ENTH domain-containing protein

Overview
NameENTH domain-containing protein
Smed IDSMED30000393
Length (bp)1573
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ENTH domain-containing protein (SMED30000393) t-SNE clustered cells

Violin plots show distribution of expression levels for ENTH domain-containing protein (SMED30000393) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ENTH domain-containing protein (SMED30000393) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ENTH domain-containing protein (SMED30000393) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000393

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000393h1SMcG0007621 dd_Smed_v4_5174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000393h1SMcG0007621 dd_Smed_v4_5174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000393h1SMcG0007621 dd_Smed_v4_5174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: EPN2 (epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639])

HSP 1 Score: 245.743 bits (626), Expect = 1.558e-75
Identity = 151/329 (45.90%), Postives = 204/329 (62.01%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQ--RKRLEKSIATSSPSGTLFQLVDTSLSVAP-ANVPSPWDVVEEQHQ----DTSSSLIAISDPW 990
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER +ALK K R+A        +  +      Q       S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+E   RR +D     +++MALE+SR +  +  +K+   S+   +   TL  L+D   S  P A    PW      +Q       ++  + SDPW
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDL----RLQMALEESRRDTVKIPKKKEHGSLPQQT---TLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPW 322          
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: EPN2 (epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639])

HSP 1 Score: 248.825 bits (634), Expect = 9.577e-75
Identity = 151/329 (45.90%), Postives = 205/329 (62.31%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQ--RKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPS-PWDVVEEQHQ----DTSSSLIAISDPW 990
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER +ALK K R+A        +  +      Q       S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+E   RR +D     +++MALE+SR +  +  +K+   S+   +   TL  L+D   S  PA   + PW      +Q       ++  + SDPW
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDL----RLQMALEESRRDTVKIPKKKEHGSLPQQT---TLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPW 322          
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: EPN2 (epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639])

HSP 1 Score: 248.825 bits (634), Expect = 9.577e-75
Identity = 151/329 (45.90%), Postives = 205/329 (62.31%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQ--RKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPS-PWDVVEEQHQ----DTSSSLIAISDPW 990
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER +ALK K R+A        +  +      Q       S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+E   RR +D     +++MALE+SR +  +  +K+   S+   +   TL  L+D   S  PA   + PW      +Q       ++  + SDPW
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDL----RLQMALEESRRDTVKIPKKKEHGSLPQQT---TLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPW 322          
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: EPN2 (epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639])

HSP 1 Score: 248.054 bits (632), Expect = 1.686e-74
Identity = 149/327 (45.57%), Postives = 203/327 (62.08%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPS-PWDVVEEQHQ----DTSSSLIAISDPW 990
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER +ALK K R+A        +  +      Q       S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+E   RR +D     +++MALE+SR +  +  + +++        TL  L+D   S  PA   + PW      +Q       ++  + SDPW
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDL----RLQMALEESRRDTVKIPKKKET--------TLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPW 315          
BLAST of ENTH domain-containing protein vs. Ensembl Human
Match: EPN1 (epsin 1 [Source:HGNC Symbol;Acc:HGNC:21604])

HSP 1 Score: 231.106 bits (588), Expect = 2.166e-68
Identity = 138/327 (42.20%), Postives = 183/327 (55.96%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNI 1005
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+V+ +C+EN++ ++TLKDFQYV+ +GKD GVNVRE+AK + ALLRD DRL++ER  ALK K +LA +   S  + GS      +Q                          PQ S  E                 +QLQLALA+SK     E D+       +  +++MA+E+S+ E   ++             +L  L D   + APA    PW            +    SDPW    +
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAW------------------------PQSSGEE----------------ELQLQLALAMSK----EEADQEERIRRGDDLRLQMAIEESKRETGGKEE-----------SSLMDLADVFTAPAPAPTTDPWGGPAPMAA-AVPTAAPTSDPWGGPPV 276          
BLAST of ENTH domain-containing protein vs. Ensembl Celegans
Match: epn-1 (EPsiN (Endocytic protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BI72])

HSP 1 Score: 233.802 bits (595), Expect = 1.179e-70
Identity = 167/462 (36.15%), Postives = 250/462 (54.11%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQS-RLEESQRKRLEKSIATSSPSGTLFQ-LVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVG---QQRSNCVSPD--W-------PLHIVDPN---ISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSP--AKYLIKKKAEDFLGEHKNLVDVNRLVDIHPGSTNPFATGKKSSLHGNPF 1356
            I R +KNV  N+++A+ KVREATSNDPWG S+ LMSEIAD+T+N M F +IM ++WKRLND  KNWRHVYK+L+L++++IK G EKVA +CREN+ TIETLKDFQ+VE+ +D G+N+RE+AK I +LL D +RL++ER + +  +++             ++ G +  + +R                  NR      SL         A P T  EE +QLQ+ALA+S+     E ++  +    + A+++MALE+S +L+++ R    K    S  SG L Q  +D  LS+    +     V     Q +SSS   ++DPW     S+ +    Q  +N +S +  W       P+    PN    +     A +     T+ +S S D   G  +   +N+LS N +   +    +K  E+FLGE+ NLV+++ L+    GS  P  TG      GNPF
Sbjct:    6 IRRQVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKRLNDSGKNWRHVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHVEDNRDQGLNIREKAKQITSLLSDDERLKNERTRFILTRNKF----------KQNNPGPVGAESRR-----------------SNRHHVTDASLDPE---YEDARPSTATEEEMQLQIALALSR----EECEKADEMRKSDDARLQMALEESQKLQDADRLATTKQGTVS--SGQLTQSALDDLLSLGVGEL-----VSGNNDQPSSSSAWGMNDPWGAPQASASLNTNDQMFANSMSNNDPWATSTVAQPVAATAPNSDPFASWDAPAPAATTPSTMPTSSSFD-LLGGDLLSPTNSLSANINTNNSTNGTRKTPENFLGENSNLVNLDNLL----GSGTPSTTG------GNPF 415          
BLAST of ENTH domain-containing protein vs. Ensembl Celegans
Match: epn-1 (EPsiN (Endocytic protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BI72])

HSP 1 Score: 232.261 bits (591), Expect = 4.144e-70
Identity = 165/461 (35.79%), Postives = 248/461 (53.80%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQ-LVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVG---QQRSNCVSPD--W-------PLHIVDPN---ISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSP--AKYLIKKKAEDFLGEHKNLVDVNRLVDIHPGSTNPFATGKKSSLHGNPF 1356
            I R +KNV  N+++A+ KVREATSNDPWG S+ LMSEIAD+T+N M F +IM ++WKRLND  KNWRHVYK+L+L++++IK G EKVA +CREN+ TIETLKDFQ+VE+ +D G+N+RE+AK I +LL D +RL++ER + +  +++             ++ G +  + +R                  NR      SL         A P T  EE +QLQ+ALA+S+     E ++  +    + A+++MALE+S+ +     RL  +   +  SG L Q  +D  LS+    +     V     Q +SSS   ++DPW     S+ +    Q  +N +S +  W       P+    PN    +     A +     T+ +S S D   G  +   +N+LS N +   +    +K  E+FLGE+ NLV+++ L+    GS  P  TG      GNPF
Sbjct:    6 IRRQVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKRLNDSGKNWRHVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHVEDNRDQGLNIREKAKQITSLLSDDERLKNERTRFILTRNKF----------KQNNPGPVGAESRR-----------------SNRHHVTDASLDPE---YEDARPSTATEEEMQLQIALALSR----EECEKADEMRKSDDARLQMALEESQKDA---DRLATTKQGTVSSGQLTQSALDDLLSLGVGEL-----VSGNNDQPSSSSAWGMNDPWGAPQASASLNTNDQMFANSMSNNDPWATSTVAQPVAATAPNSDPFASWDAPAPAATTPSTMPTSSSFD-LLGGDLLSPTNSLSANINTNNSTNGTRKTPENFLGENSNLVNLDNLL----GSGTPSTTG------GNPF 413          
BLAST of ENTH domain-containing protein vs. Ensembl Celegans
Match: rsd-3 (pep chromosome:WBcel235:X:11798505:11803656:1 gene:WBGene00004682.1 transcript:C34E11.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rsd-3)

HSP 1 Score: 108.227 bits (269), Expect = 5.501e-25
Identity = 53/145 (36.55%), Postives = 89/145 (61.38%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMY--FVDIMQMLWKRLNDKNKN-WRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEE-GKDLGVNVRERAKMICALLRDFDRLQDERIKA 450
            +   + + + NY +A   VREAT+ DPWG +   M +I + T +     F ++   L++R+ + NK+ WR VYK+L+L++Y++K GSE+     RE  + +  L+ ++Y++E GKD G+N+R R K I  ++ D + LQ ER KA
Sbjct:   28 VTESMNDAIMNYPKAMMDVREATNEDPWGPTGPQMKKICEYTRSRYMEDFYNVYTPLFQRMLENNKDAWRRVYKSLILLDYLLKNGSERFVQEAREKAYELRRLESYKYIDEKGKDQGINIRHRVKQILEMMNDDELLQAERQKA 172          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0331835)

HSP 1 Score: 236.498 bits (602), Expect = 5.110e-70
Identity = 159/428 (37.15%), Postives = 230/428 (53.74%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLE-ESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVP-------SPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERS-------DSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPA-----KYLIKKKAEDFLG 1251
            + R++KN+  NY++A+ KVREATSNDPWG S+ +MSEIA++TYNV+ F +IMQM+WKRLND  KNWRHVYKAL+L+EY+IKTGSEKVA +C+ENI  I+TL++F Y EEGKD G +VRE+AK +  LL+D +RL++ER+KA KAK R A +              ID   QR                 P   + P +S+SE    + +  PQT GEE +QLQLA+A+S+     E ++   +   +  ++++AL QS  + +    R   +         L  L+D SL     + P       +P  VV+        +   +SDPWS  + S QV     +      P  I+   +   S       D+  +   S +VAS  S + +   + + N+N      +PA      +LIK  A   LG
Sbjct:   15 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGY-----IDGPSQR--------------DLPPGWQEEPPKSVSE----LEMVRPQTAGEEELQLQLAMAMSR----EEAEQEEAKRRSDDVRLQLALSQSEQDFKDPNGRPIPAPKKEEQQSHLLDLLDISLGATSISSPPLGAAGGAPTAVVDPWAMPGPRAPSQLSDPWSGTS-SPQVDPWNPSAA----PRTILGAGVPMTSAPLGAGNDAWGARTQSPSVASGSSNEGW--LQSNGNANQNGRGATPAGPPAEGWLIKSTAVGALG 408          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0331833)

HSP 1 Score: 236.498 bits (602), Expect = 5.252e-70
Identity = 159/428 (37.15%), Postives = 230/428 (53.74%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLE-ESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVP-------SPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERS-------DSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPA-----KYLIKKKAEDFLG 1251
            + R++KN+  NY++A+ KVREATSNDPWG S+ +MSEIA++TYNV+ F +IMQM+WKRLND  KNWRHVYKAL+L+EY+IKTGSEKVA +C+ENI  I+TL++F Y EEGKD G +VRE+AK +  LL+D +RL++ER+KA KAK R A +              ID   QR                 P   + P +S+SE    + +  PQT GEE +QLQLA+A+S+     E ++   +   +  ++++AL QS  + +    R   +         L  L+D SL     + P       +P  VV+        +   +SDPWS  + S QV     +      P  I+   +   S       D+  +   S +VAS  S + +   + + N+N      +PA      +LIK  A   LG
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGY-----IDGPSQR--------------DLPPGWQEEPPKSVSE----LEMVRPQTAGEEELQLQLAMAMSR----EEAEQEEAKRRSDDVRLQLALSQSEQDFKDPNGRPIPAPKKEEQQSHLLDLLDISLGATSISSPPLGAAGGAPTAVVDPWAMPGPRAPSQLSDPWSGTS-SPQVDPWNPSAA----PRTILGAGVPMTSAPLGAGNDAWGARTQSPSVASGSSNEGW--LQSNGNANQNGRGATPAGPPAEGWLIKSTAVGALG 401          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0331838)

HSP 1 Score: 236.498 bits (602), Expect = 5.252e-70
Identity = 159/428 (37.15%), Postives = 230/428 (53.74%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLE-ESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVP-------SPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERS-------DSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPA-----KYLIKKKAEDFLG 1251
            + R++KN+  NY++A+ KVREATSNDPWG S+ +MSEIA++TYNV+ F +IMQM+WKRLND  KNWRHVYKAL+L+EY+IKTGSEKVA +C+ENI  I+TL++F Y EEGKD G +VRE+AK +  LL+D +RL++ER+KA KAK R A +              ID   QR                 P   + P +S+SE    + +  PQT GEE +QLQLA+A+S+     E ++   +   +  ++++AL QS  + +    R   +         L  L+D SL     + P       +P  VV+        +   +SDPWS  + S QV     +      P  I+   +   S       D+  +   S +VAS  S + +   + + N+N      +PA      +LIK  A   LG
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGY-----IDGPSQR--------------DLPPGWQEEPPKSVSE----LEMVRPQTAGEEELQLQLAMAMSR----EEAEQEEAKRRSDDVRLQLALSQSEQDFKDPNGRPIPAPKKEEQQSHLLDLLDISLGATSISSPPLGAAGGAPTAVVDPWAMPGPRAPSQLSDPWSGTS-SPQVDPWNPSAA----PRTILGAGVPMTSAPLGAGNDAWGARTQSPSVASGSSNEGW--LQSNGNANQNGRGATPAGPPAEGWLIKSTAVGALG 401          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0112941)

HSP 1 Score: 236.498 bits (602), Expect = 5.650e-70
Identity = 159/428 (37.15%), Postives = 230/428 (53.74%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLE-ESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVP-------SPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERS-------DSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPA-----KYLIKKKAEDFLG 1251
            + R++KN+  NY++A+ KVREATSNDPWG S+ +MSEIA++TYNV+ F +IMQM+WKRLND  KNWRHVYKAL+L+EY+IKTGSEKVA +C+ENI  I+TL++F Y EEGKD G +VRE+AK +  LL+D +RL++ER+KA KAK R A +              ID   QR                 P   + P +S+SE    + +  PQT GEE +QLQLA+A+S+     E ++   +   +  ++++AL QS  + +    R   +         L  L+D SL     + P       +P  VV+        +   +SDPWS  + S QV     +      P  I+   +   S       D+  +   S +VAS  S + +   + + N+N      +PA      +LIK  A   LG
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGY-----IDGPSQR--------------DLPPGWQEEPPKSVSE----LEMVRPQTAGEEELQLQLAMAMSR----EEAEQEEAKRRSDDVRLQLALSQSEQDFKDPNGRPIPAPKKEEQQSHLLDLLDISLGATSISSPPLGAAGGAPTAVVDPWAMPGPRAPSQLSDPWSGTS-SPQVDPWNPSAA----PRTILGAGVPMTSAPLGAGNDAWGARTQSPSVASGSSNEGW--LQSNGNANQNGRGATPAGPPAEGWLIKSTAVGALG 401          
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0331837)

HSP 1 Score: 236.113 bits (601), Expect = 1.019e-68
Identity = 159/428 (37.15%), Postives = 230/428 (53.74%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLE-ESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVP-------SPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERS-------DSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPA-----KYLIKKKAEDFLG 1251
            + R++KN+  NY++A+ KVREATSNDPWG S+ +MSEIA++TYNV+ F +IMQM+WKRLND  KNWRHVYKAL+L+EY+IKTGSEKVA +C+ENI  I+TL++F Y EEGKD G +VRE+AK +  LL+D +RL++ER+KA KAK R A +              ID   QR                 P   + P +S+SE    + +  PQT GEE +QLQLA+A+S+     E ++   +   +  ++++AL QS  + +    R   +         L  L+D SL     + P       +P  VV+        +   +SDPWS  + S QV     +      P  I+   +   S       D+  +   S +VAS  S + +   + + N+N      +PA      +LIK  A   LG
Sbjct:    8 LRRNIKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRLNDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGY-----IDGPSQR--------------DLPPGWQEEPPKSVSE----LEMVRPQTAGEEELQLQLAMAMSR----EEAEQEEAKRRSDDVRLQLALSQSEQDFKDPNGRPIPAPKKEEQQSHLLDLLDISLGATSISSPPLGAAGGAPTAVVDPWAMPGPRAPSQLSDPWSGTS-SPQVDPWNPSAA----PRTILGAGVPMTSAPLGAGNDAWGARTQSPSVASGSSNEGW--LQSNGNANQNGRGATPAGPPAEGWLIKSTAVGALG 401          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 253.062 bits (645), Expect = 3.670e-77
Identity = 174/447 (38.93%), Postives = 241/447 (53.91%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQL-VD------TSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQV---GQQRSNCVSPDWPLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDI---HPGSTNPFATG 1326
            I R +KNVV NY+E E KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +C+ENI  I+TLKDFQY++ +GKD G+NVRE++K +  LL+D DRL+ ER +ALK K R+A        +N    G    Q     S          S +  +   SP  S SE    +  A PQT GEE +QLQLALA+S+       ++       +  +++MALE+SR + S  K  +K     +     F + VD      ++ S  PA    PW +       +S++ +  +DPW + +  +     G   +   S D       PN S R D    F   D++ SS  P + +   +   S+       P     +K  E FLG +  LV+++ LV         +NPF  G
Sbjct:    6 IRRQMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNNQIGFGRGSSQPNLSTSYSEEYGKSEGSPASYHGSTSPNAS-SE----LEQARPQTSGEEELQLQLALAMSR----EAAEQEERMRRGDDLRLQMALEESRKDTSTGKVSKKKKEVGTDQTECFSVSVDLHLWPRSTFSPKPAAPVDPWGL---PGASSSATPVKSTDPWGSSSAPAAADPWGPMPATLGSFDL---FSTPNGSSRED----FSEFDSIRSSALPSQAS---LSIGSDLFEVPSGP----TRKTPESFLGPNAALVNLDSLVSKPLQQAPVSNPFLAG 426          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 248.054 bits (632), Expect = 1.191e-74
Identity = 156/375 (41.60%), Postives = 208/375 (55.47%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDP-NISERSDSATSFEISDTVASSQSP 1146
            I R +KNVV NY+E E KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +C+ENI  I+TLKDFQY++ +GKD G+NVRE++K +  LL+D DRL+ ER +ALK K R+A        +N    G    Q     S          S +  +   SP  S SE    +  A PQT GEE +QLQLALA+S+       ++       +  +++MALE+SR + S  K  +K      P  +L  L+D            PW          +      SDPW ++  + +             P   VDP  +   S SAT  + +D   SS +P
Sbjct:    6 IRRQMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNNQIGFGRGSSQPNLSTSYSEEYGKSEGSPASYHGSTSPNAS-SE----LEQARPQTSGEEELQLQLALAMSR----EAAEQEERMRRGDDLRLQMALEESRKDTSTGKVSKKK--KEPPQSSLMDLMDAVPEGHANQGTDPWGAGAAAAAGPT------SDPWQSYGAAPK-------------PAAPVDPWGLPGASSSATPVKSTDPWGSSSAP 350          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 240.35 bits (612), Expect = 1.422e-74
Identity = 147/348 (42.24%), Postives = 200/348 (57.47%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIV 1068
            I R +KNVV NY+E E KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +C+ENI  I+TLKDFQY++ +GKD G+NVRE++K +  LL+D DRL+ ER +ALK K R+A        +N    G    Q     S          S +  +   SP  S SE    +  A PQT GEE +QLQLALA+S+       ++       +  +++MALE+SR + S  K  +K      P  +L  L+D            PW          +++    SDPW ++       ++     +  WPL+ +
Sbjct:    6 IRRQMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNNQIGFGRGSSQPNLSTSYSEEYGKSEGSPASYHGSTSPNAS-SE----LEQARPQTSGEEELQLQLALAMSR----EAAEQEERMRRGDDLRLQMALEESRKDTSTGKVSKKK--KEPPQSSLMDLMDAVPEGHANQGTDPWGAG------AAAAAGPTSDPWQSYGKHRHTHKE----FAFSWPLYFL 332          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 240.35 bits (612), Expect = 7.334e-72
Identity = 132/264 (50.00%), Postives = 172/264 (65.15%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEES 816
            I R +KNVV NY+E E KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +C+ENI  I+TLKDFQY++ +GKD G+NVRE++K +  LL+D DRL+ ER +ALK K R+A        +N    G    Q     S          S +  +   SP  S SE    +  A PQT GEE +QLQLALA+S+       ++       +  +++MALE+SR + S
Sbjct:    6 IRRQMKNVVNNYSEPEKKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNNQIGFGRGSSQPNLSTSYSEEYGKSEGSPASYHGSTSPNAS-SE----LEQARPQTSGEEELQLQLALAMSR----EAAEQEERMRRGDDLRLQMALEESRKDTS 260          
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Match: epn1 (epsin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2680])

HSP 1 Score: 231.491 bits (589), Expect = 6.009e-68
Identity = 101/150 (67.33%), Postives = 128/150 (85.33%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+VA +CRENI+ ++TLKDFQY++ +GKD GVNVRE+AK +  LL+D +RL++ERI ALK K ++A
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKEKMA 155          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 241.121 bits (614), Expect = 1.906e-71
Identity = 145/336 (43.15%), Postives = 197/336 (58.63%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAP-ANVPSPWDVVEEQHQD------TSSSLIAISDPWSNHNISS 1011
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+VA +C+ENI+ I+TLKDFQYV+ +GKD GVNVRE+AK + +LL+D +RL++ER  ALK K +LA ++  S  S+  +     +Q                          PQ S  E                 +QLQLALA+SKEE E+   +       +  +++MA+E+S+ +E+  K+ E+S        +L  L D     AP A    PW        D       +S+L A SDPW    +++
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHALKTKEKLAQTSTSSSASSTLNPATEAEQAW------------------------PQSSGEE----------------ELQLQLALAMSKEEAEQVRAKEERIRRGDDLRLQMAIEESK-KEAPSKQEEQS--------SLMDLADVFSPPAPVAASAGPWGASAAPPADPWAGGVATSTLPAASDPWGGPPVAT 292          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: epn2 (epsin2 [Source:NCBI gene;Acc:448609])

HSP 1 Score: 236.113 bits (601), Expect = 3.812e-70
Identity = 148/341 (43.40%), Postives = 203/341 (59.53%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSR-------LEESQRKRLEKSIATSSPSGT-LFQLVDT-SLSVAPANVPSPWDVVEE--------QHQDTSSSLIAISDPWSN 996
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+V+ +C+ENI  I+TLKDFQY++ +GKD G+NVRE++K +  LL+D +RL+ ER +ALK K R+A        +N  + G    Q     S                   +  R  SE    +  A PQT GEE +QLQLALA+S+E  E+E   RR +D     +++MALE+SR        +++Q++     +  + PSG    Q  DT + +VA  +   PW+V           Q   + +   A  DPW  
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVSHQCKENIFAIQTLKDFQYMDRDGKDQGINVREKSKQLVCLLKDDERLKGERAQALKTKERMAQVATGVSSNNQITFGRGSSQPNLSTSYSEQDYGKSGGSPASYHGSTSPRVSSE----LEQARPQTSGEEELQLQLALAMSREVAEQEERIRRGDDL----RLQMALEESRKHTIKAPRKKAQQQTTLLDLLDALPSGAPAPQKPDTWAAAVATKSKSDPWNVAAVSPSSSDPWQSFGSGTKTAAPQDPWGG 338          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 231.876 bits (590), Expect = 4.644e-68
Identity = 102/150 (68.00%), Postives = 128/150 (85.33%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+VA +C+ENI+ I+TLKDFQYV+ +GKD GVNVRE+AK + +LL+D +RL++ER  ALK K +LA
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHALKTKEKLA 155          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: epn2 (epsin2 [Source:NCBI gene;Acc:448609])

HSP 1 Score: 230.72 bits (587), Expect = 6.096e-68
Identity = 152/349 (43.55%), Postives = 209/349 (59.89%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQ--------KQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSR-------LEESQRKRLEKSIATSSPSGT-LFQLVDT-SLSVAPANVPSPWDVVEE--------QHQDTSSSLIAISDPWSN 996
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+V+ +C+ENI  I+TLKDFQY++ +GKD G+NVRE++K +  LL+D +RL+ ER +ALK K R+A        +N  + G    Q        +Q    S    +S            SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+E   RR +D     +++MALE+SR        +++Q++     +  + PSG    Q  DT + +VA  +   PW+V           Q   + +   A  DPW  
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVSHQCKENIFAIQTLKDFQYMDRDGKDQGINVREKSKQLVCLLKDDERLKGERAQALKTKERMAQVATGVSSNNQITFGRGSSQPNLSTSYSEQDYGKSGGSPASYHGFMCNVLAATSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQEERIRRGDDL----RLQMALEESRKHTIKAPRKKAQQQTTLLDLLDALPSGAPAPQKPDTWAAAVATKSKSDPWNVAAVSPSSSDPWQSFGSGTKTAAPQDPWGG 345          
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 231.491 bits (589), Expect = 9.627e-68
Identity = 102/150 (68.00%), Postives = 128/150 (85.33%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+VA +C+ENI+ I+TLKDFQYV+ +GKD GVNVRE+AK + +LL+D +RL++ER  ALK K +LA
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHALKTKEKLA 155          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 249.595 bits (636), Expect = 2.688e-75
Identity = 151/327 (46.18%), Postives = 204/327 (62.39%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPS-PWDVVEEQHQDTS-SSLIA---ISDPW 990
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER++ALK K R+A        +  +      Q       S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+E   RR +D     +++MALE+SR +  +  + +K   + S   TL  L+D   S  P    + PW      +Q       +A   I+DPW
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDL----RLQMALEESRRDTVKVPK-KKEPGSHSQQTTLLDLMDALPSSGPVTQKTEPWSAGASANQTNPWGGTVAPSNITDPW 322          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 247.669 bits (631), Expect = 1.817e-74
Identity = 151/332 (45.48%), Postives = 205/332 (61.75%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSG-----TLFQLVDTSLSVAPANVPS-PWDVVEEQHQDTS-SSLIA---ISDPW 990
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER++ALK K R+A        +  +      Q       S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+E   RR +D     +++MALE+SR +  +  + +++ A   P       TL  L+D   S  P    + PW      +Q       +A   I+DPW
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDL----RLQMALEESRRDTVKVPKKKEAKACCKPGSHSQQTTLLDLMDALPSSGPVTQKTEPWSAGASANQTNPWGGTVAPSNITDPW 328          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 247.669 bits (631), Expect = 2.376e-74
Identity = 147/340 (43.24%), Postives = 204/340 (60.00%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQA--------KIEMALEQSRLEESQRKRLEKSIATSSPSG-----TLFQLVDTSLSVAPANVPS-PWDVVEEQHQDTS-SSLIA---ISDPW 990
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER++ALK K R+A        +  +      Q       S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+  +  +     ++         +++MALE+SR +  +  + +++ A   P       TL  L+D   S  P    + PW      +Q       +A   I+DPW
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQSSESVQTARGSKEERLRRGDDLRLQMALEESRRDTVKVPKKKEAKACCKPGSHSQQTTLLDLMDALPSSGPVTQKTEPWSAGASANQTNPWGGTVAPSNITDPW 340          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 247.669 bits (631), Expect = 2.376e-74
Identity = 147/340 (43.24%), Postives = 204/340 (60.00%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQA--------KIEMALEQSRLEESQRKRLEKSIATSSPSG-----TLFQLVDTSLSVAPANVPS-PWDVVEEQHQDTS-SSLIA---ISDPW 990
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER++ALK K R+A        +  +      Q       S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+  +  +     ++         +++MALE+SR +  +  + +++ A   P       TL  L+D   S  P    + PW      +Q       +A   I+DPW
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQSSESVQTARGSKEERLRRGDDLRLQMALEESRRDTVKVPKKKEAKACCKPGSHSQQTTLLDLMDALPSSGPVTQKTEPWSAGASANQTNPWGGTVAPSNITDPW 340          
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Match: Epn1 (epsin 1 [Source:MGI Symbol;Acc:MGI:1333763])

HSP 1 Score: 230.72 bits (587), Expect = 3.098e-68
Identity = 101/149 (67.79%), Postives = 127/149 (85.23%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRL 471
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+V+ +C+EN++ ++TLKDFQYV+ +GKD GVNVRE+AK + ALLRD DRL++ER  ALK K +L
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKL 154          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Z1Z3|EPN2_RAT (Epsin-2 OS=Rattus norvegicus OX=10116 GN=Epn2 PE=1 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 7.062e-74
Identity = 152/332 (45.78%), Postives = 205/332 (61.75%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSG-----TLFQLVDTSLSVAP-ANVPSPWDVVEEQHQDTS-SSLIA---ISDPW 990
            I R +KN+V +Y+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER++ALK K R+A        +  +      Q    +  S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+E   RR +D     +++MALE+SR +  +  + ++  A   P       TL  L+D   S  P A    PW      +Q       +A   ISDPW
Sbjct:    6 IRRQMKNIVNSYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVRFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSISHSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDL----RLQMALEESRRDTVKVPKKKEVKACCKPGSHSQQTTLLDLMDALPSSGPVAQKTEPWSTGTPANQTNPWGGTVAPANISDPW 328          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8CHU3|EPN2_MOUSE (Epsin-2 OS=Mus musculus OX=10090 GN=Epn2 PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 1.662e-73
Identity = 147/340 (43.24%), Postives = 204/340 (60.00%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQA--------KIEMALEQSRLEESQRKRLEKSIATSSPSG-----TLFQLVDTSLSVAPANVPS-PWDVVEEQHQDTS-SSLIA---ISDPW 990
            I R +KN+V NY+EAE KVREATSNDPWG SS+LM+EIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +CRENI  I+TLKDFQY++ +GKD G+NVRE++K + ALL+D +RL+ ER++ALK K R+A        +  +      Q       S         S +  +   SP+ S SE    +  A PQT GEE +QLQLALA+S+E  E+  +  +     ++         +++MALE+SR +  +  + +++ A   P       TL  L+D   S  P    + PW      +Q       +A   I+DPW
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQALKTKERMAQVATGVGSNQITFGRGSSQPNLSTSYSEQEYGKAGGSPASYHGSTSPRVS-SE----LEQARPQTSGEEELQLQLALAMSREVAEQSSESVQTARGSKEERLRRGDDLRLQMALEESRRDTVKVPKKKEAKACCKPGSHSQQTTLLDLMDALPSSGPVTQKTEPWSAGASANQTNPWGGTVAPSNITDPW 340          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80VP1|EPN1_MOUSE (Epsin-1 OS=Mus musculus OX=10090 GN=Epn1 PE=1 SV=3)

HSP 1 Score: 230.72 bits (587), Expect = 2.404e-67
Identity = 101/149 (67.79%), Postives = 127/149 (85.23%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRL 471
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+V+ +C+EN++ ++TLKDFQYV+ +GKD GVNVRE+AK + ALLRD DRL++ER  ALK K +L
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKL 154          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y6I3|EPN1_HUMAN (Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2)

HSP 1 Score: 230.335 bits (586), Expect = 2.963e-67
Identity = 101/149 (67.79%), Postives = 127/149 (85.23%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRL 471
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+V+ +C+EN++ ++TLKDFQYV+ +GKD GVNVRE+AK + ALLRD DRL++ER  ALK K +L
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKL 154          
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Match: sp|O88339|EPN1_RAT (Epsin-1 OS=Rattus norvegicus OX=10116 GN=Epn1 PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 4.356e-67
Identity = 101/149 (67.79%), Postives = 127/149 (85.23%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRL 471
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+V+ +C+EN++ ++TLKDFQYV+ +GKD GVNVRE+AK + ALLRD DRL++ER  ALK K +L
Sbjct:    6 LRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKL 154          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: A0A4S2M6J9 (ENTH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002316 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 4.376e-105
Identity = 223/501 (44.51%), Postives = 288/501 (57.49%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRL---AXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKS--------------IATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTS---------------------------------SSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENS---NNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPGSTNPFATGKKSSLHG---NPF 1356
            MPIHRH+KNVV NYT+AE KVREATSNDPWG SSTLM+EIAD T+NVM F +IMQM+W+RLNDK+KNWRHVYKAL+L+EYIIKTGS+KVA +CRENIH+IETL+DF+Y E+GKD G NVR +A+++  LLRD +RL +ER KAL A+ RL         +  +    +  +  +     SS    + L     +P   KS   S +     +    PQ+ GEE +QLQLA+AISKEEHERE  RRR E+A+E+AK++M LEQSR EE Q     +S                TS+P G LF LVDTSLS APA+VP PW       Q +S                                 SS I I DPWS     +Q  Q  S      WP   V    S  ++ A S +  D + + +     +   +H  S   N+L EN +      ++   DFLGEH+ LVD+ +L++++P STNPFATG +    G   NPF
Sbjct:    1 MPIHRHIKNVVHNYTDAERKVREATSNDPWGPSSTLMAEIADKTHNVMAFTEIMQMIWRRLNDKSKNWRHVYKALVLLEYIIKTGSDKVATQCRENIHSIETLQDFEYFEDGKDHGHNVRAKARLLSGLLRDEERLHEERTKALLARDRLMHGGLGTTTTPATGSLFSSTLGTRGGSFPSSYPKTAYLEERSPVPIHSKSLYASSTNE---LDSVMPQSIGEEQLQLQLAIAISKEEHEREERRRRTEEAKEEAKVQMVLEQSRREEQQGLDQRQSQVTVTNNNAASTSMTPTSTPGGGLFSLVDTSLSAAPAHVPDPWSSPLGTLQSSSSNTIPTTTPTVTSSTLPMQQGLPPFSSDPSATVSSSIPIEDPWSTTAPDAQPPQSNS-----AWP---VAAPASSTANPAVSSDPFDFLGNHKPVASKSTNGVHPPSGVDNSLKENEA-----RRRTPADFLGEHQGLVDLEKLIEVNPTSTNPFATGLRPLTSGPSANPF 485          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: A0A504YX00 (Epsin-2 (EPS-15-interacting protein 2) (Intersectin-EH-binding protein 2) OS=Fasciola gigantica OX=46835 GN=FGIG_03267 PE=4 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 8.570e-105
Identity = 224/489 (45.81%), Postives = 293/489 (59.92%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSP-QRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQR----------KRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQ-------DTSSSLIAISDPWSNH---------NISSQVGQQRSNCVSPDWPLHIVDPNISERSDSA--------TSFEI----SDTVASSQSPDKFTGFKIHE-----NSNNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPGSTNPFATGKKSSLHGNPF 1356
            MPIHRH+KNVV NYT+AE KVREATSNDPWG SSTLM+EIAD T+NVM F +IMQM+W+RLND +KNWRHVYKAL+L+EYI KTGS+KVA +CRENIH+IETL+DF++ E+GKD G NVR +A+++ ALLRD +RL +ER KAL A+ RL +  + +  S+G S      Q  R   S     S       P   KSP  RS +E    +    PQ+ GEE +QLQLA+AISKEEH+RE  RRR E A+E+AK++MALEQSR E  +                S + +S  G LF LVDTSLS APA++P PW                +S++++ I DPWS           N+ S   Q  S      WP   V  NIS  + +A        + F++    ++   SS       GF  HE     N  +  E  +      ++   DFLGEH+ LVD+++L++I+P STNPFATG +S+   NPF
Sbjct:    1 MPIHRHIKNVVHNYTDAERKVREATSNDPWGPSSTLMAEIADKTHNVMAFTEIMQMIWRRLND-SKNWRHVYKALVLLEYITKTGSDKVATQCRENIHSIETLRDFEFFEDGKDHGHNVRAKARLLSALLRDEERLHEERTKALLARDRLMHGGLGTTLSSGGSPSRYPSQG-RSSLSHNYPESYFLEKRSPTHSKSPISRSANE----LDSVRPQSVGEEQLQLQLAIAISKEEHDREERRRRAEAAKEEAKVQMALEQSRREGQETFDSPPLITPASMSNASGSATSAGGGLFNLVDTSLSAAPAHIPDPWSTPAPSTSTAPAIAPSSSTTVLPIDDPWSTARSSDFPSAPNVVSASKQSSS-----AWPTEPV--NISASTSTALPAISSANSPFDLLSDGTNRGGSSSVTVNSNGFHAHETEKQTNGQSSEEQNARNAESHRRTPADFLGEHQRLVDLDKLIEINPASTNPFATGARSTTPVNPF 476          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: A0A4S2M6J6 (ENTH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002316 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 8.895e-105
Identity = 222/506 (43.87%), Postives = 289/506 (57.11%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRL---AXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLE-------------------KSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTS---------------------------------SSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENS---NNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPGSTNPFATGKKSSLHG---NPF 1356
            MPIHRH+KNVV NYT+AE KVREATSNDPWG SSTLM+EIAD T+NVM F +IMQM+W+RLNDK+KNWRHVYKAL+L+EYIIKTGS+KVA +CRENIH+IETL+DF+Y E+GKD G NVR +A+++  LLRD +RL +ER KAL A+ RL         +  +    +  +  +     SS    + L     +P   KS   S +     +    PQ+ GEE +QLQLA+AISKEEHERE  RRR E+A+E+AK++M LEQSR EE +R+  +                       TS+P G LF LVDTSLS APA+VP PW       Q +S                                 SS I I DPWS     +Q  Q  S      WP   V    S  ++ A S +  D + + +     +   +H  S   N+L EN +      ++   DFLGEH+ LVD+ +L++++P STNPFATG +    G   NPF
Sbjct:    1 MPIHRHIKNVVHNYTDAERKVREATSNDPWGPSSTLMAEIADKTHNVMAFTEIMQMIWRRLNDKSKNWRHVYKALVLLEYIIKTGSDKVATQCRENIHSIETLQDFEYFEDGKDHGHNVRAKARLLSGLLRDEERLHEERTKALLARDRLMHGGLGTTTTPATGSLFSSTLGTRGGSFPSSYPKTAYLEERSPVPIHSKSLYASSTNE---LDSVMPQSIGEEQLQLQLAIAISKEEHEREERRRRTEEAKEEAKVQMVLEQSRREEQERQAWQGLDQRQSQVTVTNNNAASTSMTPTSTPGGGLFSLVDTSLSAAPAHVPDPWSSPLGTLQSSSSNTIPTTTPTVTSSTLPMQQGLPPFSSDPSATVSSSIPIEDPWSTTAPDAQPPQSNS-----AWP---VAAPASSTANPAVSSDPFDFLGNHKPVASKSTNGVHPPSGVDNSLKENEA-----RRRTPADFLGEHQGLVDLEKLIEVNPTSTNPFATGLRPLTSGPSANPF 490          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: A0A1S8WT79 (ENTH domain protein OS=Opisthorchis viverrini OX=6198 GN=X801_06484 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 5.045e-103
Identity = 220/504 (43.65%), Postives = 292/504 (57.94%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRL---AXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQ---RKRLEKSIATSS-----------PSGTLFQLVDTSLSVAPANVPSPWD---------------------------------VVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERSDSATSFEI---SDTVASSQSPDKFTGFKIHENS---NNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPGSTNPFATGKKSSLHG---NPF 1356
            MPIHRH+KNVV NYT+AE KVREATSNDPWG SSTLM+EIAD T+NVM F +IMQM+W+RLNDK+KNWRHVYKAL+L+EYIIKTGS+KVA +CRENIH+IETL+DF+Y E+GKD G NVR +A+++  LLRD +RL +ER KAL A+ RL         +  +       +  +     SS    ++ +   S       P  + S      V+  PQ+ GEE +QLQLA+AISKEEHERE  RRR E+A+E+AK++M LEQSR EE Q   R++ + +++ ++           P G LF LVDTSLS APA+VP PW                                          T SS I I DPWS+   ++Q  Q  S      W + I   + +  + SA  F+       VAS+ +        +H  S   N+L EN +      ++   DFLGEH+ LVD+ +L++++P STNPFATG +    G   NPF
Sbjct:    1 MPIHRHIKNVVHNYTDAERKVREATSNDPWGPSSTLMAEIADKTHNVMAFTEIMQMIWRRLNDKSKNWRHVYKALVLLEYIIKTGSDKVATQCRENIHSIETLQDFEYFEDGKDHGHNVRAKARLLSGLLRDEERLHEERTKALLARDRLMHGGLGTTTTPATGSLFGSTLGTRGGSFPSSTYPKAAYLEERSPVPIHSKPLYASSTNELDSVM--PQSIGEEQLQLQLAIAISKEEHEREERRRRTEEAKEEAKVQMVLEQSRREEQQGLDRRQSQVTVSNNNAASTSVTSTSTPGGGLFSLVDTSLSAAPAHVPDPWSSPLGALESSTSSAVPTTTPTVTSSALPVQQSLPPFSRDPSATVSSSIPIEDPWSSTAPNTQPPQSNS-----AWSVEIPASSTAIPTVSADPFDFLGNHKPVASTST------NGVHPPSGVDNSLKENEA-----RRRTPADFLGEHQGLVDLEKLIEVNPTSTNPFATGLRPLTSGPSANPF 486          
BLAST of ENTH domain-containing protein vs. TrEMBL
Match: A0A068Y3H0 (Liquid facets OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 1.671e-101
Identity = 225/521 (43.19%), Postives = 292/521 (56.05%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIV----LACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPS-------------GTLFQLVDTSLSVAPANVPSPWDVV----EEQHQDTSSSLIAISDPWSNH--------NISSQVGQQRSNCVSPDW--------------------PLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIH-----------------------ENSNNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPGSTNPFATGKKSSLHG---NPFA 1359
            MP+ RH+KNVV+NYTEAE KVREATSNDPWG SSTLMSEIAD TYNV+ F +IMQM+W+RLNDK+KNWRHVYKAL+L+EYIIKTGS+KVA +CRENIH IETL DF YVE+GKD+G +VRE+A+ + +LLRD +RLQ+ER KAL A+ RL +   +   +  +S  +      R             +     R  S   SLS     I      A PQ+  EE +QLQLALAISKEEHERE+ +R +E+A+E  K++M LEQS+ EE  R     S+ + + S             G LF L+DTSLS APAN+P PW  +       + D S++LIA + P++N         N S  VG Q S  + P W                    P   +DP +   S S       +  +SS +P    GF I                        +N+   S + +      K+   DFLG+HK LVD+ +LVD +P STNPFAT  +  L G   NPF+
Sbjct:    2 MPLQRHIKNVVRNYTEAERKVREATSNDPWGPSSTLMSEIADRTYNVIAFTEIMQMIWRRLNDKSKNWRHVYKALILLEYIIKTGSDKVAVQCRENIHAIETLMDFYYVEDGKDVGNSVREKARCLNSLLRDEERLQEERGKALLARERLLHGGALGTSAAAASVYSPSLPFTR----------AGSTFGDDRRPSSQPSSLSAAIGGISSDLDSAQPQSYTEEQLQLQLALAISKEEHERELQKRHEEEAKEALKLQMVLEQSKREEQSRSAAASSLISEANSTGGGGSASMTGNGGGLFSLIDTSLSAAPANMPDPWSTIVPTTVPSNSDHSNALIAATLPFNNSAYRQSNNTNSSGGVGNQLS-LIDPAWTPKDPLQSQHSYTVPVANNNPWAALDP-VEAASPSTAPTLAQNGNSSSGNP----GFGIGPTANAVTTTAITTAPTAASATSSDNAATASTSATMVTPTRKRTPADFLGDHKGLVDLEKLVDRNPASTNPFATSMR-PLTGHSTNPFS 505          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 236.884 bits (603), Expect = 6.782e-71
Identity = 124/231 (53.68%), Postives = 159/231 (68.83%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISK 717
            I R +KNVV NY+EAE KVREATSNDPWG SS+LMSEI+D+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +C+ENI  I+TLKDFQY++ +GKD G+NVRE++K +  LL+D DRL+ ER +ALK K R+A        ++  + G    Q     S          S +  +   SP  S SE    +  A PQT GEE +QLQLALA+S+
Sbjct:    6 IRRQMKNVVNNYSEAEKKVREATSNDPWGPSSSLMSEISDLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVVLLKDDDRLKGERSQALKTKERMAQVATSVGSNHQINFGRGSSQPNLSTSYSEEYGRSEGSPASYHGSTSPNAS-SE----LEQARPQTSGEEELQLQLALAMSR 231          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: epn1 (epsin-1-like [Source:NCBI gene;Acc:103024066])

HSP 1 Score: 237.654 bits (605), Expect = 1.863e-70
Identity = 119/231 (51.52%), Postives = 153/231 (66.23%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISK 717
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+VA +CRENI+ ++TLKDFQY++ +GKD GVNVRE+AK +  LL+D +RL++ERI ALK K ++A ++  S   +    G +       Q                                   A PQ+ GEE +QLQLALA+SK
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKEKMAQTSSASSAPSAPGLGGVSSSTDGDQ-----------------------------------AWPQSSGEEDLQLQLALAMSK 201          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: epn3b (epsin-3-like [Source:NCBI gene;Acc:103023012])

HSP 1 Score: 220.705 bits (561), Expect = 2.921e-64
Identity = 98/150 (65.33%), Postives = 126/150 (84.00%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+T++V+ F ++M M+WKRLND  KNWRHVYKAL L++Y+ KTGSE+VA +CREN  TI+TL+DFQYV+ +G+D GVNVRE+AK + ALLRD +RL+ ER +ALK K R+A
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTFSVVAFSEVMAMVWKRLNDHGKNWRHVYKALTLLDYLAKTGSERVAQQCRENAFTIQTLRDFQYVDRDGRDQGVNVREKAKQLVALLRDEERLRQERAQALKTKERMA 155          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 219.55 bits (558), Expect = 7.873e-64
Identity = 95/150 (63.33%), Postives = 124/150 (82.67%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            + R +KN+V NYTEAE KVREATSNDPWG  S+LM EIAD+T+NV+ F ++M M+WKRLND  KNWRHVYKAL L+EY++K GSE+VA +CRENI+ I+TL+DFQY++ +G+D GVNVRE+AK + +LLRD DRL+ ER +A K + R+A
Sbjct:    6 LRRSVKNIVNNYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRLNDHGKNWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQAHKTRERMA 155          
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 219.935 bits (559), Expect = 9.341e-64
Identity = 95/150 (63.33%), Postives = 124/150 (82.67%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            + R +KN+V NYTEAE KVREATSNDPWG  S+LM EIAD+T+NV+ F ++M M+WKRLND  KNWRHVYKAL L+EY++K GSE+VA +CRENI+ I+TL+DFQY++ +G+D GVNVRE+AK + +LLRD DRL+ ER +A K + R+A
Sbjct:    6 LRRSVKNIVNNYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRLNDHGKNWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQAHKTRERMA 155          
BLAST of ENTH domain-containing protein vs. Ensembl Sea Lamprey
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 245.358 bits (625), Expect = 2.514e-74
Identity = 146/322 (45.34%), Postives = 189/322 (58.70%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPW 990
            + R +KN+V N++EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +C+ENI  I+TLKDFQYV+ +GKD GVNVRE++K + ALLRD DRL+ ER  ALK K RLA        +N  + G    Q     S          S +  +   S   S       +  A PQT GEE +QLQLALA+S+     E ++       +  +++MALE+S+  +   K+ E      S   +L  LVD      P     PW V             A +DPW
Sbjct:    6 LRRQMKNIVNNFSEAEVKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCKENIFAIQTLKDFQYVDRDGKDQGVNVREKSKQLVALLRDEDRLRGEREHALKTKERLAQGATGMGSNNKVTFGRGSSQPNLSTSYSDEYGKAGGSPASYHGYTSQHMSTQ-----LEQARPQTSGEEELQLQLALAMSR----EEAEQEERMRRGDDLRLQMALEESKRAKLAAKKEEVCACRHSRQSSLLDLVDAFRPTVPQPSADPWGVTPPPP--------AQADPW 310          
BLAST of ENTH domain-containing protein vs. Ensembl Sea Lamprey
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 130.954 bits (328), Expect = 9.911e-33
Identity = 65/143 (45.45%), Postives = 100/143 (69.93%), Query Frame = 1
Query:   46 NVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNK-NWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEE-GKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSR 468
            N+V NYTE E KVREAT+++PWG S  LM EIA  T+    F ++M MLW R+  +NK NWR  YK L+L+ Y+++ GSE+V    RE+++ + +L+D+ +V+E GKD GVNVR++ K +   ++D +R+++ER KA K + +
Sbjct:   15 NIVMNYTEMEAKVREATNDEPWGPSGKLMGEIAKATFMYELFPEVMNMLWARMLRENKNNWRRAYKGLLLLTYLLRNGSERVVTSAREHLYDLRSLEDYHFVDENGKDQGVNVRQKVKEMIDFVQDDERVREERKKAKKHRDK 157          
BLAST of ENTH domain-containing protein vs. Ensembl Yeast
Match: ENT3 (Protein containing an N-terminal epsin-like domain; involved in clathrin recruitment and traffic between the Golgi and endosomes; associates with the clathrin adaptor Gga2p [Source:SGD;Acc:S000003886])

HSP 1 Score: 137.502 bits (345), Expect = 2.662e-36
Identity = 67/141 (47.52%), Postives = 96/141 (68.09%), Query Frame = 1
Query:   34 RHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDK-NKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKA 450
            R  +NVV NYTE E KVREAT+N+PWGASSTLM +I+  TYN     +I+ M+++R  +K    WR +YKAL L++Y+IK GSE+     R +I+ I  L+ F Y++ +G+D G+NVR R K +  LL D ++++ ER KA
Sbjct:   20 RKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINVRTRVKALIELLSDDNKIRAERKKA 160          
BLAST of ENTH domain-containing protein vs. Ensembl Yeast
Match: ENT1 (Epsin-like protein involved in endocytosis and actin patch assembly; functionally redundant with Ent2p; binds clathrin via a clathrin-binding domain motif at C-terminus; relocalizes from bud neck to cytoplasm upon DNA replication stress; ENT1 has a paralog, ENT2, that arose from the whole genome duplication [Source:SGD;Acc:S000002320])

HSP 1 Score: 123.25 bits (308), Expect = 6.870e-31
Identity = 66/142 (46.48%), Postives = 93/142 (65.49%), Query Frame = 1
Query:   34 RHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYV-EEGKDLGVNVRERAKMICALLRDFDRLQDERIKALK 456
            R  KN+VK Y+  +  VR ATSND    S   + E+A+ +Y+   F +IM ML KRLNDK K WRH+ KAL +++Y+I+ GSE     CREN++ I+TLK+F++  +EG D G  VR +AK + ALL D +RL +ER   +K
Sbjct:    7 RSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKELTALLSDDERLNEERNMNIK 148          
BLAST of ENTH domain-containing protein vs. Ensembl Yeast
Match: ENT2 (Epsin-like protein required for endocytosis and actin patch assembly; functionally redundant with Ent1p; contains clathrin-binding motif at C-terminus; ENT2 has a paralog, ENT1, that arose from the whole genome duplication [Source:SGD;Acc:S000004196])

HSP 1 Score: 117.087 bits (292), Expect = 2.427e-28
Identity = 58/137 (42.34%), Postives = 91/137 (66.42%), Query Frame = 1
Query:   34 RHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEE-GKDLGVNVRERAKMICALLRDFDRLQDER 441
            R  KN++K Y+  +  VR+AT+ND    S   + ++A  +Y+ + F +IM ML KRLNDK K WRHV K+L +++Y+++ GSE     CREN + I+TL++F++  E G D G  +R +AK + +LL D +RL++ER
Sbjct:    7 RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKELVSLLNDEERLREER 143          
BLAST of ENTH domain-containing protein vs. Ensembl Yeast
Match: ENT4 (Protein of unknown function; contains an N-terminal epsin-like domain; proposed to be involved in the trafficking of Arn1p in the absence of ferrichrome [Source:SGD;Acc:S000003961])

HSP 1 Score: 62.003 bits (149), Expect = 2.725e-11
Identity = 43/121 (35.54%), Postives = 73/121 (60.33%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPW-GASSTLMSEIADMTYNVMYFVDIMQMLWKRL----NDKN--KNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKD 363
            MP+    K+ +++ TE+  KV++AT+ D   GA+ TLM+EI+ +TY+     +I+Q++ KRL    N +N  +N   V K L L+ Y++  GS +     + N+  IE L+DFQ V++ +D
Sbjct:    1 MPLLDTFKSFIQSPTES--KVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRNCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQ-VQDPRD 118          
BLAST of ENTH domain-containing protein vs. Ensembl Nematostella
Match: EDO36992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH59])

HSP 1 Score: 220.32 bits (560), Expect = 6.205e-70
Identity = 102/152 (67.11%), Postives = 127/152 (83.55%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            M I R LKNVV NY+ +E KVREATSNDPWG SS+LMSEIAD TYNV+ F +IM M+W+RLND  KNWRHVYK+L+L++YIIKTGSE+VA +CRENI  I+TLKDFQ+++ +GKD G+NVRE+AK + ALL+D +RL+ ER +ALKAK R A
Sbjct:    1 MSIRRQLKNVVNNYSNSEVKVREATSNDPWGPSSSLMSEIADATYNVVAFSEIMAMIWRRLNDHGKNWRHVYKSLVLLDYIIKTGSERVAQQCRENIFVIQTLKDFQFIDKDGKDQGMNVREKAKQLVALLKDEERLKSERQRALKAKERFA 152          
BLAST of ENTH domain-containing protein vs. Ensembl Nematostella
Match: EDO48788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIC8])

HSP 1 Score: 121.709 bits (304), Expect = 2.078e-32
Identity = 63/145 (43.45%), Postives = 98/145 (67.59%), Query Frame = 1
Query:   46 NVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKR-LNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEE-GKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            NVV NY+E E KVREAT++D WG   +LM EIA  T+   +F ++M MLWKR L +  K WR +YK+L+L+ Y++K GS++V    R++I+ +  L++F + +E GKD G+NVR + K +  L++D DR++ ER +A K + +  
Sbjct:   16 NVVMNYSEVEAKVREATNDDTWGPHGSLMQEIAKYTFTYEHFPEVMSMLWKRMLQEPKKYWRRIYKSLLLLGYLLKNGSDRVVTNARDHIYDMRQLENFHHTDENGKDQGINVRHKVKELIELVQDDDRIRSERKRAKKNRDKYT 160          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: epn2 (epsin 2 [Source:NCBI gene;Acc:101161060])

HSP 1 Score: 234.187 bits (596), Expect = 1.223e-69
Identity = 137/326 (42.02%), Postives = 186/326 (57.06%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHN 1002
            I R +KN+V NY++AE KVREATSNDPWG SS+LMSE+AD+TYNV+ F +IM M+WKRLND  KNWRHVYKAL L++Y+IKTGSE+VA +C+ENI  I+TLKDFQYV+ +GKD G+NVRE++K +  LL+D +RL+ ER +ALK K R+A  +  S         +    +  L +S                  +   + SE    +  A PQT GEE +QLQLALA+S+       ++       +  +++MALE+S+ E     +L K      P   L  L+D      P     PW                 +DPW  H 
Sbjct:    5 IRRQMKNMVNNYSDAEKKVREATSNDPWGPSSSLMSEVADLTYNVVAFSEIMNMIWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVALQCKENIFAIQTLKDFQYVDRDGKDQGINVREKSKQLVVLLKDEERLKAERSQALKTKERMAQVSTGSSQMGFGRGSS----QPNLSTSYSEEYGRSEGSPASYHGSTSPNAGSE----LEQARPQTSGEEELQLQLALAMSR----EAAEQEERIRRGDDLRLQMALEESKKEGPGSAKLAKK--KKEPQSALMDLMDVP---EPRATSDPWSARAGAGG-------GSADPWHAHG 306          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: epn1 (epsin-1 [Source:NCBI gene;Acc:101167232])

HSP 1 Score: 234.958 bits (598), Expect = 1.764e-69
Identity = 153/354 (43.22%), Postives = 200/354 (56.50%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMA-LEQSRLEESQRKRLE----------KSIATSSPS-GTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPD 1050
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+VA +CRENI+ ++TLKDFQY++ +GKD G+NVRE+AK +  LL+D ++L++ERI ALK K ++A                  Q      +          S    +    P++           A PQ+ GEE +QLQLALA+SKEE E+E   RR +D R Q  IE +  E+ + EES    L            ++A++ PS          S   APA    PW V       TS +    SDPW         G Q +    PD
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGLNVREKAKQLVTLLKDEEKLREERIHALKTKEKMA------------------QTSSASSAPSAPSLGGSLSLGSHSGGADPEQ-----------AWPQSSGEEDLQLQLALAMSKEEAEQEERLRRGDDLRLQMAIEESKKEKPKPEESALMELSAVDPWGAPATATVASAGPSPPPTVPGSAASNPWAPAASTDPWGV-------TSPTSPTSSDPWGG-------GPQPTVAPPPD 316          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: epn1 (epsin-1 [Source:NCBI gene;Acc:101167232])

HSP 1 Score: 233.417 bits (594), Expect = 1.126e-68
Identity = 117/231 (50.65%), Postives = 153/231 (66.23%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISK 717
            + R +KN+V NY+EAE KVREATSNDPWG SS+LMSEIAD+TYNV+ F +IM M+WKRLND  KNWRHVYKA+ LMEY+IKTGSE+VA +CRENI+ ++TLKDFQY++ +GKD G+NVRE+AK +  LL+D ++L++ERI ALK K ++A                  Q      +          S    +    P++           A PQ+ GEE +QLQLALA+SK
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGLNVREKAKQLVTLLKDEEKLREERIHALKTKEKMA------------------QTSSASSAPSAPSLGGSLSLGSHSGGADPEQ-----------AWPQSSGEEDLQLQLALAMSK 207          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: epn3a (epsin-1 [Source:NCBI gene;Acc:101168623])

HSP 1 Score: 210.69 bits (535), Expect = 1.289e-60
Identity = 91/150 (60.67%), Postives = 123/150 (82.00%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            I R +KN V +YT+AE KVREAT NDPWG   +LMSEI+D+T+NV+ F DIM+++WKRLND  KNWRHV+KAL+L+E+++KTGSE+V   C+ENIH+I+TLKDFQY++ +G D G  VRE+AK + +LLRD ++L+ ER  ALK+KSR+A
Sbjct:    6 IRRQMKNAVHSYTDAEIKVREATCNDPWGPPVSLMSEISDLTFNVVAFADIMRIIWKRLNDNGKNWRHVFKALVLLEHLVKTGSERVVKACKENIHSIQTLKDFQYIDRDGHDQGATVREKAKRLASLLRDEEKLKKERSHALKSKSRVA 155          
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Match: epn3a (epsin-1 [Source:NCBI gene;Acc:101168623])

HSP 1 Score: 210.69 bits (535), Expect = 1.295e-60
Identity = 91/150 (60.67%), Postives = 123/150 (82.00%), Query Frame = 1
Query:   28 IHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVE-EGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLA 474
            I R +KN V +YT+AE KVREAT NDPWG   +LMSEI+D+T+NV+ F DIM+++WKRLND  KNWRHV+KAL+L+E+++KTGSE+V   C+ENIH+I+TLKDFQY++ +G D G  VRE+AK + +LLRD ++L+ ER  ALK+KSR+A
Sbjct:    6 IRRQMKNAVHSYTDAEIKVREATCNDPWGPPVSLMSEISDLTFNVVAFADIMRIIWKRLNDNGKNWRHVFKALVLLEHLVKTGSERVVKACKENIHSIQTLKDFQYIDRDGHDQGATVREKAKRLASLLRDEEKLKKERSHALKSKSRVA 155          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000055467.1 (SMESG000055467.1)

HSP 1 Score: 501.516 bits (1290), Expect = 1.729e-177
Identity = 301/303 (99.34%), Postives = 302/303 (99.67%), Query Frame = 1
Query:  394 MICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPG 1302
            MICALLRDFDRLQDERIKALKAKSRLANSNVVSFGSNGSSNGAIDQQKQRLQSSPIGISSLIRSGSLPNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKEEHEREIDRRRDEDAREQAKIEMALEQSRLEESQ KRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQ+GQQRSNCVSPDWPLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPG
Sbjct:    1 MICALLRDFDRLQDERIKALKAKSRLANSNVVSFGSNGSSNGAIDQQKQRLQSSPIGISSLIRSGSLPNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKEEHEREIDRRRDEDAREQAKIEMALEQSRLEESQLKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQLGQQRSNCVSPDWPLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPG 303          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000055467.1 (SMESG000055467.1)

HSP 1 Score: 487.263 bits (1253), Expect = 7.622e-172
Identity = 296/303 (97.69%), Postives = 297/303 (98.02%), Query Frame = 1
Query:  394 MICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPG 1302
            MICALLRDFDRLQDERIKALKAKSRLANSNVVSFGSNGSSNGAIDQQKQRLQSSPIGISSLIRSGSLPNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKEEHEREIDRRRDEDAREQAKIEMALEQSRLEE      EKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQ+GQQRSNCVSPDWPLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPG
Sbjct:    1 MICALLRDFDRLQDERIKALKAKSRLANSNVVSFGSNGSSNGAIDQQKQRLQSSPIGISSLIRSGSLPNRCKSPQRSLSERPYPIVLACPQTEGEEHIQLQLALAISKEEHEREIDRRRDEDAREQAKIEMALEQSRLEE------EKSIATSSPSGTLFQLVDTSLSVAPANVPSPWDVVEEQHQDTSSSLIAISDPWSNHNISSQLGQQRSNCVSPDWPLHIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPAKYLIKKKAEDFLGEHKNLVDVNRLVDIHPG 297          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000042233.1 (SMESG000042233.1)

HSP 1 Score: 221.476 bits (563), Expect = 4.069e-65
Identity = 181/495 (36.57%), Postives = 252/495 (50.91%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYP---IVLACPQTEGE-EHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQL-VDTS---LSVAPANVPS----------PWDVVEEQHQDTSSSL-IAISDPWSNHN-------ISSQVGQQRSNC-VSPDWPL-----------HIVDPNISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSE----NCSPAKYL-------IKKKAEDFLGEHKNLVDVNRLVDIHPG-STNPFATGKKSSLHGNPF 1356
            M I R +KNVV  Y+EAE  VREATSNDPWG SSTLMSEIADMT +   F DIMQ++WKRLNDK KNWRHVYK+L+L++Y++K G+E++A  C +NIHTIETLKDFQY EE KDLGV +RE++K +  LL+D + L +ER K LK K +  N             G + ++ ++                         +   +  +P   + L   +T+ E E  +LQ A+ +SKEEHER +  R+DE+ RE+ KI++ALEQS+ EE   K  E S      +G L  L VDT          NV S          PW   +     + + +  +  D W N +       +    G ++ N   + +W              I+D N  E SDS+      +T  S  S        + +  N+LS     +CS    L        KK  ++FLGE+ NLV++  LV I    + NPF     S++  NPF
Sbjct:    1 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRK-------------------------QFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEELYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPDVWLNKDSRQSKNIVDDIFGDEKPNTQFASNWNFDVNGLTPSNQNKIIDSNPWEESDSSFGQLTKNTTGSLAS--------LTDIGNDLSREKKHSCSVTDLLDTNTSTNKKKTPQEFLGENANLVNLENLVPIPKAVAKNPFGM-TASAVVSNPF 461          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000042233.1 (SMESG000042233.1)

HSP 1 Score: 208.764 bits (530), Expect = 3.754e-60
Identity = 145/369 (39.30%), Postives = 206/369 (55.83%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYP---IVLACPQTEGE-EHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEE------------SQRKRLEKSIATSSPSGTLFQLVDTS---------LSVAPANVPS-PWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPD 1050
            M I R +KNVV  Y+EAE  VREATSNDPWG SSTLMSEIADMT +   F DIMQ++WKRLNDK KNWRHVYK+L+L++Y++K G+E++A  C +NIHTIETLKDFQY EE KDLGV +RE++K +  LL+D + L +ER K LK K +  N             G + ++ ++                         +   +  +P   + L   +T+ E E  +LQ A+ +SKEEHER +  R+DE+ RE+ KI++ALEQS+ EE            S ++  E  ++ S+   +L++L + S         LS    +  S PW       +   SS+    DPW + + +    +   N  +PD
Sbjct:    1 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRK-------------------------QFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPD 344          
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Match: SMESG000042233.1 (SMESG000042233.1)

HSP 1 Score: 208.379 bits (529), Expect = 6.910e-60
Identity = 145/369 (39.30%), Postives = 206/369 (55.83%), Query Frame = 1
Query:   22 MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYFVDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTIETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRLAXXXXXXXXXXXXXXXAIDQQKQRLQXXXXXXXXXXXXXXXXNRCKSPQRSLSERPYP---IVLACPQTEGE-EHIQLQLALAISKXXXXXXXXXXXXXXXXXQAKIEMALEQSRLEE------------SQRKRLEKSIATSSPSGTLFQLVDTS---------LSVAPANVPS-PWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPD 1050
            M I R +KNVV  Y+EAE  VREATSNDPWG SSTLMSEIADMT +   F DIMQ++WKRLNDK KNWRHVYK+L+L++Y++K G+E++A  C +NIHTIETLKDFQY EE KDLGV +RE++K +  LL+D + L +ER K LK K +  N             G + ++ ++                         +   +  +P   + L   +T+ E E  +LQ A+ +SKEEHER +  R+DE+ RE+ KI++ALEQS+ EE            S ++  E  ++ S+   +L++L + S         LS    +  S PW       +   SS+    DPW + + +    +   N  +PD
Sbjct:    1 MEIRRKVKNVVYKYSEAEKYVREATSNDPWGPSSTLMSEIADMTNSYSAFDDIMQLIWKRLNDKGKNWRHVYKSLVLLDYLVKCGNERIAEECLQNIHTIETLKDFQYFEEHKDLGVGIREKSKALVILLKDKEILTNERSKGLKVKEKFQNKQSSIGSHQHRRPGELGREIRK-------------------------QFTKDNQFPRTVMKLNFEETKSEIEDDELQRAIELSKEEHERAMKIRQDEERREELKIKLALEQSKKEEEVLAVLRPPPKVSDKQNNETLLSKSAKRDSLYKLSEASRIFDQQNGDLSSLDVDTKSDPWGATATNVKSQDSSIPLDFDPWKSPDNNFGSSKTPMNTSTPD 344          
The following BLAST results are available for this feature:
BLAST of ENTH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPN21.558e-7545.90epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639][more]
EPN29.577e-7545.90epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639][more]
EPN29.577e-7545.90epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639][more]
EPN21.686e-7445.57epsin 2 [Source:HGNC Symbol;Acc:HGNC:18639][more]
EPN12.166e-6842.20epsin 1 [Source:HGNC Symbol;Acc:HGNC:21604][more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
epn-11.179e-7036.15EPsiN (Endocytic protein) homolog [Source:UniProt... [more]
epn-14.144e-7035.79EPsiN (Endocytic protein) homolog [Source:UniProt... [more]
rsd-35.501e-2536.55pep chromosome:WBcel235:X:11798505:11803656:1 gene... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lqf5.110e-7037.15gene:FBgn0028582 transcript:FBtr0331835[more]
lqf5.252e-7037.15gene:FBgn0028582 transcript:FBtr0331833[more]
lqf5.252e-7037.15gene:FBgn0028582 transcript:FBtr0331838[more]
lqf5.650e-7037.15gene:FBgn0028582 transcript:FBtr0112941[more]
lqf1.019e-6837.15gene:FBgn0028582 transcript:FBtr0331837[more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epn23.670e-7738.93epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn21.191e-7441.60epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn21.422e-7442.24epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn27.334e-7250.00epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn16.009e-6867.33epsin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2680][more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uvssa1.906e-7143.15UV stimulated scaffold protein A [Source:Xenbase;A... [more]
epn23.812e-7043.40epsin2 [Source:NCBI gene;Acc:448609][more]
uvssa4.644e-6868.00UV stimulated scaffold protein A [Source:Xenbase;A... [more]
epn26.096e-6843.55epsin2 [Source:NCBI gene;Acc:448609][more]
uvssa9.627e-6868.00UV stimulated scaffold protein A [Source:Xenbase;A... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epn22.688e-7546.18epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
Epn21.817e-7445.48epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
Epn22.376e-7443.24epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
Epn22.376e-7443.24epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
Epn13.098e-6867.79epsin 1 [Source:MGI Symbol;Acc:MGI:1333763][more]
back to top
BLAST of ENTH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z1Z3|EPN2_RAT7.062e-7445.78Epsin-2 OS=Rattus norvegicus OX=10116 GN=Epn2 PE=1... [more]
sp|Q8CHU3|EPN2_MOUSE1.662e-7343.24Epsin-2 OS=Mus musculus OX=10090 GN=Epn2 PE=1 SV=1[more]
sp|Q80VP1|EPN1_MOUSE2.404e-6767.79Epsin-1 OS=Mus musculus OX=10090 GN=Epn1 PE=1 SV=3[more]
sp|Q9Y6I3|EPN1_HUMAN2.963e-6767.79Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2[more]
sp|O88339|EPN1_RAT4.356e-6767.79Epsin-1 OS=Rattus norvegicus OX=10116 GN=Epn1 PE=1... [more]
back to top
BLAST of ENTH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M6J94.376e-10544.51ENTH domain-containing protein OS=Opisthorchis fel... [more]
A0A504YX008.570e-10545.81Epsin-2 (EPS-15-interacting protein 2) (Intersecti... [more]
A0A4S2M6J68.895e-10543.87ENTH domain-containing protein OS=Opisthorchis fel... [more]
A0A1S8WT795.045e-10343.65ENTH domain protein OS=Opisthorchis viverrini OX=6... [more]
A0A068Y3H01.671e-10143.19Liquid facets OS=Echinococcus multilocularis OX=62... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epn26.782e-7153.68epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
epn11.863e-7051.52epsin-1-like [Source:NCBI gene;Acc:103024066][more]
epn3b2.921e-6465.33epsin-3-like [Source:NCBI gene;Acc:103023012][more]
epn3a7.873e-6463.33epsin 3 [Source:NCBI gene;Acc:103029089][more]
epn3a9.341e-6463.33epsin 3 [Source:NCBI gene;Acc:103029089][more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
epn22.514e-7445.34epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
clint1a9.911e-3345.45clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
ENT32.662e-3647.52Protein containing an N-terminal epsin-like domain... [more]
ENT16.870e-3146.48Epsin-like protein involved in endocytosis and act... [more]
ENT22.427e-2842.34Epsin-like protein required for endocytosis and ac... [more]
ENT42.725e-1135.54Protein of unknown function; contains an N-termina... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO369926.205e-7067.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487882.078e-3243.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ENTH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epn21.223e-6942.02epsin 2 [Source:NCBI gene;Acc:101161060][more]
epn11.764e-6943.22epsin-1 [Source:NCBI gene;Acc:101167232][more]
epn11.126e-6850.65epsin-1 [Source:NCBI gene;Acc:101167232][more]
epn3a1.289e-6060.67epsin-1 [Source:NCBI gene;Acc:101168623][more]
epn3a1.295e-6060.67epsin-1 [Source:NCBI gene;Acc:101168623][more]
back to top
BLAST of ENTH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055467.11.729e-17799.34SMESG000055467.1[more]
SMESG000055467.17.622e-17297.69SMESG000055467.1[more]
SMESG000042233.14.069e-6536.57SMESG000042233.1[more]
SMESG000042233.13.754e-6039.30SMESG000042233.1[more]
SMESG000042233.16.910e-6039.30SMESG000042233.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000393 ID=SMED30000393|Name=ENTH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1573bp
TCTATATAAATCTTATATGAGATGCCAATTCATCGGCATTTAAAAAATGT
TGTTAAAAATTACACAGAAGCTGAATGTAAAGTGCGAGAAGCTACATCTA
ACGATCCATGGGGTGCTTCCAGCACTTTAATGTCAGAGATAGCTGATATG
ACGTACAACGTTATGTATTTTGTTGATATTATGCAAATGTTATGGAAAAG
ATTAAATGATAAGAATAAAAATTGGCGACATGTGTATAAAGCTTTGATGT
TAATGGAATATATTATTAAAACCGGTAGTGAAAAAGTCGCAGCCCGTTGC
CGCGAAAATATTCACACTATCGAAACACTAAAAGATTTTCAATACGTTGA
AGAAGGGAAAGATCTTGGCGTGAACGTGCGAGAACGAGCTAAAATGATTT
GTGCTCTTTTACGAGATTTTGATAGACTGCAAGATGAACGAATCAAAGCA
CTGAAAGCAAAGTCTCGATTGGCCAATTCAAACGTCGTTTCATTTGGCTC
AAATGGATCAAGCAATGGAGCGATCGATCAACAAAAACAGCGATTGCAAT
CGTCACCGATCGGAATTTCTAGTCTTATTCGAAGCGGATCTCTACCAAAT
AGATGCAAATCACCACAAAGAAGTTTATCGGAACGGCCATATCCAATTGT
GCTGGCTTGCCCACAAACTGAGGGCGAGGAACATATTCAATTGCAGCTTG
CACTGGCAATCAGCAAAGAGGAACACGAACGGGAAATCGACAGGAGAAGA
GATGAGGATGCTCGAGAGCAAGCCAAAATTGAGATGGCATTGGAACAGAG
CAGATTAGAGGAGAGCCAACGAAAACGATTGGAGAAATCTATTGCTACCT
CATCACCGAGCGGGACTTTATTCCAGTTAGTCGATACTTCATTATCGGTT
GCACCAGCCAATGTACCAAGTCCTTGGGATGTGGTTGAGGAGCAACACCA
GGATACCTCATCATCATTAATTGCTATCTCAGATCCATGGTCAAATCATA
ATATATCGAGTCAAGTGGGTCAACAGCGAAGCAACTGTGTCAGTCCAGAT
TGGCCGTTGCATATTGTTGATCCGAATATTTCCGAACGAAGTGACAGTGC
TACCTCATTCGAAATCAGCGATACAGTCGCCTCTAGTCAATCGCCAGATA
AATTTACTGGATTTAAAATCCATGAAAACTCGAATAATTTAAGTGAAAAT
TGCTCTCCAGCAAAATATCTGATTAAGAAAAAGGCCGAAGATTTCCTTGG
AGAGCATAAAAATTTGGTAGATGTCAACCGATTGGTTGACATTCATCCGG
GTTCAACAAATCCGTTTGCAACTGGGAAAAAATCATCACTCCATGGGAAT
CCATTTGCACAGTGTCAGAATGAAAATCATTTGCCTCTTAACCAACTGAA
CCATAACAATAGCGAAGATGTCGTCACCTTGTCCTGTGAGGCATGGCCGT
CAGACATCAATCTGCCCATTGCTAGTCATCAACAGCCGTTGAATCCGTTT
TTATAATACTTTTGCAATCATTCAATCATTTTGATTTGTTTTGTACATTA
TTTCTAATAAATTTCGACTGCCA
back to top

protein sequence of SMED30000393-orf-1

>SMED30000393-orf-1 ID=SMED30000393-orf-1|Name=SMED30000393-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=495bp
MPIHRHLKNVVKNYTEAECKVREATSNDPWGASSTLMSEIADMTYNVMYF
VDIMQMLWKRLNDKNKNWRHVYKALMLMEYIIKTGSEKVAARCRENIHTI
ETLKDFQYVEEGKDLGVNVRERAKMICALLRDFDRLQDERIKALKAKSRL
ANSNVVSFGSNGSSNGAIDQQKQRLQSSPIGISSLIRSGSLPNRCKSPQR
SLSERPYPIVLACPQTEGEEHIQLQLALAISKEEHEREIDRRRDEDAREQ
AKIEMALEQSRLEESQRKRLEKSIATSSPSGTLFQLVDTSLSVAPANVPS
PWDVVEEQHQDTSSSLIAISDPWSNHNISSQVGQQRSNCVSPDWPLHIVD
PNISERSDSATSFEISDTVASSQSPDKFTGFKIHENSNNLSENCSPAKYL
IKKKAEDFLGEHKNLVDVNRLVDIHPGSTNPFATGKKSSLHGNPFAQCQN
ENHLPLNQLNHNNSEDVVTLSCEAWPSDINLPIASHQQPLNPFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR027319Epsin-2_metazoa
IPR013809ENTH
IPR003903UIM_dom
IPR008942ENTH_VHS
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0030128clathrin coat of endocytic vesicle
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0030100regulation of endocytosis
Vocabulary: molecular function
TermDefinition
GO:0008289lipid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 108..149
NoneNo IPR availablePANTHERPTHR12276EPSIN/ENT-RELATEDcoord: 2..250
IPR027319Epsin-2, metazoaPANTHERPTHR12276:SF50EPSIN-2coord: 2..250