 (46.36%), Postives = 336/522 (64.37%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSX-XXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL----------------ITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHC----TEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIE-LIDMQLAYINTNHADF 1587
            ME LI VVN+LQD F +L      + LPQI VVGSQSAGKSSVLEN VGRDFLPRG+GIVTRRPL+LQL                   T ++A F H  +K FTDF+ VR+EIE +T+R+TG NKGIS  PI+L++YS  V++L+L+DLPG+TK+ VGDQP NIE QIR MIL YI   + +ILAV+PAN D A S+ +K+++EVD GG RT+ V+TKLDLMD+GTDA D+L  K++P++ G +G+VNRSQ++I   K I  A+  E+ F    K Y  LA R GT YL K LN  L +HIR+ LP LK  +    A  + ++ A      E    K + L+  +  F T +  +IEG+   IET EL GGA I  IFH+ F   L   N L    +L QL+         I  AI+N  G R  +F+P+++FE +VKR+I++L+EPS++CV+LV  E+ +++ HC     ++M  +PRL ++I  + S  ++ E +   ++++E L+ ++LAYINT H +F
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFM--QKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFG----EPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPL---ENLTQLD---------ILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLK-ERLKPTNELVENLVAIELAYINTKHPEF 503          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 426.787 bits (1096), Expect = 1.580e-137
Identity = 242/522 (46.36%), Postives = 336/522 (64.37%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSX-XXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL----------------ITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHC----TEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIE-LIDMQLAYINTNHADF 1587
            ME LI VVN+LQD F +L      + LPQI VVGSQSAGKSSVLEN VGRDFLPRG+GIVTRRPL+LQL                   T ++A F H  +K FTDF+ VR+EIE +T+R+TG NKGIS  PI+L++YS  V++L+L+DLPG+TK+ VGDQP NIE QIR MIL YI   + +ILAV+PAN D A S+ +K+++EVD GG RT+ V+TKLDLMD+GTDA D+L  K++P++ G +G+VNRSQ++I   K I  A+  E+ F    K Y  LA R GT YL K LN  L +HIR+ LP LK  +    A  + ++ A      E    K + L+  +  F T +  +IEG+   IET EL GGA I  IFH+ F   L   N L    +L QL+         I  AI+N  G R  +F+P+++FE +VKR+I++L+EPS++CV+LV  E+ +++ HC     ++M  +PRL ++I  + S  ++ E +   ++++E L+ ++LAYINT H +F
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFM--QKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFG----EPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPL---ENLTQLD---------ILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLK-ERLKPTNELVENLVAIELAYINTKHPEF 503          
BLAST of Dynamin-1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 426.787 bits (1096), Expect = 1.580e-137
Identity = 242/522 (46.36%), Postives = 336/522 (64.37%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSX-XXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL----------------ITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHC----TEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIE-LIDMQLAYINTNHADF 1587
            ME LI VVN+LQD F +L      + LPQI VVGSQSAGKSSVLEN VGRDFLPRG+GIVTRRPL+LQL                   T ++A F H  +K FTDF+ VR+EIE +T+R+TG NKGIS  PI+L++YS  V++L+L+DLPG+TK+ VGDQP NIE QIR MIL YI   + +ILAV+PAN D A S+ +K+++EVD GG RT+ V+TKLDLMD+GTDA D+L  K++P++ G +G+VNRSQ++I   K I  A+  E+ F    K Y  LA R GT YL K LN  L +HIR+ LP LK  +    A  + ++ A      E    K + L+  +  F T +  +IEG+   IET EL GGA I  IFH+ F   L   N L    +L QL+         I  AI+N  G R  +F+P+++FE +VKR+I++L+EPS++CV+LV  E+ +++ HC     ++M  +PRL ++I  + S  ++ E +   ++++E L+ ++LAYINT H +F
Sbjct:    1 MENLIPVVNKLQDVFATLGRKEDQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAMDVLMGKVIPVKLGIIGVVNRSQQNILDNKLIVDAVKDEQSFM--QKKYPTLASRNGTPYLAKRLNMLLMHHIRNCLPALKARVSIMNAQCQSDLVAFG----EPVEDKNRTLLQIITRFATAYTSTIEGTARNIETTELCGGARICYIFHDTFGRSLESVNPL---ENLTQLD---------ILTAIRNATGPRPALFVPEVSFELLVKRQIQRLEEPSLRCVELVHEEMQRMVQHCGFTTQQEMIRFPRLYDKINEVVSGVLK-ERLKPTNELVENLVAIELAYINTKHPEF 503          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301596)

HSP 1 Score: 914.835 bits (2363), Expect = 0.000e+0
Identity = 474/775 (61.16%), Postives = 606/775 (78.19%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSG-AEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGF--MSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDE-----KTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDW 2385
            M+ LI +VN+LQDAF SL + + L+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQLI   TEY EFLH   KKF+ F+E+R+EIE +T+R+TG NKGISN PINLRVYSP+VLNLTLIDLPG+TKVA+GDQP +IE QI+ MI Q+I++E CLILAV+PAN+DLANSDALK++KEVDP GVRTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DI+G+KDI  ALAAERKFF++H SY+H+ADR+GT YLQ+VLNQQLTNHIRD+LP L++ ++ Q+ ++E+EVE  K  +P D + KTKA++  +Q  ++ F ++IEGSG A + T ELSGGA IN+IFHER  +E++K            +  DE+ELRR+IS+AI+N HGIR G+F PDMAFEAIVKR+I  LKEP +KCVDLVV EL  ++  CT KM  YPRLREE ER+ +  +R  E S K+QI+ LID +LAY+NTNH DF   AN   K+ +   NK G +   N  ++IR+G + +QN+ I++GGS+  +F+LTS+S+SW+KD+++ EKKF + L+GLKL+DI  GF  MS++ +FALF+P+ +NVYKDYKQLEL  E  E +++WKASFLRAGVYP K ET+ +GDE     K+ S     DPQLERQVETIRNLV+SYMKIV+K+ RD+VPK IM +II+  K F+  E+LA++Y S D   +MEES +   RRE +LR ++A KDAL II +VS  TVS P+P  V +DW
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVK------------MACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENA--NKTGTRQLGN--QVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDEEGQEQKSASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDW 759          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301597)

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 474/775 (61.16%), Postives = 606/775 (78.19%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSG-AEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGF--MSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDE-----KTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDW 2385
            M+ LI +VN+LQDAF SL + + L+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQLI   TEY EFLH   KKF+ F+E+R+EIE +T+R+TG NKGISN PINLRVYSP+VLNLTLIDLPG+TKVA+GDQP +IE QI+ MI Q+I++E CLILAV+PAN+DLANSDALK++KEVDP GVRTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DI+G+KDI  ALAAERKFF++H SY+H+ADR+GT YLQ+VLNQQLTNHIRD+LP L++ ++ Q+ ++E+EVE  K  +P D + KTKA++  +Q  ++ F ++IEGSG A + T ELSGGA IN+IFHER  +E++K            +  DE+ELRR+IS+AI+N HGIR G+F PDMAFEAIVKR+I  LKEP +KCVDLVV EL  ++  CT KM  YPRLREE ER+ +  +R  E S K+QI+ LID +LAY+NTNH DF   AN   K+ +   NK G +   N  ++IR+G + +QN+ I++GGS+  +F+LTS+S+SW+KD+++ EKKF + L+GLKL+DI  GF  MS++ +FALF+P+ +NVYKDYKQLEL  E  E +++WKASFLRAGVYP K ET+ +GDE     K+ S     DPQLERQVETIRNLV+SYMKIV+K+ RD+VPK IM +II+  K F+  E+LA++Y S D   +MEES +   RRE +LR ++A KDAL II +VS  TVS P+P  V +DW
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVK------------MACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENA--NKTGTRQLGN--QVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDEEGQEQKSASEESSSDPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDW 759          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301595)

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 472/770 (61.30%), Postives = 604/770 (78.44%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSG-AEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGF--MSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDW 2385
            M+ LI +VN+LQDAF SL + + L+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQLI   TEY EFLH   KKF+ F+E+R+EIE +T+R+TG NKGISN PINLRVYSP+VLNLTLIDLPG+TKVA+GDQP +IE QI+ MI Q+I++E CLILAV+PAN+DLANSDALK++KEVDP GVRTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DI+G+KDI  ALAAERKFF++H SY+H+ADR+GT YLQ+VLNQQLTNHIRD+LP L++ ++ Q+ ++E+EVE  K  +P D + KTKA++  +Q  ++ F ++IEGSG A + T ELSGGA IN+IFHER  +E++K            +  DE+ELRR+IS+AI+N HGIR G+F PDMAFEAIVKR+I  LKEP +KCVDLVV EL  ++  CT KM  YPRLREE ER+ +  +R  E S K+QI+ LID +LAY+NTNH DF   AN   K+ +   NK G +   N  ++IR+G + +QN+ I++GGS+  +F+LTS+S+SW+KD+++ EKKF + L+GLKL+DI  GF  MS++ +FALF+P+ +NVYKDYKQLEL  E  E +++WKASFLRAGVYP K ET+ +GDE     +   DPQLERQVETIRNLV+SYMKIV+K+ RD+VPK IM +II+  K F+  E+LA++Y S D   +MEES +   RRE +LR ++A KDAL II +VS  TVS P+P  V +DW
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVK------------MACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENA--NKTGTRQLGN--QVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSS-DPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDW 753          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0301594)

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 472/770 (61.30%), Postives = 604/770 (78.44%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSG-AEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGF--MSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDW 2385
            M+ LI +VN+LQDAF SL + + L+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQLI   TEY EFLH   KKF+ F+E+R+EIE +T+R+TG NKGISN PINLRVYSP+VLNLTLIDLPG+TKVA+GDQP +IE QI+ MI Q+I++E CLILAV+PAN+DLANSDALK++KEVDP GVRTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DI+G+KDI  ALAAERKFF++H SY+H+ADR+GT YLQ+VLNQQLTNHIRD+LP L++ ++ Q+ ++E+EVE  K  +P D + KTKA++  +Q  ++ F ++IEGSG A + T ELSGGA IN+IFHER  +E++K            +  DE+ELRR+IS+AI+N HGIR G+F PDMAFEAIVKR+I  LKEP +KCVDLVV EL  ++  CT KM  YPRLREE ER+ +  +R  E S K+QI+ LID +LAY+NTNH DF   AN   K+ +   NK G +   N  ++IR+G + +QN+ I++GGS+  +F+LTS+S+SW+KD+++ EKKF + L+GLKL+DI  GF  MS++ +FALF+P+ +NVYKDYKQLEL  E  E +++WKASFLRAGVYP K ET+ +GDE     +   DPQLERQVETIRNLV+SYMKIV+K+ RD+VPK IM +II+  K F+  E+LA++Y S D   +MEES +   RRE +LR ++A KDAL II +VS  TVS P+P  V +DW
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVK------------MACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENA--NKTGTRQLGN--QVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSS-DPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDW 753          
BLAST of Dynamin-1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074123)

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 472/770 (61.30%), Postives = 604/770 (78.44%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSG-AEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGF--MSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDW 2385
            M+ LI +VN+LQDAF SL + + L+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQLI   TEY EFLH   KKF+ F+E+R+EIE +T+R+TG NKGISN PINLRVYSP+VLNLTLIDLPG+TKVA+GDQP +IE QI+ MI Q+I++E CLILAV+PAN+DLANSDALK++KEVDP GVRTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DI+G+KDI  ALAAERKFF++H SY+H+ADR+GT YLQ+VLNQQLTNHIRD+LP L++ ++ Q+ ++E+EVE  K  +P D + KTKA++  +Q  ++ F ++IEGSG A + T ELSGGA IN+IFHER  +E++K            +  DE+ELRR+IS+AI+N HGIR G+F PDMAFEAIVKR+I  LKEP +KCVDLVV EL  ++  CT KM  YPRLREE ER+ +  +R  E S K+QI+ LID +LAY+NTNH DF   AN   K+ +   NK G +   N  ++IR+G + +QN+ I++GGS+  +F+LTS+S+SW+KD+++ EKKF + L+GLKL+DI  GF  MS++ +FALF+P+ +NVYKDYKQLEL  E  E +++WKASFLRAGVYP K ET+ +GDE     +   DPQLERQVETIRNLV+SYMKIV+K+ RD+VPK IM +II+  K F+  E+LA++Y S D   +MEES +   RRE +LR ++A KDAL II +VS  TVS P+P  V +DW
Sbjct:    1 MDSLITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMADRLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIFHERLRFEIVK------------MACDEKELRREISFAIRNIHGIRVGLFTPDMAFEAIVKRQIALLKEPVIKCVDLVVQELSVVVRMCTAKMSRYPRLREETERIITTHVRQREHSCKEQILLLIDFELAYMNTNHEDFIGFANAQNKSENA--NKTGTRQLGN--QVIRKGHMVIQNLGIMKGGSRPYWFVLTSESISWYKDEDEKEKKFMLPLDGLKLRDIEQGFMSMSRRVTFALFSPDGRNVYKDYKQLELSCETVEDVESWKASFLRAGVYPEKQETQENGDESASEESSS-DPQLERQVETIRNLVDSYMKIVTKTTRDMVPKAIMMLIINNAKDFINGELLAHLYASGDQAQMMEESAESATRREEMLRMYRACKDALQIIGDVSMATVSSPLPPPVKNDW 753          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm1a (dynamin 1a [Source:NCBI gene;Acc:100307098])

HSP 1 Score: 966.837 bits (2498), Expect = 0.000e+0
Identity = 492/777 (63.32%), Postives = 620/777 (79.79%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK---DETEPSGDEK-TDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNR+QDAF ++    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQLI   TEYAEFLHC  KKFTDF+EVR+EIEA+T+R+TG+NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QI+ M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  A+AAERKFF++H SY+HLADRMGT YLQK LNQQLTNHIRD+LP L+  +++QL SIE+EVE  K+ RP+DP+ KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELR++ISYAIKN HGIRTG+F PDMAFE IVKR+I K+KEP  KCVD+V+ EL+  +  CT+K+  YP LREE+ER+ +Q IR  E   K+Q++ LID++LAY+NTNH DF   AN   +++  ++   GNQ  D +  +IR+GWLT+ N+ I++GG+K+ +F+LT++SLSW+KDDE+ EKK+ ++++ LK +D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E+QE +D WKASFLRAGVYP +    E   +G+E  +D      DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K ++  E+LA++YS  D NTLMEES ++  RR+ +LR + ALK+AL+II ++S+ T+S  +P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAMAAERKFFLSHPSYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRAKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCQKCVDMVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVLLLIDIELAYMNTNHEDFIGFANAQQRSSQIKKKAAGNQ--DEI-MVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKFRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACESQEEVDGWKASFLRAGVYPERVVEKEKNDAGEENGSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLIPKTIMHLMINNTKEYINAELLASLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALNIIGDISTTTISTSLPPPVDDSWLQ 763          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm1b (dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3])

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 516/868 (59.45%), Postives = 644/868 (74.19%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNK-LGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPT----KDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSARRXXXXXXXXXXXXXXXX------------------------------GLPPPIMPQRVQSYNPTVPARPISGVSSTIPKP 2571
            GN GME LI +VNR+QDAF ++    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQLI   TEYAEFLHC  KKFTDF+EVR+EIEA+T+RITG+NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE+QIR M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDAR+IL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  A++AERKFF+TH SY+HLADRMGT YLQK LNQQLTNHIRD+LP L+N +++QL SIE+EVE  K  RP+DP+ KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+EL+K            +E DE+ELR++ISYAIKN HGIRTG+F PDMAFE IVKR+I K+KEP  KCVDLV+ EL+  +  CT+K+  YP LREE+ER+ +Q IR  E   K+Q++ LID++LAY+NTNH DF   AN   +++   + K  GNQ  D +  +IR+GWLT+ N+ I++GG+K+ +F++T+++LSW+KDDE+ EKK+ + L+ LKL+DI   FMS K  FALFN  Q+NVYKDY+QLEL ++ QE +D+WKASFLRAGVYP     K++++ S +  +D      DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++   RE +LR + ALK+AL+II ++S+ TVS  +P  V+D W Q       S RR P   P   +  P                                 G PPP +P R     P VP+RP  G  S    P
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGMRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMSAERKFFLTHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKHFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQVDTVELSGGARINRIFHERFPFELVK------------MEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVITELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQMNKKKAAGNQ--DEI-MVIRKGWLTINNIGIMKGGAKEYWFVMTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKSFMSSKHVFALFNTEQRNVYKDYRQLELASDTQEEVDSWKASFLRAGVYPERITDKEKSDTSDESSSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKDFIHAELLANLYSCGDQNTLMEESAEQAQHREEMLRMYHALKEALNIIGDISTSTVSTAMPPPVDDSWLQVQGGP--SGRRSPMSSPTPQRRAPPGPPRPGGRTAPGPPTIGAPPVPSRPGASPDPFGAPPPQVPSRPNRAPPGVPSRPSKGSPSHSESP 852          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm1a (dynamin 1a [Source:NCBI gene;Acc:100307098])

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 491/777 (63.19%), Postives = 620/777 (79.79%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK---DETEPSGDEK-TDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNR+QDAF ++    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQLI   TEYAEFLHC  KKFTDF+EVR+EIEA+T+R+TG+NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QI+ M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  A+AAERKFF++H SY+HLADRMGT YLQK LNQQLTNHIRD+LP L+  +++QL SIE+EVE  K+ RP+DP+ KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELR++ISYAIKN HGIRTG+F PD+AFEAIVK++I+KL  P +KC+D+VV EL   I  C+EK+  YP LREE+ER+ +Q IR  E   K+Q++ LID++LAY+NTNH DF   AN   +++  ++   GNQ  D +  +IR+GWLT+ N+ I++GG+K+ +F+LT++SLSW+KDDE+ EKK+ ++++ LK +D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E+QE +D WKASFLRAGVYP +    E   +G+E  +D      DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K ++  E+LA++YS  D NTLMEES ++  RR+ +LR + ALK+AL+II ++S+ T+S  +P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAMAAERKFFLSHPSYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRAKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRKEISYAIKNIHGIRTGLFTPDLAFEAIVKKQIQKLNGPCLKCIDMVVSELTSTIRKCSEKLAQYPMLREEMERIVTQHIRDRESRTKNQVLLLIDIELAYMNTNHEDFIGFANAQQRSSQIKKKAAGNQ--DEI-MVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKFRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACESQEEVDGWKASFLRAGVYPERVVEKEKNDAGEENGSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLIPKTIMHLMINNTKEYINAELLASLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALNIIGDISTTTISTSLPPPVDDSWLQ 763          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm1b (dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3])

HSP 1 Score: 962.214 bits (2486), Expect = 0.000e+0
Identity = 513/848 (60.50%), Postives = 642/848 (75.71%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNK-LGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQG-----DPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWR--QPDPS---VDLSARRXXXXXXXXXXXXXXXXGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 2583
            GN GME LI +VNR+QDAF ++    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQLI   TEYAEFLHC  KKFTDF+EVR+EIEA+T+RITG+NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE+QIR M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDAR+IL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  A++AERKFF+TH SY+HLADRMGT YLQK LNQQLTNHIRD+LP L+N +++QL SIE+EVE  K  RP+DP+ KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+EL+K            +E DE+ELR++ISYAIKN HGIRTG+F PDMAFE IVKR+I K+KEP  KCVDLV+ EL+  +  CT+K+  YP LREE+ER+ +Q IR  E   K+Q++ LID++LAY+NTNH DF   AN   +++   + K  GNQ  D +  +IR+GWLT+ N+ I++GG+K+ +F++T+++LSW+KDDE+ EKK+ + L+ LKL+DI   FMS K  FALFN  Q+NVYKDY+QLEL ++ QE +D+WKASFLRAGVYP +   +    + +D  +  G     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++   RE +LR + ALK+AL+II ++S+ TVS  +P  V+D W   Q  PS     +S+  P    P             PP +        P VP+RP  G S   P P+G P
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGMRTIGVITKLDLMDEGTDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMSAERKFFLTHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKHFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQVDTVELSGGARINRIFHERFPFELVK------------MEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVITELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQMNKKKAAGNQ--DEI-MVIRKGWLTINNIGIMKGGAKEYWFVMTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKSFMSSKHVFALFNTEQRNVYKDYRQLELASDTQEEVDSWKASFLRAGVYPERITDKEKQSDTSDESSSDGFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKDFIHAELLANLYSCGDQNTLMEESAEQAQHREEMLRMYHALKEALNIIGDISTSTVSTAMPPPVDDSWLQVQGGPSGRRSPMSSPTPQRRAPPGPPRPGGRTAPGPPTIGA------PPVPSRP--GAS---PDPFGAP 823          
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Match: dnm2a (dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84])

HSP 1 Score: 950.658 bits (2456), Expect = 0.000e+0
Identity = 486/771 (63.04%), Postives = 613/771 (79.51%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDW 2385
            GN GME+LI ++N+LQDAF S+    NL+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPL+LQL+    EYAEFLHC  +KF DF+EVR+EIEA+T+RITG NKGIS  PINLRVYSPNVLNLTLIDLPGMTKVAVGDQP +IE QIR MI+Q+I  E+CLILAV+PAN DLANSDALK++KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDG+KDIR ALAAERKFF++H SY+H+A+RMGT +LQK LNQQLTNHIRD+LP L++ +++QL S+E+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+EL+K  I++          DE+ELRR+IS+AIKN HG+RTG+F PD+AFEAIVK++I KLKEP +KC+DLV+ ELI     CT K+ +YPRLREE ER+ +  +R  E   KDQ++ LID +L+YINTNH DF   AN   +    ++  + NQ       +IR+GWLTL N++I++GGSK+ +F+LT++SLSW+KD+E+ EKK+ + L+ LKL+D+  GFMS K  FA+FN  Q+NVYKD +Q+EL  ++QE +D+WKASFLRAGVYP KD+ E       DS ++  DPQLERQVETIRNLV+SY+ IV+K+ RDL+PKTIM ++I+  K F+  E+LA +YS  D N+LMEES D+  RR+ +LR + A+K+AL II ++S+ T+S PVP  VND W
Sbjct:    2 GNRGMEELIPLINKLQDAFSSIGQSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNNKAEYAEFLHCKGRKFVDFDEVRQEIEAETDRITGSNKGISPIPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPPDIEHQIRDMIMQFITRESCLILAVTPANMDLANSDALKVAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDIRAALAAERKFFLSHPSYRHMAERMGTPHLQKALNQQLTNHIRDTLPGLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKCIEGSGDQVDTAELSGGARINRIFHERFPFELVK--IVF----------DEKELRREISHAIKNVHGVRTGLFTPDLAFEAIVKKQIIKLKEPCLKCIDLVIQELINTFRQCTNKLSSYPRLREETERIVTTYVREREGKTKDQVLLLIDTELSYINTNHEDFIGFANAQQRNIVNKKRAIPNQ-------VIRKGWLTL-NISIMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKLRDVEKGFMSTKHIFAIFNTEQRNVYKDLRQIELACDSQEDMDSWKASFLRAGVYPEKDQVESEEAAPADSFSM--DPQLERQVETIRNLVDSYIGIVNKTIRDLMPKTIMHLMINSAKDFIHSELLAYLYSSGDQNSLMEESADQAQRRDEMLRMYHAIKEALSIIGDISTSTISTPVPPPVNDSW 750          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 954.125 bits (2465), Expect = 0.000e+0
Identity = 486/774 (62.79%), Postives = 617/774 (79.72%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTAD-GERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME+LI +VN+LQDAF S+    NL+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPL+LQLI + TEYAEFLHC +KKFTDF+EV +EIEA+T+R+TG NKGIS  PINLRVYSPNVLNLTLIDLPG+TKV VGDQP +IE QI+ MILQ+I  ++CLILAV+P N+DLANSDALK++KEVDP G+RTIGVITKLDLMDEGTDA+DIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI+ AL AERKFF++H  Y+H+A+RMGT +LQK LNQQLTNHIR++LP L+N +++QL S+E+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+EL+K            +E DE++LRR+ISYAIKN HG+RTG+F PDMAFEAIVK+++ KLKEP +KCVD+V+ ELI  +  CT K+ +YP+LREE ER+ +  IR  E   KDQI+ LID++L+YINTNH DF   AN   +++   ++  + NQ       +IR GWLT+ N++I++GGSK+ +FILT++SLSW+KD+E+ EKK+ + L+ LK++DI  GFMS K  FA+FN  Q+NVYKD +Q+EL  ++QE +D+WKASFLRAGVYP KD+  PS +E+T       DPQLERQVETIRNLV+SY+ IV+KS RDL+PKTIM ++I+  K F+  E+LA +Y S D N+LMEES D+  RRE++LR + ALK+AL II ++S+ T + PVP  V+D W Q
Sbjct:    2 GNRGMEELIPLVNKLQDAFSSIGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVWQEIEAETDRVTGTNKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDIKAALGAERKFFLSHPGYRHIAERMGTPHLQKTLNQQLTNHIRETLPALRNKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVK------------MEFDEKDLRREISYAIKNIHGVRTGLFTPDMAFEAIVKKQVVKLKEPCLKCVDMVIQELINTVRQCTAKLLSYPKLREETERIVTTYIREREGKTKDQILLLIDIELSYINTNHEDFIGFANAQQRSSQLNKKRAVPNQ-------VIRRGWLTINNISIMKGGSKEYWFILTAESLSWYKDEEEKEKKYMLPLDNLKIRDIEKGFMSTKHIFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQVIPSEEEETQENTFSMDPQLERQVETIRNLVDSYICIVNKSIRDLMPKTIMHLMINNSKDFIHSELLAYLYSSADQNSLMEESADQAQRREDMLRMYHALKEALKIIGDISTSTATTPVPPPVDDTWLQ 756          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 952.97 bits (2462), Expect = 0.000e+0
Identity = 497/775 (64.13%), Postives = 620/775 (80.00%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME+LI +VNRLQDAF S+    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL+ ++TEY EFLHC  KKFTDF+E+R EIEA+T+R TG NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI+ ALAAERKFF++H SY+HLADRMGT YLQK LNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL++ VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PDMAFE IVK++I+K+KEP +KCVD+V+ ELI  +  CT+K+  YP LREE+ER+ +  IR  E   KDQ++ LID++L+Y+NTNH DF   AN   +++   + K  GNQ       +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + L+ LKL+DI  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +  E+E +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I   K F+  ++LAN+YS  D NTLMEES ++   R+ +L+ ++ALK+AL II ++S+ T+S P+P  V+D W Q
Sbjct:    2 GNRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQ-------VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERASESEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGDISTTTISTPMPPPVDDSWLQ 754          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 952.97 bits (2462), Expect = 0.000e+0
Identity = 497/778 (63.88%), Postives = 619/778 (79.56%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPT----KDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME+LI +VNRLQDAF S+    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL+ ++TEY EFLHC  KKFTDF+E+R EIEA+T+R TG NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI+ ALAAERKFF++H SY+HLADRMGT YLQK LNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL++ VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PDMAFE IVK++I+K+KEP +KCVD+V+ ELI  +  CT+K+  YP LREE+ER+ +  IR  E   KDQ++ LID++L+Y+NTNH DF   AN   +++   + K  GNQ       +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + L+ LKL+DI  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP     KD+   S +  +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I   K F+  ++LAN+YS  D NTLMEES ++   R+ +L+ ++ALK+AL II ++S+ T+S P+P  V+D W Q
Sbjct:    2 GNRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQ-------VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERAGDKDKASESEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGDISTTTISTPMPPPVDDSWLQ 760          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 486/754 (64.46%), Postives = 603/754 (79.97%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINE 2331
            GN GME+LI +VNRLQDAF S+    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL+ ++TEY EFLHC  KKFTDF+E+R EIEA+T+R TG NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI+ ALAAERKFF++H SY+HLADRMGT YLQK LNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL++ VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PDMAFE IVK++I+K+KEP +KCVD+V+ ELI  +  CT+K+  YP LREE+ER+ +  IR  E   KDQ++ LID++L+Y+NTNH DF   AN   +++   + K  GNQ       +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + L+ LKL+DI  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +     S +  +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I   K F+  ++LAN+YS  D NTLMEES ++   R+ +L+ ++ALK+AL II +
Sbjct:    2 GNRGMEELIPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLADRMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLLMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQIKKIKEPCLKCVDMVISELIGTVRQCTKKLSQYPHLREEMERIVTTHIREREGRTKDQVMLLIDIELSYMNTNHEDFIGFANAQQRSSQTNKKKASGNQ-------VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLPLDNLKLRDIEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERAGASESEENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTIRDLMPKTIMHLMIINTKDFIHSDLLANLYSCGDQNTLMEESAEQAQHRDEMLKMYRALKEALCIIGD 736          
BLAST of Dynamin-1 vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 947.577 bits (2448), Expect = 0.000e+0
Identity = 501/840 (59.64%), Postives = 637/840 (75.83%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTAD-GERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ-----PDPSVDLSARRXXXXXXXXXXXXXXXXGLPPPIMPQRVQSYNPTVPARPI-SGVSSTIPKP 2571
            GN GME+LI +VN+LQDAF S+    NL+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPL+LQLI + TEYAEFLHC +KKFTDF+EV +EIEA+T+R+TG NKGIS  PINLRVYSPNVLNLTLIDLPG+TKV VGDQP +IE QI+ MILQ+I  ++CLILAV+P N+DLANSDALK++KEVDP G+RTIGVITKLDLMDEGTDA+DIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI+ AL AERKFF++H  Y+H+A+RMGT +LQK LNQQLTNHIR++LP L+N +++QL S+E+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+EL+K            +E DE++LRR+ISYAIKN HG+RTG+F PDMAFEAIVK+++ KLKEP +KCVD+V+ ELI  +  CT K+ +YP+LREE ER+ +  IR  E   KDQI+ LID++L+YINTNH DF   AN   +++   ++  + NQ       +IR GWLT+ N++I++GGSK+ +FILT++SLSW+KD+E+ EKK+ + L+ LK++DI  GFMS K  FA+FN  Q+NVYKD +Q+EL  ++QE +D+WKASFLRAGVYP KD+ E   +E+T       DPQLERQVETIRNLV+SY+ IV+KS RDL+PKTIM ++I+  K F+  E+LA +Y S D N+LMEES D+  RRE++LR + ALK+AL II ++S+ T + PVP  V+D W Q       P+V    RRP                  PP  P  V+   P  P  P+ +G S+ I  P
Sbjct:    2 GNRGMEELIPLVNKLQDAFSSIGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVWQEIEAETDRVTGTNKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDIKAALGAERKFFLSHPGYRHIAERMGTPHLQKTLNQQLTNHIRETLPALRNKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVK------------MEFDEKDLRREISYAIKNIHGVRTGLFTPDMAFEAIVKKQVVKLKEPCLKCVDMVIQELINTVRQCTAKLLSYPKLREETERIVTTYIREREGKTKDQILLLIDIELSYINTNHEDFIGFANAQQRSSQLNKKRAVPNQ-------VIRRGWLTINNISIMKGGSKEYWFILTAESLSWYKDEEEKEKKYMLPLDNLKIRDIEKGFMSTKHIFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQRE---EEETQENTFSMDPQLERQVETIRNLVDSYICIVNKSIRDLMPKTIMHLMINNSKDFIHSELLAYLYSSADQNSLMEESADQAQRREDMLRMYHALKEALKIIGDISTSTATTPVPPPVDDTWLQNSNSGHSPTVQ---RRPVSTVL-------------PPSRPPAVRGPTPGPPLIPVPAGGSAFIAPP 803          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 976.852 bits (2524), Expect = 0.000e+0
Identity = 506/781 (64.79%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ +TTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALKI+KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EV+  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PD+AFEA VK++++KLKEPS+KCVD+VV EL   I  C+EK+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 976.467 bits (2523), Expect = 0.000e+0
Identity = 506/781 (64.79%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ +TTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALKI+KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EV+  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PD+AFEA VK++++KLKEPS+KCVD+VV EL   I  C+EK+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 976.467 bits (2523), Expect = 0.000e+0
Identity = 506/781 (64.79%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ +TTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALKI+KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EV+  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PD+AFEA VK++++KLKEPS+KCVD+VV EL   I  C+EK+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 976.082 bits (2522), Expect = 0.000e+0
Identity = 502/781 (64.28%), Postives = 621/781 (79.51%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ +TTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALKI+KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EV+  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PDMAFE IVK++++K++EP +KCVD+V+ ELI  +  CT+K+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ       +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ-------VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 760          
BLAST of Dynamin-1 vs. Ensembl Mouse
Match: Dnm1 (dynamin 1 [Source:MGI Symbol;Acc:MGI:107384])

HSP 1 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 503/781 (64.40%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ +TTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALKI+KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EV+  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PDMAFE IVK++++K++EP +KCVD+V+ ELI  +  CT+K+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|Q08DF4|DYN1_BOVIN (Dynamin-1 OS=Bos taurus OX=9913 GN=DNM1 PE=2 SV=1)

HSP 1 Score: 978.778 bits (2529), Expect = 0.000e+0
Identity = 507/781 (64.92%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ ATTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALK++KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PD+AFEA VK++++KLKEPS+KCVD+VV EL   I  C+EK+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTATIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKASGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|Q05193|DYN1_HUMAN (Dynamin-1 OS=Homo sapiens OX=9606 GN=DNM1 PE=1 SV=2)

HSP 1 Score: 977.237 bits (2525), Expect = 0.000e+0
Identity = 504/781 (64.53%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ ATTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALK++KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PDMAFE IVK++++K++EP +KCVD+V+ ELI  +  CT+K+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|P21575|DYN1_RAT (Dynamin-1 OS=Rattus norvegicus OX=10116 GN=Dnm1 PE=1 SV=2)

HSP 1 Score: 976.852 bits (2524), Expect = 0.000e+0
Identity = 506/781 (64.79%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ +TTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALKI+KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EV+  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PD+AFEA VK++++KLKEPS+KCVD+VV EL   I  C+EK+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|P39053|DYN1_MOUSE (Dynamin-1 OS=Mus musculus OX=10090 GN=Dnm1 PE=1 SV=2)

HSP 1 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 503/781 (64.40%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-------DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+ +TTEYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPANSDLANSDALKI+KEVDP G RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  ALAAERKFF++H SY+HLADRMGT YLQKVLNQQLTNHIRD+LP L+N +++QL SIE+EV+  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAIKN HGIRTG+F PDMAFE IVK++++K++EP +KCVD+V+ ELI  +  CT+K+Q YPRLREE+ER+ +  IR  E   K+Q++ LID++LAY+NTNH DF   AN   ++    + K  GNQ  D +  +IR+GWLT+ N+ I++GGSK+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +        ETE +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LAN+YS  D NTLMEES ++  RR+ +LR + ALK+AL II ++++ TVS P+P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIKNIHGIRTGLFTPDMAFETIVKKQVKKIREPCLKCVDMVISELISTVRQCTKKLQQYPRLREEMERIVTTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQ--DEIL-VIRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETEENG---SDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSELLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVSTPMPPPVDDSWLQ 764          
BLAST of Dynamin-1 vs. UniProt/SwissProt
Match: sp|Q08877|DYN3_RAT (Dynamin-3 OS=Rattus norvegicus OX=10116 GN=Dnm3 PE=1 SV=2)

HSP 1 Score: 959.903 bits (2480), Expect = 0.000e+0
Identity = 505/831 (60.77%), Postives = 631/831 (75.93%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTAD-GERNKLGNQYSD---NVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDW-----RQPDPSVDLSARRXXXXXXXXXXXXXXXXGLPPPIMPQRVQSYNPTVPARP 2538
            GN  ME+LI +VNRLQDAF +L     L LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+T+  EYAEFLHC  KKFTDF+EVR EIEA+T+R+TG NKGIS+ PINLRVYSP+VLNLTLIDLPG+TKV VGDQP +IE QIR MI+Q+I  ENCLILAV+PAN+DLANSDALK++KEVDP G+RTIGVITKLDLMDEGTDARD+L+NKLLPLRRGYVG+VNRSQ+DIDGKKDI+ A+ AERKFF++H +Y+H+ADRMGT +LQKVLNQQLTNHIRD+LP  +N ++ QL SIE EVEA K+ +PEDP  KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+E++K            +E +E+ELRR+ISYAIKN HGIRTG+F PDMAFEAIVK++I KLK PS+K VDLV+ ELI  +  CT+++ N+PRL EE ER+ +  IR  E   KDQ++ LID+Q++YINTNH DF   AN   +++   +++ +GNQ ++   + + +IR+GWLT+ N+ I++GGSK  +F+LT++SLSW+KDDE+ EKK+ + L+ LK++D+  GFMS K  FALFN  Q+NVYKDY+ LEL  ++QE +D+WKAS LRAGVYP K  TE   DE   + N   DPQLERQVETIRNLV+SYM I++K  RDL+PKTIM ++I+ VK F+  E+LA +YS  D NTLMEES ++  RR+ +LR +QALK+AL II ++++ TVS P P  V+D W     R P PS     R               ++G  P I      S  P VP RP
Sbjct:    2 GNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRHEIEAETDRVTGMNKGISSVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIRDMIMQFITRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQKDIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKLQGQLLSIEHEVEAFKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGAKINRIFHERFPFEIVK------------MEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKLKGPSLKSVDLVMQELINTVKKCTKRLANFPRLCEETERIVANHIREREGKTKDQVLLLIDIQVSYINTNHEDFIGFANAQQRSSQVHKKSTIGNQGTNLPPSRQIVIRKGWLTVSNIGIMKGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKGFMSSKHVFALFNTEQRNVYKDYRSLELACDSQEDVDSWKASLLRAGVYPDKSFTE--NDENGQAENFSMDPQLERQVETIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESVEQAQRRDEMLRMYQALKEALAIIGDINTVTVSTPAPPPVDDSWLQHSRRSPPPSPTTQRR---LTLSAPLPRPASSRGPAPAIPSPGPHSGAPPVPFRP 815          
BLAST of Dynamin-1 vs. TrEMBL
Match: A0A094ZKG0 (Dynamin-1 OS=Schistosoma haematobium OX=6185 GN=MS3_03369 PE=3 SV=1)

HSP 1 Score: 999.194 bits (2582), Expect = 0.000e+0
Identity = 500/784 (63.78%), Postives = 644/784 (82.14%), Query Frame = 1
Query:   70 MSGNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSA 2418
            MSGN GMEQLI +VNRLQDAF SL +PLNL+LPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLI +  EYAEFLHC NK+FTDF+EVR+EIEA+T+R+TG NKGISNTPINLRVYSPNVLNLTLIDLPGMTKV VGDQP +IE QIR+MIL++I +ENCLILAVSPANSDLANSDALK+SKEVDP G+RTIGV+TKLDLMD+GTDAR+IL+N+LLPLRRGY+G+VNRSQRDI+G+KDI+ ALAAERKFF++H SY+H+ADRMGT +LQ  LNQQLTNHIRD+LP L+N +++Q+ ++E+EVE  K  +P DP++KTKAL++ VQ FE  F  +I+G G+EI+TK LSGGA+IN+IFHER PYE+ K            +E+DE ELR++ISYAI+N HGIRTG+F PD+AFE I +++I+K+K PS+KC DLVV +L +++H CT +M+N+PRLREE ER+ +Q IR  E+ A+DQI+ L+D+QL+Y+NTNH DF    + + ++++  +NK GN+    V  +IR+GWL+LQNVT+LRGG+KD +F+L ++SL+W+KDDE+ EK++ + L+GLK++DI  GF  KK +FALF P+  NVYKDYKQLEL AE+ E++D+WKASFLRAGVYP K ++E +    T S+    +PQLERQVE IRNLV+SYMKIV K+  DLVPK +M ++++E+K+FLK E+L N+Y   D+N+LM ES   + +R+ ++R + A+K+AL+II+EVS  TVS P+P  VNDDW Q D    L+A
Sbjct:    1 MSGNVGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPLDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHPSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNK------------IETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGNK----VSSVIRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKTEQSDTSSLE-SSEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWLQSDIPGGLTA 767          
BLAST of Dynamin-1 vs. TrEMBL
Match: A0A5K4EDF9 (Dynamin, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 998.038 bits (2579), Expect = 0.000e+0
Identity = 500/785 (63.69%), Postives = 648/785 (82.55%), Query Frame = 1
Query:   70 MSGNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQG-DPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSA 2418
            MSGN GMEQLI +VNRLQDAF SL +PLNL+LPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLI +  EYAEFLHC NK+FTDF+EVR+EIEA+T+R+TG NKGISNTPINLRVYSPNVLNLTLIDLPGMTKV VGDQP +IE QIR+MIL++I +ENCLILAVSPANSDLANSDALK+SKEVDP G+RTIGV+TKLDLMD+GTDAR+IL+N+LLPLRRGY+G+VNRSQRDI+G+KDI+ ALAAERKFF++H SY+H+ADRMGT +LQ  LNQQLTNHIRD+LP L+N +++Q+ ++E+EVE  K  +P DP++KTKAL++ VQ FE  F  +I+G G+EI+TK LSGGA+IN+IFHER PYE+ K            +E+DE ELR++ISYAI+N HGIRTG+F PD+AFE I +++I+K+K PS+KC DLVV +L +++H CT +M+N+PRLREE ER+ +Q IR  E+ A+DQI+ L+D+QL+Y+NTNH DF    + + ++++  +NK GN+    V  +IR+GWL+LQNVT+LRGG+KD +F+L ++SL+W+KDDE+ EK++ + L+GLK++DI  GF  KK +FALF P+  NVYKDYKQLEL AE+ E++D+WKASFLRAGVYP K ++E +  E++DS +++  +PQLERQVE IRNLV+SYMKIV K+  DLVPK +M ++++E+K+FLK E+L N+Y   D+N+LM ES   + +R+ ++R + A+K+AL+II+EVS  TVS P+P  VNDDW   D    L+A
Sbjct:    1 MSGNIGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPPDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHSSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNK------------IETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGNK----VSSVIRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKT--EQSDSSSLEASEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWLLSDIPGGLTA 767          
BLAST of Dynamin-1 vs. TrEMBL
Match: A0A5K4EE90 (Dynamin, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 996.497 bits (2575), Expect = 0.000e+0
Identity = 500/785 (63.69%), Postives = 647/785 (82.42%), Query Frame = 1
Query:   70 MSGNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQG-DPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSA 2418
            MSGN GMEQLI +VNRLQDAF SL +PLNL+LPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLI +  EYAEFLHC NK+FTDF+EVR+EIEA+T+R+TG NKGISNTPINLRVYSPNVLNLTLIDLPGMTKV VGDQP +IE QIR+MIL++I +ENCLILAVSPANSDLANSDALK+SKEVDP G+RTIGV+TKLDLMD+GTDAR+IL+N+LLPLRRGY+G+VNRSQRDI+G+KDI+ ALAAERKFF++H SY+H+ADRMGT +LQ  LNQQLTNHIRD+LP L+N +++Q+ ++E+EVE  K  +P DP++KTKAL++ VQ FE  F  +I+G G+EI+TK LSGGA+IN+IFHER PYE+ K            +E+DE ELR++ISYAI+N HGIRTG+F PD+AFE I +++I+K+K PS+KC DLVV +L +++H CT +M+N+PRLREE ER+ +Q IR  E+ A+DQI+ L+D+QL+Y+NTNH DF    + + ++++  +NK GN       K+IR+GWL+LQNVT+LRGG+KD +F+L ++SL+W+KDDE+ EK++ + L+GLK++DI  GF  KK +FALF P+  NVYKDYKQLEL AE+ E++D+WKASFLRAGVYP K ++E +  E++DS +++  +PQLERQVE IRNLV+SYMKIV K+  DLVPK +M ++++E+K+FLK E+L N+Y   D+N+LM ES   + +R+ ++R + A+K+AL+II+EVS  TVS P+P  VNDDW   D    L+A
Sbjct:    1 MSGNIGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPPDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHSSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNK------------IETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGN-------KVIRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKT--EQSDSSSLEASEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWLLSDIPGGLTA 764          
BLAST of Dynamin-1 vs. TrEMBL
Match: A0A5K4ED86 (Dynamin, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 996.497 bits (2575), Expect = 0.000e+0
Identity = 500/785 (63.69%), Postives = 647/785 (82.42%), Query Frame = 1
Query:   70 MSGNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQG-DPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSA 2418
            MSGN GMEQLI +VNRLQDAF SL +PLNL+LPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLI +  EYAEFLHC NK+FTDF+EVR+EIEA+T+R+TG NKGISNTPINLRVYSPNVLNLTLIDLPGMTKV VGDQP +IE QIR+MIL++I +ENCLILAVSPANSDLANSDALK+SKEVDP G+RTIGV+TKLDLMD+GTDAR+IL+N+LLPLRRGY+G+VNRSQRDI+G+KDI+ ALAAERKFF++H SY+H+ADRMGT +LQ  LNQQLTNHIRD+LP L+N +++Q+ ++E+EVE  K  +P DP++KTKAL++ VQ FE  F  +I+G G+EI+TK LSGGA+IN+IFHER PYE+ K            +E+DE ELR++ISYAI+N HGIRTG+F PD+AFE I +++I+K+K PS+KC DLVV +L +++H CT +M+N+PRLREE ER+ +Q IR  E+ A+DQI+ L+D+QL+Y+NTNH DF    + + ++++  +NK GN       K+IR+GWL+LQNVT+LRGG+KD +F+L ++SL+W+KDDE+ EK++ + L+GLK++DI  GF  KK +FALF P+  NVYKDYKQLEL AE+ E++D+WKASFLRAGVYP K ++E +  E++DS +++  +PQLERQVE IRNLV+SYMKIV K+  DLVPK +M ++++E+K+FLK E+L N+Y   D+N+LM ES   + +R+ ++R + A+K+AL+II+EVS  TVS P+P  VNDDW   D    L+A
Sbjct:    1 MSGNIGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPPDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHSSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNK------------IETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGN-------KVIRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKT--EQSDSSSLEASEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWLLSDIPGGLTA 764          
BLAST of Dynamin-1 vs. TrEMBL
Match: A0A3Q0KF72 (Dynamin, putative OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 996.497 bits (2575), Expect = 0.000e+0
Identity = 500/785 (63.69%), Postives = 647/785 (82.42%), Query Frame = 1
Query:   70 MSGNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQG-DPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSA 2418
            MSGN GMEQLI +VNRLQDAF SL +PLNL+LPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLI +  EYAEFLHC NK+FTDF+EVR+EIEA+T+R+TG NKGISNTPINLRVYSPNVLNLTLIDLPGMTKV VGDQP +IE QIR+MIL++I +ENCLILAVSPANSDLANSDALK+SKEVDP G+RTIGV+TKLDLMD+GTDAR+IL+N+LLPLRRGY+G+VNRSQRDI+G+KDI+ ALAAERKFF++H SY+H+ADRMGT +LQ  LNQQLTNHIRD+LP L+N +++Q+ ++E+EVE  K  +P DP++KTKAL++ VQ FE  F  +I+G G+EI+TK LSGGA+IN+IFHER PYE+ K            +E+DE ELR++ISYAI+N HGIRTG+F PD+AFE I +++I+K+K PS+KC DLVV +L +++H CT +M+N+PRLREE ER+ +Q IR  E+ A+DQI+ L+D+QL+Y+NTNH DF    + + ++++  +NK GN       K+IR+GWL+LQNVT+LRGG+KD +F+L ++SL+W+KDDE+ EK++ + L+GLK++DI  GF  KK +FALF P+  NVYKDYKQLEL AE+ E++D+WKASFLRAGVYP K ++E +  E++DS +++  +PQLERQVE IRNLV+SYMKIV K+  DLVPK +M ++++E+K+FLK E+L N+Y   D+N+LM ES   + +R+ ++R + A+K+AL+II+EVS  TVS P+P  VNDDW   D    L+A
Sbjct:    1 MSGNIGMEQLIPLVNRLQDAFSSLGVPLNLDLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLINSRNEYAEFLHCKNKQFTDFDEVRKEIEAETDRLTGSNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVPVGDQPPDIEVQIRSMILEFITQENCLILAVSPANSDLANSDALKLSKEVDPQGLRTIGVVTKLDLMDQGTDAREILENRLLPLRRGYIGVVNRSQRDIEGRKDIKAALAAERKFFLSHSSYRHMADRMGTPFLQSTLNQQLTNHIRDTLPGLRNKLQSQMLAMEKEVEEYKHYKPSDPSFKTKALLLTVQSFEKDFHHAIDGGGSEIDTKTLSGGALINRIFHERLPYEMNK------------IETDEEELRKEISYAIRNIHGIRTGLFTPDLAFETITRKQIDKMKIPSLKCADLVVAQLTEIVHACTARMENFPRLREETERIVNQWIREREIRARDQIVLLVDIQLSYMNTNHEDFIGFESAEQQSSEVAKNKPGN-------KVIRKGWLSLQNVTLLRGGNKDFWFVLNTESLTWYKDDEEKEKRYVLLLDGLKIRDIETGFFGKKHAFALFYPDNHNVYKDYKQLELCAESAELVDSWKASFLRAGVYPAKTKSEKT--EQSDSSSLEASEPQLERQVEIIRNLVDSYMKIVIKTQLDLVPKLLMHMLVNEIKSFLKGELLPNLYQAGDLNSLMSESLGVQQKRDEMVRVYDAMKEALNIISEVSMSTVSTPIPPPVNDDWLLSDIPGGLTA 764          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 960.288 bits (2481), Expect = 0.000e+0
Identity = 490/774 (63.31%), Postives = 616/774 (79.59%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNR+QDAF ++    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQLI   TEYAEFLHC  KKFTDF+EVR+EIEA+T+R+TG+NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QI+ M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDG+KDI  A+AAERKFF+TH  Y+HLADRMGT YLQK LNQQLTNHIRD+LP L++ +++QL SIE+EVE  K+ RP+DP+ KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELR++ISYAIKN HGIRTG+F PD+AFEAIVK++I+KLK P +KC+D+VV EL   I  C+EK+  YP LREE+ER+ +Q IR  E   KDQ++ LID++LAY+NTNH DF   AN   +++   + K  GNQ  D +  +IR+GWLT+ N+ I++GG+K+ +F+LT++SLSW+KDDE+ EKK+ ++++ LKL+D+   FMS K  FALFN  Q+NVYKDY+QLEL  E QE +D WKASFLRAGVY  +  ++ S +  +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LA +YS  D NTLMEES ++   R+ +LR + AL++AL II ++S+ T+S  +P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLTHPGYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRKEISYAIKNIHGIRTGLFTPDLAFEAIVKKQIQKLKSPVLKCIDMVVSELTSTIRKCSEKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQINKKKAPGNQ--DEI-MVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKSFMSSKHIFALFNTEQRNVYKDYRQLELACETQEDVDGWKASFLRAGVYAERVVSDTSEENGSDSFMHSMDPQLERQVETIRNLVDSYMGIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYHALREALSIIGDISTTTISTALPPPVDDSWLQ 760          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 958.748 bits (2477), Expect = 0.000e+0
Identity = 490/774 (63.31%), Postives = 616/774 (79.59%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNR+QDAF ++    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQLI   TEYAEFLHC  KKFTDF+EVR+EIEA+T+R+TG+NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QI+ M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDG+KDI  A+AAERKFF+TH  Y+HLADRMGT YLQK LNQQLTNHIRD+LP L++ +++QL SIE+EVE  K+ RP+DP+ KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELR++ISYAIKN HGIRTG+F PD+AFEAIVK++I+KLK P +KC+D+VV EL   I  C+EK+  YP LREE+ER+ +Q IR  E   KDQ++ LID++LAY+NTNH DF   AN   +++   + K  GNQ  D +  +IR+GWLT+ N+ I++GG+K+ +F+LT++SLSW+KDDE+ EKK+ ++++ LKL+D+   FMS K  FALFN  Q+NVYKDY+QLEL  E QE +D WKASFLRAGVY  +  ++ S +  +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LA +YS  D NTLMEES ++   R+ +LR + AL++AL II ++S+ T+S  +P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLTHPGYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRKEISYAIKNIHGIRTGLFTPDLAFEAIVKKQIQKLKSPVLKCIDMVVSELTSTIRKCSEKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQINKKKAPGNQ--DEI-MVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKSFMSSKHIFALFNTEQRNVYKDYRQLELACETQEDVDGWKASFLRAGVYAERVVSDTSEENGSDSFMHSMDPQLERQVETIRNLVDSYMGIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYHALREALSIIGDISTTTISTALPPPVDDSWLQ 760          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm1a (dynamin-1 [Source:NCBI gene;Acc:103024863])

HSP 1 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 491/776 (63.27%), Postives = 613/776 (78.99%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKL-GNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK--DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNR+QDAF ++    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQLI   TEYAEFLHC  KKFTDF+EVR+EIEA+T+R+TG+NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QI+ M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDG+KDI  A+AAERKFF+TH  Y+HLADRMGT YLQK LNQQLTNHIRD+LP L++ +++QL SIE+EVE  K+ RP+DP+ KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELR++ISYAIKN HGIRTG+F PDMAFE IVKR+I K KEP  KCVD+V+ EL+  +  CT+K+  YP LREE+ER+ +Q IR  E   KDQ++ LID++LAY+NTNH DF   AN   +++   + K  GNQ       +IR+GWLT+ N+ I++GG+K+ +F+LT++SLSW+KDDE+ EKK+ ++++ LKL+D+   FMS K  FALFN  Q+NVYKDY+QLEL  E QE +D WKASFLRAGVY  +  D +E +G   +DS     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LA +YS  D NTLMEES ++   R+ +LR + AL++AL II ++S+ T+S  +P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRVTGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEHQIKEMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLTHPGYRHLADRMGTPYLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKRIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQILKNKEPCQKCVDMVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKDQVMLLIDIELAYMNTNHEDFIGFANAQQRSSQINKKKAPGNQ-------VIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKSFMSSKHIFALFNTEQRNVYKDYRQLELACETQEDVDGWKASFLRAGVYAERVSDTSEENG---SDSFMHSMDPQLERQVETIRNLVDSYMGIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYHALREALSIIGDISTTTISTALPPPVDDSWLQ 755          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm1b (dynamin-1 [Source:NCBI gene;Acc:103047879])

HSP 1 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 493/778 (63.37%), Postives = 616/778 (79.18%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTK-----DETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VN+LQDAF ++    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQLI   TEYAEFLHC  KKFTDF+EVR+EIEA+T+RITG+NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE QI+ M++Q++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  A+AAERKFF+TH SY+HLA+RMGT YLQK+LNQQLTNHIRD+LP L+N +++QL SIE+EVE  K+ RP+DP+ KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELR++ISYAIKN HGIRTG+F PDMAFE IVKR+I K+KEP  KCVDLV+ EL+  +  CT+K+  YP LREE+ER+ +Q IR  E   K Q++ LID++LAY+NTNH DF   AN   +++   + K      D   K+IR+GWLT+ N+ I++GG+K+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKL+DI   FMS K  FALFN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP +      ++E S +  ++S     DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LA +YS  D NTLMEES ++   R+ +LR + ALK+AL+II ++S+ TVS  +P  V+D W Q
Sbjct:    2 GNRGMEDLIPLVNKLQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGQNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPSDIEFQIKDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMAAERKFFLTHPSYRHLAERMGTPYLQKILNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKCIEGSGDQIDTYELSGGARINRIFHERFPFELVK------------MEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDLVISELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKGQVMLLIDVELAYMNTNHEDFIGFANAQQRSSQMSKKK------DAGNKVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLRDIEKSFMSSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERIMDKEKQSEASEESSSESFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIHAELLAQLYSCGDQNTLMEESAEQAQHRDEMLRMYYALKEALNIIGDISTTTVSTSLPPPVDDSWLQ 761          
BLAST of Dynamin-1 vs. Ensembl Cavefish
Match: dnm2a (dynamin-2 [Source:NCBI gene;Acc:111191899])

HSP 1 Score: 954.896 bits (2467), Expect = 0.000e+0
Identity = 489/774 (63.18%), Postives = 620/774 (80.10%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVR---KIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDW 2385
            GN GME LI ++N+LQDAF S+    NL+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPL+LQL+    EYAEFLHC  KKF DF+EVR EIEA+T+RITG NKGIS  PINLRVYSPNVLNLTLIDLPGMTKVAVGDQP +IE QIR M++Q+I +E+CLILAV+PAN+DLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDG+KDIR ALAAERKFF++H +Y+H+A+RMGT +LQK LNQQLTNHIRD+LP L++ +++QL S+E+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+EL+K  I++          DE+ELRR+IS+AIKN HG+RTG+F PD+AFEAIVK++I KLKEP +KC+DLV+ ELI  +  CT K+ +YPRLREE ER+ +  +R  E   KDQ++ LID++L+YINTNH DF   AN   +     + +      D +R   K+IR+GWLT+ N++I++GGSK+ +F+LT++SLSW+KD+E+ EKK+ + L+ LKL+D+  GFMS K +FA+FN  Q+NVYKD +Q+EL  ++Q+ +D+WKASFLRAGVYP KD+TE      TD+ ++  DPQLERQVETIRNLV+SY+ IV+KS RDL+PKTIM ++I+  K F+  E+LA +Y S D N+LMEES D+  RR+ +LR + ALK+AL II ++S+ TVS PVP  VND+W
Sbjct:    2 GNRGMEDLIPLINKLQDAFSSIGQSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNNKAEYAEFLHCKGKKFVDFDEVRSEIEAETDRITGTNKGISPIPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPHDIEHQIRDMLMQFITKESCLILAVTPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDIRAALAAERKFFLSHPAYRHIAERMGTPHLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKCIEGSGDQVDTVELSGGARINRIFHERFPFELVK--IVF----------DEKELRREISHAIKNVHGVRTGLFTPDLAFEAIVKKQIVKLKEPCLKCIDLVIQELINTVRQCTNKLGSYPRLREETERIVTTHVREREGKTKDQVLLLIDIELSYINTNHEDFIGFANAQQRNPHVNKKRAIPNQLDGLREPEKVIRKGWLTI-NISIMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKLRDVEKGFMSTKHTFAIFNTEQRNVYKDLRQIELACDSQDDVDSWKASFLRAGVYPEKDQTEAEDAAPTDTFSM--DPQLERQVETIRNLVDSYIGIVNKSIRDLMPKTIMHLMINSAKDFIHSELLAYLYSSSDQNSLMEESADQAQRRDEMLRMYHALKEALTIIGDISTSTVSAPVPPPVNDNW 760          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 338/515 (65.63%), Postives = 419/515 (81.36%), Query Frame = 1
Query:  232 RDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTAD--GERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSW 1770
            RDFLPRGSGIVTRRPL+LQL+    EYAEFLHC  KKFTDFEEVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTLIDLPGMTKV VGDQP +IE QIR M++Q++ +ENCLILAVSPAN+DLANSDALKI+KEVDP G+RTIGVITKLDLMD+GTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDG+KDI  A+AAERKFF++H SY+H+ADRMGT YLQK LNQQLTNHIRD+LP L+N ++ Q+ S+E+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E DE+ELRR+ISYAI+N +GIRTG+F PD+AFEAIVK++I+KLKEP +KCVDLVVGEL  +I  C+EK+ +YPRLR++ +R+ +  IR  E   KDQ++ LID+QLAY+NTNH DF   +N   +T+    ++   GNQ       +IR+GWLT+ N+ I++GGSK+ +F+LT++SLSW
Sbjct:    1 RDFLPRGSGIVTRRPLILQLMFCKAEYAEFLHCKGKKFTDFEEVRAEIEAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDDGTDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLSHPSYRHMADRMGTPYLQKTLNQQLTNHIRDTLPALRNKLQGQMLSMEKEVEEYKNFRPDDPTRKTKALLQMVQQFAFDFEKRIEGSGDQIDTVELSGGARINRIFHERFPFELVK------------MEFDEKELRREISYAIRNINGIRTGLFTPDLAFEAIVKKQIQKLKEPCLKCVDLVVGELTNVIRKCSEKLGSYPRLRDDTDRIVTTYIREREGRTKDQVLLLIDIQLAYMNTNHEDFIGFSNAQQRTSQPVAKKKAPGNQ-------VIRKGWLTINNIGIMKGGSKEYWFVLTAESLSW 496          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 431.024 bits (1107), Expect = 5.608e-139
Identity = 244/533 (45.78%), Postives = 341/533 (63.98%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLI----------------TATT-------------EYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHC----TEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF 1587
            ME LI V+N+LQD F +     ++ LPQI VVG+QS+GKSSVLE+ VGRDFLPRG+GIVTRRPLVLQL+                TA+T             E+ +FLH  NK ++DF E+R+EIE +TERITG NKGIS+  I+L+++SP+VLNLTL+DLPG+TKV VGDQP +IE QIR +I+++I   N +ILAV+ AN+DLA S+ALKI++EVD  G RT+ VITKLDLMD GTDA DIL  +++P++ G +G+VNRSQ DI+ KK I  A+  E+ F    K Y  LA+R GT +L K LN+ L +HIRD LP+LK  +    A  +  +    +  P D   K   L+  V  F  ++  +IEG+   IET EL GGA I  IFHE F   L   + L     L  L+         +  AI+N  G R  +F+P+++FE +VKR+I++L+EPS++CV+LV  E+ ++I HC    T+++  +P+L + I  + +  +R     + + +  L+ ++LAYINT H DF
Sbjct:    1 MEALIPVINKLQDVF-NTVGSESIQLPQIVVVGAQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHVIPDERIRPGGEENGTASTAARLILFAGVEAEEWGKFLHTKNKVYSDFNEIRQEIENETERITGTNKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAGTDAMDILTGRVIPVKLGIIGVVNRSQLDINTKKTILDAMQDEQSFM--QKKYPSLANRNGTKFLGKTLNRLLMHHIRDCLPELKTRVNVMAAQYQSLLGGYGN--PVDD--KNATLLQLVTKFAAEYCNTIEGTAKHIETSELCGGARICYIFHETFGRTLESVDPL---GGLTTLD---------VLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRRRLPVSNEMVHNLVAIELAYINTKHPDF 514          

HSP 2 Score: 49.6766 bits (117), Expect = 2.895e-6
Identity = 26/71 (36.62%), Postives = 43/71 (60.56%), Query Frame = 1
Query: 2068 ERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLD-MNTLMEESEDEKDRRE 2277
            +R  E I  L++SY  IV K+ +D VPK +M  +++ VK  L+ E++  +Y    ++ L+ ESED   RR+
Sbjct:  669 QRDCEVIEKLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDNLQSELVGQLYKQQLLDELLTESEDMAQRRK 739          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007915.1 (pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene:ENSPMAG00000007153.1 transcript:ENSPMAT00000007915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.06 bits (510), Expect = 2.731e-58
Identity = 115/314 (36.62%), Postives = 179/314 (57.01%), Query Frame = 1
Query:  658 GGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHC----TEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF 1587
             G RT+ V++KLDLMD GTDA D+L  +++P++ G VG+VNRSQ DI+  K +  +L  E  F    + Y  LA+R GT  L K LN+ L +HIRD LP+LK  + N L +  + + +      +DP   +  L+  V  F +++  +IEG+   IET EL GGA I  IFHE F             R L  L          +  AI+N  G R  +F+P+++FE +VKR+I++L+EP ++CV+LV  E+ +++ HC    T+++  +P+L + I  + +  +R       + +  L+ ++LAYINT H DF
Sbjct:    9 AGRRTLAVVSKLDLMDAGTDATDVLLGRVVPVKLGIVGVVNRSQLDINKNKSVSDSLRDEDVFL--QRKYPALANRSGTKNLAKTLNRLLMHHIRDCLPELKARV-NMLVAQYQSLLSGYGEMVDDP---SATLLSIVTKFASEYCHTIEGTSKHIETSELCGGARICYIFHETF------------GRTLESLHPLGGLTTMDVLTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPGLRCVELVHEEMQRIVQHCSNYSTQELLRFPKLHDAIVEVVTSLLRKRLPFTNEMVHNLVAIELAYINTKHPDF 304          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 203.756 bits (517), Expect = 4.326e-56
Identity = 147/474 (31.01%), Postives = 243/474 (51.27%), Query Frame = 1
Query:  172 IAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFL------HCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTD--ARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLAD---RMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDE-RELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNY-PRLREEIERLTSQKIRLEEVSAKDQIIELIDMQ 1554
            +AV+G QS+GKSSVLE   G   LPRGSGIVTR PL L+L  A   +   +         N K    E V   +      +TG + G+S + I L V S +V +LTLIDLPG+ +VA+  Q  +IE+QI+ +I  +I  +  + L V P N D+A ++ALK+++ VDP GVRT+GV+TK DLMDEGT+  A  IL N++ PL +GYV +  RSQRD++  + +  A   E  FF  H  + H+ +      T  L   L ++L ++I+ +LP+L+  +  +L     E+E+     P+D   K +   IN ++   ++   + G         L+ G     +      Y L++ +     +DL + +     EL   I   I N  G     F+   AFE + +  +++L++P++  + +   +L  +     + +  + P     ++     +++ +E  A+  I+ L  M+
Sbjct:   51 VAVIGDQSSGKSSVLEALSGVQ-LPRGSGIVTRCPLALKLKRAPGPWHGRIKYRVQGRTINTKLDTPESVGDAVLQAQSELTGDDLGVSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTERNALRILQNQVFPLSKGYVLVKCRSQRDVEAHQTLAEASRVEAAFFKKHPVFCHVHNGGKLTTTTVLAAKLTEELVDNIKRTLPKLRKDLAEKLREACAELESQGESIPDDARAKQQ--FINARVM--RYNDDVRG---------LARGEPSRNLPRNMMLYTLVREHFRTWLKDLKRAQDAWLEELDNLIREYIDNRSGRELPGFVSYHAFENLARVHVQRLEKPALNVLAVTCSKLSDVFMRLADDVFKFLPEFNRLVKAKVGAQVQGQEQKARVLIVTLFRME 510          
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002195.1 (pep scaffold:Pmarinus_7.0:GL484008:1783:12172:-1 gene:ENSPMAG00000001995.1 transcript:ENSPMAT00000002195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.356 bits (490), Expect = 1.580e-55
Identity = 109/200 (54.50%), Postives = 142/200 (71.00%), Query Frame = 1
Query: 1813 LEGLKLKDI-SGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYP-----TKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            L+ L+L+D+  GGFMS K  FA+FN  Q+NVYKDY+QLEL  E QE +D+WKASFLRAGVYP      K ++E S D   D+     DPQLERQVETIRNLV+SYM IVSK+ RDL+PKTIM ++I+  K F+  E+LA++Y S D  +LMEES ++  RR+ +LR +  LKDAL II ++S  T + P+P  V+D W Q
Sbjct:   11 LDNLQLRDMEKGGFMSSKHIFAIFNTEQRNVYKDYRQLELACEGQEEVDSWKASFLRAGVYPERRAYVKQQSE-SEDSTGDNFGNSMDPQLERQVETIRNLVDSYMGIVSKNIRDLMPKTIMHLMINNTKDFIHSELLAHLYSSSDQTSLMEESAEQAQRRDEVLRMYHTLKDALSIIGDISMSTATTPLPPPVDDSWMQ 209          
BLAST of Dynamin-1 vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 433.335 bits (1113), Expect = 4.094e-140
Identity = 237/543 (43.65%), Postives = 332/543 (61.14%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL----------------------ITATT--------------------EYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHC-TEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF 1587
            +E LI  VN+LQD      I        +AVVGSQS+GKSS+LE  VGRDFLPRG+GIVTRRPLVLQL                      +T  +                    E+ EFLH   K+F DF++++REIE +T RI GK+KGIS  PINL+V+SP+VLNLTL+DLPG+TKV +G+QP +IE QI+ +IL YI   NCLILAVSPAN DL NS++LK+++EVDP G RTIGVITKLDLMD GT+A DIL  K+ PL+ G+VG+VNRSQ+DI   K +  +L  E  +F  H  Y+ ++ + GT YL K+LNQ L +HIRD LP +K  +   ++  E+E+     +       +   ++  +  F T FI SI+G+ ++I TKEL GGA I  I++  F   L   +    + +L  L+         +  AI+N+ G R  +F+P++AF+ +VK +I+ L EPS +CV+LV  EL+K+ H C + ++  YP+L+  +  + S+ +R      +  +  LID+  AYINTNH +F
Sbjct:    4 LEDLIPTVNKLQDVMYDSGIDTLDLPI-LAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNALDILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKHPVYRTISTKCGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYGGVGATTNESRASLVLQLMNKFSTNFISSIDGTSSDINTKELCGGARIYYIYNNVFGNSLKSID---PTSNLSVLD---------VRTAIRNSTGPRPTLFVPELAFDLLVKPQIKLLLEPSQRCVELVYEELMKICHKCGSAELARYPKLKSMLIEVISELLRERLQPTRSYVESLIDIHRAYINTNHPNF 533          
BLAST of Dynamin-1 vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 419.083 bits (1076), Expect = 2.986e-135
Identity = 236/555 (42.52%), Postives = 330/555 (59.46%), Query Frame = 1
Query:   91 EQLIQVVNRLQDAF--VSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLI--------------TATT------------------------------EYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERF--------PYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTE--KMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF 1587
            E LI  +N+LQDA   +       ++LPQI VVGSQS+GKSSVLEN VGRDFLPRG+GIVTRRPLVLQLI              TA                                E+ EFLH   KKF +F+E+R+EI  +T+++TG N GIS+ PINLR+YSP+VL LTL+DLPG+TKV VGDQP +IE QI+ M+L+YI + N +IL+V+ AN+DLANSD LK+++EVDP G RTIGV+TK+DLMD+GTD  DIL  +++PLR GY+ ++NR Q+DI+ KK IR AL  ERKFF  H SY   A   GT YL K LN  L +HIR +LP++K  IE  L   + E+    ++ PE  +  +  ++  +  F  ++   ++G   E+ ++ELSGGA I+ +FHE F        P++ IK             +SD R +       + N+ G    +F+   AFE +VK++I + +EPS++ V LV  EL++++       K   YP LRE I     Q ++   +   + ++++I  +  YINT H D 
Sbjct:    3 EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLKKYQNEL---INLGPETMDSASSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARISYVFHETFKNGVDSLDPFDQIK-------------DSDIRTI-------MYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLKQIISQPKYSRYPALREAISNQFIQFLKDATIPTNEFVVDIIKAEQTYINTAHPDL 534          
BLAST of Dynamin-1 vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 177.563 bits (449), Expect = 2.249e-46
Identity = 99/215 (46.05%), Postives = 138/215 (64.19%), Query Frame = 1
Query:  172 IAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTE---YAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGK 807
            I V+GSQS+GKSSVLE+ VGR+FLP+GS +VTRRP+ L L+         A+F         DF+EV+R +  +       ++ +S  PI L + S  V +L+L+DLPG  +V   DQP  ++++IR +  +Y+   N +ILA+S A+ DLANS ALK SK  DP G+RTIGVITKLDL+D    AR IL+NK  PL  GYVG++ ++   I+ K
Sbjct:  213 IVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRML-MELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDP-EKARSILNNKKYPLSMGYVGVITKTPSSINRK 424          
BLAST of Dynamin-1 vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 334/504 (66.27%), Postives = 415/504 (82.34%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF 1587
            GN GME LI +VN++QDAF S+     ++LPQIAVVGSQSAGKSSVLENFVG+DFLPRGSGIVTRRPL+LQL  + +EYAEFLHC NKKFTDF EV++EI A+T+R+TG NKGISN PINLRVYSP+VL+LTL+DLPGMTKV VGDQP +IE QIR+M+L++I +ENCLILAVSPANSDLANSDALKI++EVDP G RTIGVITKLDLMDEGTDARDIL+N++LPLRRGY+GIVNRSQ DIDG+KDIR ALAAERKFF+++ SY+H+AD+MGT YLQKVLNQQLTNHI+D+LP L++ +++ L ++E+EV+  ++  P D + +TKALM  +Q F   F K+IEGSG  I T ELSGGA IN+IFHERFPYEL+K            +E DE++LRR+I +AIKN HGIR G+F PDMAFEAIVKR+I+KL+ P++KCVD+V+ EL  +I  C  +M  YP LR+++ER+    IR  EV+ K+Q+   I+++LAYINTNH DF
Sbjct:    2 GNKGMEDLIPIVNKIQDAFASIGYSSMIDLPQIAVVGSQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLQPSKSEYAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEGTDARDILENRVLPLRRGYIGIVNRSQADIDGRKDIRAALAAERKFFLSNPSYRHMADKMGTQYLQKVLNQQLTNHIKDTLPALRSKLQDNLLALEKEVKGYENYNPRDLSVRTKALMQMMQTFSADFEKAIEGSGDSINTVELSGGAKINRIFHERFPYELVK------------MEFDEKQLRREIMFAIKNIHGIRVGLFTPDMAFEAIVKRQIDKLRSPAIKCVDMVMTELTSVIQKCATQMAKYPLLRDQVERIVIDHIRSNEVTTKEQVQTFIELELAYINTNHPDF 493          
BLAST of Dynamin-1 vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 441.039 bits (1133), Expect = 4.246e-143
Identity = 242/533 (45.40%), Postives = 335/533 (62.85%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLI-------------------------TATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEK---MQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDAN 1602
            MEQLI V+N+LQD F +     ++ LPQI VVG+QS+GKSSVLEN VGRDFLPRGSG+VTRRPL+LQL+                             E+ +FLH   K F DF  +R EIE +T+R+TG NKGIS+ PINL++YSP VLNLTL+DLPG+TKV VGDQP +IE QIR +ILQYI   N +ILAV+PAN DLA S+ALKI++EVDP G RT+ V TKLDLMD GTDA D+L  +++P++ G +G+VNRSQ DI+ +K I  AL  E  FF   ++Y  +A R GT YL K LN+ L +HIR+ LP+LK+ + +  +     +++      E    K   L+  +  F   +   IEG+  EIET EL GGA I  IFH+ F             R L  +++ E    R I  AI+N  G R  +F+P+++FE +VKR+I +L+EPS++C++LV  E+ ++I H  ++   ++ +PRL E I  +    ++   +   + +  L+ ++LAYINTNH DF   A+
Sbjct:    1 MEQLIPVINKLQDVF-NTVGSESIQLPQIVVVGAQSSGKSSVLENLVGRDFLPRGSGVVTRRPLILQLVHVPPRAKEKKINELPDKKEAAEDHDAEPAEWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHGTDAMDVLYGRVIPVKLGIIGVVNRSQLDINNRKSIENALRDEADFFA--RNYPTVASRNGTPYLAKTLNKLLMHHIRNCLPELKSRVNSMTSQYHHLLQSYG----EPVMDKGPYLLQMITRFAATYCSIIEGTAHEIETSELCGGARICYIFHDIF------------GRTLTIMDAMEGLSTRDILTAIRNATGPRPALFVPEISFELLVKRQIRRLEEPSLRCIELVHEEMQRIIQHSFDQVMEIKRFPRLHESIVDVIINLLQRRLMPCNEMVENLVAIELAYINTNHPDFTDGAS 514          

HSP 2 Score: 51.9878 bits (123), Expect = 9.732e-7
Identity = 32/85 (37.65%), Postives = 51/85 (60.00%), Query Frame = 1
Query: 2080 ETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMY-SLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINE 2331
            + IR L++SY  IV KS +D VPK IM  +++ VK  ++ E++  +Y S    TL++ESE    +R+      +AL+ A  II+E
Sbjct:  627 DIIRKLIKSYFVIVRKSIQDSVPKAIMAFLVNYVKERIQSELVEKLYKSERFETLLQESEHMHIKRKEAAEMLKALQRAGQIISE 711          
BLAST of Dynamin-1 vs. Ensembl Nematostella
Match: EDO43348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ55])

HSP 1 Score: 232.646 bits (592), Expect = 6.669e-70
Identity = 119/230 (51.74%), Postives = 178/230 (77.39%), Query Frame = 1
Query: 1669 KIIREGWLTLQNVTILRG---GSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQG-----DPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINE 2331
            +IIR+GWLT+     ++G   GSK+ +F+LT+++L+W+KD+E+ E K+ ++L+G++L+D+  GFMSK+ SFALFNP+ KN++KD+KQLEL A+NQE +D+WKASFLRAGVYP ++ +E          ++QG     DPQ+ERQVETIRNLV+SY++IVSK+ RDLVPKTIM +II+ +K F+  E+LA++YS  +++ LMEESE+E  RRE +L+ + + K+AL I+ +
Sbjct:   18 QIIRKGWLTVSQAGFMKGVGMGSKEYWFVLTAETLTWYKDEEEKETKYQLRLDGVRLRDLEAGFMSKRVSFALFNPDTKNLFKDHKQLELSADNQETVDSWKASFLRAGVYPERESSEDK--------SLQGEIGTLDPQMERQVETIRNLVDSYIRIVSKTIRDLVPKTIMYMIINNIKEFIAAELLAHLYSSGNVSDLMEESEEEAQRREEMLKMYHSTKEALQIVGD 239          
BLAST of Dynamin-1 vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 114.39 bits (285), Expect = 4.293e-26
Identity = 81/292 (27.74%), Postives = 149/292 (51.03%), Query Frame = 1
Query:  169 QIAVVGSQSAGKSSVLENFVGRDFLPRGSG-IVTRRPLVLQLITATTEYAEFLHCSNKKF-----TDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDA----RDILDNKLLPLRR-GYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKH---LADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIERE 1002
            ++ VVG QSAGK+SVLE        PRGSG ++TR P+++ L       A+F   ++++F      + +++R E+E   +R   + + +S   I++ V  P +  + L+DLPG+         ++ +S I  +  +Y++  N +IL +     D   S+   +   +DP G RTI V+TK+DL ++   +    + IL+  L P++  GY  +V  +    +  + I+T   +E  FF T K +K     A +M T  L   ++Q     +R+S+ Q  ++ + +  ++E E
Sbjct:   31 RVVVVGDQSAGKTSVLEMIAQARIFPRGSGQMMTRSPVMVTLSEGPNHIAQF-KGNSRQFDLTQEKELKDLRHEVELRMKRSVKQGQTVSPEVISMTVKGPGLHRMVLVDLPGIIGTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQNETSPSRIKQILEGNLFPMKALGYFAVVTGTGNTSESIETIKT---SEEGFFRTSKLFKSGVFKASQMTTQNLSFAVSQCFWKMVRESIEQQADAYKAKRFNLEAE 318          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: ENSORLT00000022079.2 (dynamin-1 [Source:NCBI gene;Acc:101154874])

HSP 1 Score: 963.755 bits (2490), Expect = 0.000e+0
Identity = 487/777 (62.68%), Postives = 620/777 (79.79%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNK-LGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKD---ETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME+LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+T  TEYAEFLHC  KKFTDF+EVR+EIEA+T+RITG NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QI+ M+LQ++ ++NCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  AL AERKFF++H +Y+HLADRMGTAYLQK+LNQQLTNHIRD+LP L++ +++QL SIE+EVE  K+ RP+DP+ KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+E++K            LESDE+ LR++ISYAIKN HGIRTG+F PDMAFE IVKR+I ++KEP  KCVD+V+GEL+  +  CT+K+  YP LREE+ER+ +Q IR  E   KDQ++ LID++LAY+NTNH DF   AN   K++   + K  GNQ  D +  +IR+GWLT+ N+ I++GG+K+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKLKDI   FMS K  FALF+   +NVYKDY+QLEL +E+QE +D+WKASFLRAGVYP +    E   + D  +DS     DPQLERQVE +RNLV+SY+ I+ ++ RDL+PKTIM ++++  K F+  ++LA++YS  D NTLMEES+++  RR+ +LR + AL++ L+II ++S+ TV+   P  V+D W Q
Sbjct:    2 GNRGMEELIPLVNRLQDAFSAIGQNASLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGHNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPPDIEQQIKDMLLQFVTKDNCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAALQAERKFFLSHPAYRHLADRMGTAYLQKILNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKRIEGSGDQVDTYELSGGAKINRIFHERFPFEMVK------------LESDEKTLRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGQIKEPCQKCVDMVIGELVNTVRQCTQKLAQYPMLREEMERIVTQHIRDRESRTKDQVLLLIDIELAYVNTNHEDFIGFANAQQKSSQLSKKKAAGNQ--DEI-MVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLKDIEKSFMSSKHIFALFSTEHRNVYKDYRQLELASESQEEVDSWKASFLRAGVYPERSVDKEKAEAEDSNSDSQIHSLDPQLERQVEIVRNLVDSYLSIIHRTVRDLIPKTIMHLMVNNTKEFIHADLLAHLYSCGDQNTLMEESQEQAQRRDEMLRMYHALREGLNIIGDISTTTVTTTAPPPVDDSWLQ 763          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: ENSORLT00000022076.2 (dynamin-1 [Source:NCBI gene;Acc:101154874])

HSP 1 Score: 962.985 bits (2488), Expect = 0.000e+0
Identity = 487/777 (62.68%), Postives = 620/777 (79.79%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNK-LGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKD---ETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME+LI +VNRLQDAF ++    +L+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQL+T  TEYAEFLHC  KKFTDF+EVR+EIEA+T+RITG NKGIS  PINLRVYSPNVLNLTL+DLPGMTKV VGDQP +IE QI+ M+LQ++ ++NCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  AL AERKFF++H +Y+HLADRMGTAYLQK+LNQQLTNHIRD+LP L++ +++QL SIE+EVE  K+ RP+DP+ KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+E++K            LESDE+ LR++ISYAIKN HGIRTG+F PDMAFE IVKR+I ++KEP  KCVD+V+GEL+  +  CT+K+  YP LREE+ER+ +Q IR  E   KDQ++ LID++LAY+NTNH DF   AN   K++   + K  GNQ  D +  +IR+GWLT+ N+ I++GG+K+ +F+LT+++LSW+KDDE+ EKK+ + ++ LKLKDI   FMS K  FALF+   +NVYKDY+QLEL +E+QE +D+WKASFLRAGVYP +    E   + D  +DS     DPQLERQVE +RNLV+SY+ I+ ++ RDL+PKTIM ++++  K F+  ++LA++YS  D NTLMEES+++  RR+ +LR + AL++ L+II ++S+ TV+   P  V+D W Q
Sbjct:    2 GNRGMEELIPLVNRLQDAFSAIGQNASLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVTCPTEYAEFLHCKGKKFTDFDEVRQEIEAETDRITGHNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPPDIEQQIKDMLLQFVTKDNCLLLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDITAALQAERKFFLSHPAYRHLADRMGTAYLQKILNQQLTNHIRDTLPGLRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFAVDFEKRIEGSGDQVDTYELSGGAKINRIFHERFPFEMVK------------LESDEKTLRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGQIKEPCQKCVDMVIGELVNTVRQCTQKLAQYPMLREEMERIVTQHIRDRESRTKDQVLLLIDIELAYVNTNHEDFIGFANAQQKSSQLSKKKAAGNQ--DEI-MVIRKGWLTINNIGIMKGGAKEYWFVLTAETLSWYKDDEEKEKKYMLPVDNLKLKDIEKSFMSSKHIFALFSTEHRNVYKDYRQLELASESQEEVDSWKASFLRAGVYPERSVDKEKAEAEDSNSDSQIHSLDPQLERQVEIVRNLVDSYLSIIHRTVRDLIPKTIMHLMVNNTKEFIHADLLAHLYSCGDQNTLMEESQEQAQRRDEMLRMYHALREGLNIIGDISTTTVTTTAPPPVDDSWLQ 763          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: dnm2b (dynamin-2 [Source:NCBI gene;Acc:101155909])

HSP 1 Score: 957.592 bits (2474), Expect = 0.000e+0
Identity = 504/826 (61.02%), Postives = 633/826 (76.63%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNK--LGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSARRXXXXXXXXXXXXXX--XXGLPPPIMPQRVQSYNPTVPARP 2538
            GN GME+LI ++N+LQDAF S+    NL+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPL+LQL+ + TE+AEFLHC  +KF DFEEVR EIEA+T+RITG NKGIS  PINLRVYSPNVLNLTLIDLPGMTKVAVGDQP +IE QIR M+LQ+I +E+CLILAV+PAN+DLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDIR ALAAERKFF++H +Y+HLA+RMGT +LQK LNQQLTNHIRD+LP L++ +++QL S+E+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +++T  LSGGA IN+IFHERFP+EL+K            +E DE+ELR++ISYAIKN HG+RTG+F PD+AFEAIVK++I KLKEP +KC+DLV+ ELI  +  CT K+ +YPRLREE ER+ +  IR  +   KDQ++ LID++L+YINTNH DF   AN   +TA     K  + NQ       +IR GWLT+ N++I++GGSKD +F+LT++SLSW+KD+E+ EKK+ + L+ LKL+D+  GFMS K  FA+FN  Q+NVYKD +Q+EL  + QE +D+WKASFLRAGVYP K + E + D  T S  +  DPQLERQVETIRNLV+SY+ IV+KS RDL+PKTIM ++I+  K F+  E+LA +YS  D  +LMEES ++  RR+ +LR + ALK+AL II ++S+ TVS PVP  V+D W   +PS   S R         N+P  +      PPP +        P +P+RP
Sbjct:    2 GNRGMEELIPLINKLQDAFSSIGQSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNSKTEHAEFLHCKGRKFVDFEEVRMEIEAETDRITGSNKGISPIPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPPDIEHQIRDMLLQFITKESCLILAVTPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDIRAALAAERKFFLSHPAYRHLAERMGTPHLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSLEKEVEEFKNFRPDDPARKTKALLQMVQQFGVDFEKCIEGSGDQVDTSNLSGGAKINRIFHERFPFELVK------------MEFDEKELRKEISYAIKNIHGVRTGLFTPDLAFEAIVKKQIIKLKEPCLKCIDLVIQELINTVRQCTNKLGSYPRLREETERIVTTYIRERDSKTKDQVLLLIDIELSYINTNHEDFIGFANAQQRTAANATKKRVIPNQ-------VIRRGWLTI-NISIMKGGSKDYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKLRDVEKGFMSSKHVFAIFNTEQRNVYKDLRQIELACDTQEEVDSWKASFLRAGVYPDKGQAE-NEDSLTQSDMVSMDPQLERQVETIRNLVDSYISIVNKSIRDLMPKTIMHLMINNTKDFIHSELLAYLYSAGDQGSLMEESAEQAQRRDEMLRMYHALKEALLIIGDISTTTVSTPVPPPVDDTWITKEPSPPPSTRHANSMTLPPNRPPAVRGPSSAPPPSLNPSPAFGVPPLPSRP 806          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: dnm2a (dynamin-2 [Source:NCBI gene;Acc:101162128])

HSP 1 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 491/776 (63.27%), Postives = 621/776 (80.03%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLK-TADGERNKLGNQYSD--NVR--KIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDW 2385
            GN GME LI ++N+LQDAF S+    NL+LPQIAVVG QSAGKSSVLENFVGRDFLPRGSGIVTRRPL+LQL+   TE+AEFLHC  KKF +F+EVR EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTLIDLPGMTKVAVGDQP +IE QIR M++Q+I +E+CLILAV+PAN+DLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDARDIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  A+AAERKFF++H +Y+HLA+RMGT +LQK LNQQLTNHIRD+LP L++ +++QL S+E+EVE  K+ RP+DP  KTKAL+  VQ F   F K IEGSG +++T ELSGGA IN+IFHERFP+EL+K  I++          DE+ELRR+IS+AIKN HG+RTG+F PD+AFE IVK++I KLK P +KC+DLV+ ELI  +  CT K+ +YPRLREE ER+ S  +R  E   KDQ++ LID++L+YINTNH DF   AN   + TA  ++  + NQ  D   VR  K+IR+GWLT+ N++I++GGSK+ +FILT++SLSW+KD+E+ EKK+ + L+ LK++D+  GFMS K SFA+FN  Q+NVYKD +Q+EL  ++QE +D+WKASFLRAGVYP KD+TE      TD+ ++  DPQLERQVETIRNLV+SY+ I++KS RDLVPKTIM ++I+  K F+  E+LA +YS  D N+LMEES D+  RR+ +LR + ALK+AL II ++S  T+S PVP  VND W
Sbjct:    2 GNRGMEDLIPLINKLQDAFSSIGQSCNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLVNCKTEHAEFLHCKGKKFVNFDEVRAEIEAETDRVTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVAVGDQPVDIEHQIREMLMQFITKESCLILAVTPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDARDILENKLLPLRRGYIGVVNRSQKDIDGKKDIGAAMAAERKFFLSHPAYRHLAERMGTPHLQKTLNQQLTNHIRDTLPGLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKCIEGSGDQVDTNELSGGAKINRIFHERFPFELVK--IVF----------DEKELRREISHAIKNVHGVRTGLFTPDLAFEVIVKKQIVKLKTPCLKCIDLVIQELISTVRQCTNKLGSYPRLREETERIVSTHVREREGKTKDQVLLLIDIELSYINTNHEDFIGFANAQQRNTAVNKKRAIPNQLGDLGEVREEKVIRKGWLTI-NISIMKGGSKEYWFILTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSSKHSFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQTEQEDAAPTDTFSM--DPQLERQVETIRNLVDSYIGIINKSIRDLVPKTIMHLMINSAKDFIHAELLAYLYSSGDQNSLMEESADQAQRRDEMLRMYHALKEALQIIGDISVTTISTPVPPPVNDSW 762          
BLAST of Dynamin-1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 951.044 bits (2457), Expect = 0.000e+0
Identity = 487/781 (62.36%), Postives = 623/781 (79.77%), Query Frame = 1
Query:   76 GNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANG-------DLKTADGERNKLGNQYSDNVR-KIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSL-DMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQ 2391
            GN GME LI +VNR+QDAF ++    NL+LPQIAVVG QSAGKSSVLENFVG+DFLPRGSGIVTRRPLVLQL+ + TE+AEFLHC  KKFTDF+EVR+EIEA+T+R+TG NKGIS  PINLRVYSP+VLNLTL+DLPGMTKV VGDQP +IE+QIR M+LQ++ +ENCL+LAVSPANSDLANSDALKI+KEVDP G+RTIGVITKLDLMDEGTDA+DIL+NKLLPLRRGY+G+VNRSQ+DIDGKKDI  A+AAERKFF++H +Y+HLADRMGT YLQKVLN+QLTNHIRD+LP L++ +++QL SIE+EVE  K+ RP+DP+ KTK L+  VQ F   F K IEGSG +I+T ELSGGA IN+IFHERFP+EL+K            +E +E+ELR++ISYAIKN HGIRTG+F PDMAFE IVKR+I K+KEP  KCVD+V+ EL+  +  CT+K+  YP LREE+ER+ +Q IR  E   K+Q++ LID++L+Y+NTNH DF   AN        + K A G ++++  +   N R K+IR+GWLT+ N+ I++GG+K+ +F+LT++SLSW+KDDE+ EKK+ ++++ LKL+D+  GFMS K  FALFN  Q+NVYKDY+QLEL  E+QE +DAWKASFLRAGVYP +  ++   D  +D++    DPQLERQVETIRNLV+SYM IV+K+ RDL+PKTIM ++I+  K F+  E+LA +YS  D N+LMEES+++   R+ +LR + AL++AL II ++S+ TVS   P  V+D W Q
Sbjct:    2 GNRGMEDLIPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEGTDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYRHLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPDDPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFPFELVK------------MEFNEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIGKIKEPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSYMNTNHEDFIGFANAQQRINQINKKKAAGNQDEIMPERGVNDRFKVIRKGWLTINNIGIMKGGAKEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKHIFALFNTEQRNVYKDYRQLELACESQEDVDAWKASFLRAGVYPERVTSDGGDDNDSDNLMHSMDPQLERQVETIRNLVDSYMSIVNKTVRDLMPKTIMHLMINNTKEFINAELLAQLYSCGDQNSLMEESQEQAQHRDEMLRMYHALREALRIIGDISTTTVSTANPPPVDDSWLQ 770          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000021502.1 (SMESG000021502.1)

HSP 1 Score: 1566.59 bits (4055), Expect = 0.000e+0
Identity = 828/838 (98.81%), Postives = 829/838 (98.93%), Query Frame = 1
Query:   70 MSGNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSARRXXXXXXXXXXXXXXXXGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 2583
            MSGNYGMEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEG+GAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF RDANGD KTADGERNKLGNQ       IIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP
Sbjct:    1 MSGNYGMEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGAGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFQRDANGDRKTADGERNKLGNQ-------IIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 831          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000021502.1 (SMESG000021502.1)

HSP 1 Score: 1555.04 bits (4025), Expect = 0.000e+0
Identity = 823/838 (98.21%), Postives = 824/838 (98.33%), Query Frame = 1
Query:   70 MSGNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSARRXXXXXXXXXXXXXXXXGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 2583
            MSGNYGMEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEG+GAEIETKELSGGAIINQIFHERFPYELIK            LESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF RDANGD KTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP
Sbjct:    1 MSGNYGMEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGAGAEIETKELSGGAIINQIFHERFPYELIK------------LESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFQRDANGDRKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 826          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000021502.1 (SMESG000021502.1)

HSP 1 Score: 1551.57 bits (4016), Expect = 0.000e+0
Identity = 822/832 (98.80%), Postives = 823/832 (98.92%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSARRXXXXXXXXXXXXXXXXGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 2583
            MEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEG+GAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF RDANGD KTADGERNKLGNQ       IIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP
Sbjct:    1 MEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGAGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFQRDANGDRKTADGERNKLGNQ-------IIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 825          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000021502.1 (SMESG000021502.1)

HSP 1 Score: 1533.85 bits (3970), Expect = 0.000e+0
Identity = 816/838 (97.37%), Postives = 817/838 (97.49%), Query Frame = 1
Query:   70 MSGNYGMEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSARRXXXXXXXXXXXXXXXXGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 2583
            MSGNYGMEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEG+GAEIETKELSGGAIINQIFHERFPYELIK            LESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF RDANGD KTADGERNKLGNQ       IIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP
Sbjct:    1 MSGNYGMEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGAGAEIETKELSGGAIINQIFHERFPYELIK------------LESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFQRDANGDRKTADGERNKLGNQ-------IIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 819          
BLAST of Dynamin-1 vs. Planmine SMEST
Match: SMESG000021502.1 (SMESG000021502.1)

HSP 1 Score: 1520.37 bits (3935), Expect = 0.000e+0
Identity = 810/832 (97.36%), Postives = 811/832 (97.48%), Query Frame = 1
Query:   88 MEQLIQVVNRLQDAFVSXXXXXXXXXXQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGAEIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILRGGSKDLYFILTSDSLSWXXXXXXXXXXXXXXLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEXXXXXXXXXXXXXXNDDWRQPDPSVDLSARRXXXXXXXXXXXXXXXXGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 2583
            MEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEG+GAEIETKELSGGAIINQIFHERFPYELIK            LESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADF RDANGD KTADGERNKLGNQ       IIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP
Sbjct:    1 MEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRREIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQPQNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVRTIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIRTALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNSIENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGAGAEIETKELSGGAIINQIFHERFPYELIK------------LESDERELRRQISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIKLIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYINTNHADFQRDANGDRKTADGERNKLGNQ-------IIREGWLTLQNVTILRGGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCSFALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPSGDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCIIIDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALDIINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPINKGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP 813          
The following BLAST results are available for this feature:
BLAST of Dynamin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNM10.000e+064.92dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM10.000e+064.92dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM10.000e+064.92dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM10.000e+064.40dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
DNM10.000e+064.53dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
back to top
BLAST of Dynamin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyn-10.000e+059.10Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
dyn-10.000e+059.10Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
drp-11.580e-13746.36Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-11.580e-13746.36Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-11.580e-13746.36Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shi0.000e+061.16gene:FBgn0003392 transcript:FBtr0301596[more]
shi0.000e+061.16gene:FBgn0003392 transcript:FBtr0301597[more]
shi0.000e+061.30gene:FBgn0003392 transcript:FBtr0301595[more]
shi0.000e+061.30gene:FBgn0003392 transcript:FBtr0301594[more]
shi0.000e+061.30gene:FBgn0003392 transcript:FBtr0074123[more]
back to top
BLAST of Dynamin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1a0.000e+063.32dynamin 1a [Source:NCBI gene;Acc:100307098][more]
dnm1b0.000e+059.45dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3][more]
dnm1a0.000e+063.19dynamin 1a [Source:NCBI gene;Acc:100307098][more]
dnm1b0.000e+060.50dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3][more]
dnm2a0.000e+063.04dynamin 2a [Source:ZFIN;Acc:ZDB-GENE-050913-84][more]
back to top
BLAST of Dynamin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcbld20.000e+062.79discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
ei240.000e+064.13etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
ei240.000e+063.88etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
ei240.000e+064.46etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
dcbld20.000e+059.64discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnm10.000e+064.79dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+064.79dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+064.79dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+064.28dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
Dnm10.000e+064.40dynamin 1 [Source:MGI Symbol;Acc:MGI:107384][more]
back to top
BLAST of Dynamin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08DF4|DYN1_BOVIN0.000e+064.92Dynamin-1 OS=Bos taurus OX=9913 GN=DNM1 PE=2 SV=1[more]
sp|Q05193|DYN1_HUMAN0.000e+064.53Dynamin-1 OS=Homo sapiens OX=9606 GN=DNM1 PE=1 SV=... [more]
sp|P21575|DYN1_RAT0.000e+064.79Dynamin-1 OS=Rattus norvegicus OX=10116 GN=Dnm1 PE... [more]
sp|P39053|DYN1_MOUSE0.000e+064.40Dynamin-1 OS=Mus musculus OX=10090 GN=Dnm1 PE=1 SV... [more]
sp|Q08877|DYN3_RAT0.000e+060.77Dynamin-3 OS=Rattus norvegicus OX=10116 GN=Dnm3 PE... [more]
back to top
BLAST of Dynamin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZKG00.000e+063.78Dynamin-1 OS=Schistosoma haematobium OX=6185 GN=MS... [more]
A0A5K4EDF90.000e+063.69Dynamin, putative OS=Schistosoma mansoni OX=6183 P... [more]
A0A5K4EE900.000e+063.69Dynamin, putative OS=Schistosoma mansoni OX=6183 P... [more]
A0A5K4ED860.000e+063.69Dynamin, putative OS=Schistosoma mansoni OX=6183 P... [more]
A0A3Q0KF720.000e+063.69Dynamin, putative OS=Schistosoma mansoni OX=6183 P... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnm1a0.000e+063.31dynamin-1 [Source:NCBI gene;Acc:103024863][more]
dnm1a0.000e+063.31dynamin-1 [Source:NCBI gene;Acc:103024863][more]
dnm1a0.000e+063.27dynamin-1 [Source:NCBI gene;Acc:103024863][more]
dnm1b0.000e+063.37dynamin-1 [Source:NCBI gene;Acc:103047879][more]
dnm2a0.000e+063.18dynamin-2 [Source:NCBI gene;Acc:111191899][more]
back to top
BLAST of Dynamin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006976.10.000e+065.63pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
ENSPMAT00000002816.15.608e-13945.78pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
ENSPMAT00000007915.12.731e-5836.62pep scaffold:Pmarinus_7.0:GL487011:231:8254:1 gene... [more]
mxb4.326e-5631.01myxovirus (influenza) resistance B [Source:NCBI ge... [more]
ENSPMAT00000002195.11.580e-5554.50pep scaffold:Pmarinus_7.0:GL484008:1783:12172:-1 g... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
DNM14.094e-14043.65Dynamin-related GTPase involved in mitochondrial o... [more]
VPS12.986e-13542.52Dynamin-like GTPase required for vacuolar sorting;... [more]
MGM12.249e-4646.05Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO321910.000e+066.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348954.246e-14345.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433486.669e-7051.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403594.293e-2627.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynamin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022079.20.000e+062.68dynamin-1 [Source:NCBI gene;Acc:101154874][more]
ENSORLT00000022076.20.000e+062.68dynamin-1 [Source:NCBI gene;Acc:101154874][more]
dnm2b0.000e+061.02dynamin-2 [Source:NCBI gene;Acc:101155909][more]
dnm2a0.000e+063.27dynamin-2 [Source:NCBI gene;Acc:101162128][more]
dnm1a0.000e+062.36dynamin 1 [Source:NCBI gene;Acc:101157793][more]
back to top
BLAST of Dynamin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021502.10.000e+098.81SMESG000021502.1[more]
SMESG000021502.10.000e+098.21SMESG000021502.1[more]
SMESG000021502.10.000e+098.80SMESG000021502.1[more]
SMESG000021502.10.000e+097.37SMESG000021502.1[more]
SMESG000021502.10.000e+097.36SMESG000021502.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000411 ID=SMED30000411|Name=Dynamin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2688bp
CTATTTTTATGCTAGTACAAAACTTTAAATTTTTATAAATATATATTTCA
GGAATAAATATATATAATTATGTCTGGAAATTATGGCATGGAGCAATTGA
TACAAGTTGTAAATAGATTACAAGATGCTTTTGTTTCTTTAAATATTCCA
TTAAATTTAAATTTACCTCAAATAGCGGTTGTTGGTAGTCAAAGTGCTGG
TAAAAGTAGTGTTTTAGAAAACTTTGTTGGCAGAGATTTCCTTCCAAGAG
GTTCAGGTATTGTTACTCGAAGACCTTTAGTTCTGCAGTTAATAACTGCC
ACAACTGAATATGCTGAATTTTTACATTGTTCTAATAAAAAGTTTACTGA
CTTTGAAGAAGTTCGTCGTGAGATTGAGGCAGATACTGAAAGAATAACTG
GAAAAAATAAAGGCATTTCCAATACTCCTATAAATCTTCGTGTTTACTCA
CCTAATGTGCTCAATTTGACATTAATCGATTTACCTGGTATGACAAAAGT
TGCGGTCGGTGATCAGCCTCAAAATATCGAATCACAAATTCGAACGATGA
TTCTTCAATATATACAGGAAGAAAATTGCCTCATTTTGGCTGTTAGTCCA
GCTAATAGTGATTTGGCCAATTCTGACGCTTTGAAAATTTCCAAAGAAGT
TGATCCAGGAGGAGTGAGAACGATTGGTGTCATCACCAAATTGGATTTAA
TGGACGAAGGCACAGATGCTCGTGATATTTTGGATAATAAACTATTGCCA
CTTAGAAGAGGATACGTGGGAATCGTTAATCGAAGCCAGCGAGATATTGA
TGGGAAAAAAGATATCAGAACAGCCTTGGCAGCAGAAAGGAAATTTTTCA
TCACACATAAATCTTATAAACACCTGGCTGATCGCATGGGAACCGCATAC
TTGCAGAAGGTCCTCAACCAGCAGCTCACCAATCACATCAGGGACAGCCT
ACCACAATTGAAAAACAGCATTGAGAATCAACTGGCCAGTATCGAACGAG
AAGTCGAGGCCTGCAAATCCATTCGGCCGGAAGATCCTAATTATAAAACG
AAAGCCCTAATGATAAACGTTCAAATATTTGAAACGCAATTTATTAAATC
CATTGAGGGTTCCGGCGCAGAAATCGAAACGAAAGAGTTATCCGGTGGAG
CCATTATCAATCAAATATTCCATGAAAGGTTTCCATATGAGCTTATCAAA
GCTAATATACTCTATATCAGCCGAGATCTTGTACAGCTGGAAAGTGACGA
ACGTGAATTACGACGGCAAATCAGTTACGCTATCAAAAACAATCACGGTA
TAAGAACTGGGATTTTCATTCCAGATATGGCATTTGAGGCTATTGTAAAG
AGAGAAATAGAGAAATTGAAAGAACCGTCGATGAAATGTGTGGATTTAGT
GGTGGGGGAATTGATAAAACTGATCCATCATTGCACTGAAAAAATGCAAA
ATTATCCTCGCTTGCGAGAAGAAATCGAACGATTGACCAGTCAAAAAATC
AGACTAGAAGAAGTGAGTGCAAAGGATCAGATTATCGAACTAATTGATAT
GCAATTGGCTTATATAAACACGAATCACGCGGATTTCAATCGAGATGCAA
ATGGAGACCTGAAAACTGCAGACGGTGAGCGCAACAAGCTAGGAAACCAG
TATTCTGACAACGTTAGAAAGATAATCCGTGAAGGATGGTTAACTTTACA
AAATGTGACAATATTACGTGGTGGCAGCAAAGATTTATATTTTATATTAA
CCTCTGATTCTCTCAGTTGGTTTAAAGACGATGAAAAAACTGAAAAAAAA
TTTGACATGAAATTGGAAGGTCTTAAACTGAAAGATATTTCTGGTGGCTT
TATGTCAAAAAAATGCTCATTTGCTCTATTTAATCCTAATCAGAAAAATG
TTTACAAAGATTACAAGCAATTAGAATTAGTGGCAGAAAATCAAGAGATG
TTGGATGCTTGGAAAGCTTCGTTTTTACGAGCCGGAGTATACCCAACAAA
AGATGAGACTGAGCCATCTGGGGATGAAAAAACGGATTCGGTAAACATTC
AGGGGGACCCTCAATTGGAAAGGCAAGTTGAAACAATTCGTAATCTAGTA
GAGTCGTATATGAAAATTGTAAGCAAATCTCATCGGGACCTTGTTCCCAA
GACAATTATGTGTATCATAATCGATGAGGTAAAGGCTTTTCTTAAGCAAG
AAATGCTAGCAAATATGTATTCATTGGATATGAACACTTTAATGGAAGAA
TCAGAGGATGAAAAAGATAGAAGAGAAAATCTGTTGCGTTCTCATCAAGC
CCTTAAAGACGCTCTTGATATTATAAATGAAGTATCATCCAAAACTGTTT
CTGTACCAGTTCCATCTGCAGTAAATGATGACTGGCGACAGCCTGATCCA
TCTGTCGACCTAAGTGCCCGAAGACCACCGCCTCCTCCACCAAACATGAA
TAAACCGAAGCCAATAAACAAAGGCTTACCTCCTCCAATTATGCCACAAA
GAGTACAGAGCTACAACCCAACAGTACCTGCTCGTCCTATTTCTGGCGTA
TCATCAACCATTCCAAAACCTTATGGTAAACCTTGAGATGTTATATTGTG
AAAATTTATATACTACACGTTTCTTTCTTAATGGAAATTTGTAGATTCGT
TTATATACAATAAATCTTATCTTTATTTTAAAAAAAAA
back to top

protein sequence of SMED30000411-orf-1

>SMED30000411-orf-1 ID=SMED30000411-orf-1|Name=SMED30000411-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=839bp
MSGNYGMEQLIQVVNRLQDAFVSLNIPLNLNLPQIAVVGSQSAGKSSVLE
NFVGRDFLPRGSGIVTRRPLVLQLITATTEYAEFLHCSNKKFTDFEEVRR
EIEADTERITGKNKGISNTPINLRVYSPNVLNLTLIDLPGMTKVAVGDQP
QNIESQIRTMILQYIQEENCLILAVSPANSDLANSDALKISKEVDPGGVR
TIGVITKLDLMDEGTDARDILDNKLLPLRRGYVGIVNRSQRDIDGKKDIR
TALAAERKFFITHKSYKHLADRMGTAYLQKVLNQQLTNHIRDSLPQLKNS
IENQLASIEREVEACKSIRPEDPNYKTKALMINVQIFETQFIKSIEGSGA
EIETKELSGGAIINQIFHERFPYELIKANILYISRDLVQLESDERELRRQ
ISYAIKNNHGIRTGIFIPDMAFEAIVKREIEKLKEPSMKCVDLVVGELIK
LIHHCTEKMQNYPRLREEIERLTSQKIRLEEVSAKDQIIELIDMQLAYIN
TNHADFNRDANGDLKTADGERNKLGNQYSDNVRKIIREGWLTLQNVTILR
GGSKDLYFILTSDSLSWFKDDEKTEKKFDMKLEGLKLKDISGGFMSKKCS
FALFNPNQKNVYKDYKQLELVAENQEMLDAWKASFLRAGVYPTKDETEPS
GDEKTDSVNIQGDPQLERQVETIRNLVESYMKIVSKSHRDLVPKTIMCII
IDEVKAFLKQEMLANMYSLDMNTLMEESEDEKDRRENLLRSHQALKDALD
IINEVSSKTVSVPVPSAVNDDWRQPDPSVDLSARRPPPPPPNMNKPKPIN
KGLPPPIMPQRVQSYNPTVPARPISGVSSTIPKPYGKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027741DNM1
IPR022812Dynamin_SF
IPR003130GED
IPR001849PH_domain
IPR001401Dynamin_GTPase
IPR027417P-loop_NTPase
IPR000375Dynamin_central
IPR011993PH-like_dom_sf
IPR019762Dynamin_GTPase_CS
IPR030381G_DYNAMIN_dom
IPR020850GED_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0005515protein binding
GO:0008017microtubule binding
GO:0008022protein C-terminus binding
GO:0016787hydrolase activity
GO:0019901protein kinase binding
GO:0042802identical protein binding
GO:0046983protein dimerization activity
Vocabulary: biological process
TermDefinition
GO:0000266mitochondrial fission
GO:0003374dynamin family protein polymerization involved in mitochondrial fission
GO:0006897endocytosis
GO:0006898receptor-mediated endocytosis
GO:0007032endosome organization
GO:0007605sensory perception of sound
GO:0008344adult locomotory behavior
GO:0016185synaptic vesicle budding from presynaptic endocytic zone membrane
GO:0045920negative regulation of exocytosis
GO:0051262protein tetramerization
GO:0051932synaptic transmission, GABAergic
GO:0061025membrane fusion
GO:0072583clathrin-dependent endocytosis
GO:1901998toxin transport
Vocabulary: cellular component
TermDefinition
GO:0001917photoreceptor inner segment
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0030117membrane coat
GO:0031966mitochondrial membrane
GO:0042584chromaffin granule membrane
GO:0043209myelin sheath
GO:0045202synapse
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 455..482
NoneNo IPR availableCOILSCoilCoilcoord: 721..745
NoneNo IPR availableCOILSCoilCoilcoord: 298..318
NoneNo IPR availableGENE3DG3DSA:1.20.120.1240coord: 319..726
e-value: 8.0E-292
score: 971.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 7..751
e-value: 8.0E-292
score: 971.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 817..838
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 781..805
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 765..805
NoneNo IPR availableCDDcd01256PH_dynamincoord: 535..644
e-value: 4.96552E-57
score: 188.684
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 535..641
IPR022812Dynamin superfamilyPRINTSPR00195DYNAMINcoord: 32..50
score: 84.1
coord: 57..74
score: 85.94
coord: 196..212
score: 73.71
coord: 219..238
score: 47.55
coord: 127..144
score: 77.89
coord: 177..195
score: 65.09
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 35..207
e-value: 4.6E-54
score: 183.0
IPR022812Dynamin superfamilyPANTHERPTHR11566DYNAMINcoord: 5..785
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 535..642
e-value: 4.3E-9
score: 46.2
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 536..635
e-value: 5.0E-8
score: 33.4
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 534..640
score: 11.917
IPR001401Dynamin, GTPase domainSMARTSM00053dynamin_3coord: 7..246
e-value: 3.8E-160
score: 548.0
IPR001401Dynamin, GTPase domainCDDcd08771DLP_1coord: 30..295
e-value: 6.45374E-142
score: 418.572
IPR003130Dynamin GTPase effectorSMARTSM00302GED_2coord: 665..755
e-value: 6.8E-21
score: 85.4
IPR003130Dynamin GTPase effectorPFAMPF02212GEDcoord: 667..755
e-value: 1.4E-21
score: 76.4
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 509..667
e-value: 8.0E-292
score: 971.3
IPR000375Dynamin central domainPFAMPF01031Dynamin_Mcoord: 217..511
e-value: 1.2E-92
score: 310.2
IPR027741Dynamin-1PANTHERPTHR11566:SF32DYNAMIN-1coord: 5..785
IPR019762Dynamin, GTPase region, conserved sitePROSITEPS00410G_DYNAMIN_1coord: 58..67
IPR020850GTPase effector domainPROSITEPS51388GEDcoord: 670..760
score: 25.014
IPR030381Dynamin-type guanine nucleotide-binding (G) domainPROSITEPS51718G_DYNAMIN_2coord: 29..295
score: 71.396
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 6..304