Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

Overview
NameMembrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
Smed IDSMED30000377
Length (bp)2569
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (SMED30000377) t-SNE clustered cells

Violin plots show distribution of expression levels for Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (SMED30000377) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (SMED30000377) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (SMED30000377) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000377

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30000377SMESG000026494.1 dd_Smed_v4_5498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000377SMESG000026494.1 dd_Smed_v4_5498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000377SMESG000026494.1 dd_Smed_v4_5498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000377SMESG000026494.1 dd_Smed_v4_5498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000377SMESG000026494.1 dd_Smed_v4_5498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000377SMESG000026494.1 dd_Smed_v4_5498_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000377SMESG000026494.1 Contig20334newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000377SMESG000026494.1 Contig20334uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000377SMESG000026494.1 Contig45616newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000377SMESG000026494.1 Contig45616uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30000377SMESG000026494.1 dd_Smed_v6_5498_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30000377SMESG000026494.1 dd_Smed_v4_5498_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Human
Match: MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:HGNC Symbol;Acc:HGNC:18957])

HSP 1 Score: 119.783 bits (299), Expect = 4.825e-27
Identity = 122/452 (26.99%), Postives = 185/452 (40.93%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         +   T+LI  I    F +  +     I  +      P      P I    P N P F PA H  S    DST+ F P                               PD +   +K+  I  S   + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  202 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------IGSETSLI--IHRGGFFS-PWKTPKPIMDRWENQGSPQTSLSAPAI----PQNLP-FPPALHRSSF--PDSTEAFDPRK-----------------------------PDPYELYEKSRAIYESPDYKELDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 599          

HSP 2 Score: 55.4546 bits (132), Expect = 4.014e-7
Identity = 98/475 (20.63%), Postives = 168/475 (35.37%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF----IPDTFYESKKTNTIKYS-----QPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++       + +     + P +          L L             RQD     +       RQ P  Y  P      D  Q P       P   Y     +T +Y      QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  368 KELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 820          

HSP 3 Score: 53.5286 bits (127), Expect = 1.862e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:   34 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 117          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Human
Match: MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:HGNC Symbol;Acc:HGNC:18957])

HSP 1 Score: 119.783 bits (299), Expect = 5.042e-27
Identity = 122/452 (26.99%), Postives = 185/452 (40.93%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         +   T+LI  I    F +  +     I  +      P      P I    P N P F PA H  S    DST+ F P                               PD +   +K+  I  S   + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  202 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------IGSETSLI--IHRGGFFS-PWKTPKPIMDRWENQGSPQTSLSAPAI----PQNLP-FPPALHRSSF--PDSTEAFDPRK-----------------------------PDPYELYEKSRAIYESPDYKELDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 599          

HSP 2 Score: 55.8398 bits (133), Expect = 3.357e-7
Identity = 98/475 (20.63%), Postives = 168/475 (35.37%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF----IPDTFYESKKTNTIKYS-----QPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++       + +     + P +          L L             RQD     +       RQ P  Y  P      D  Q P       P   Y     +T +Y      QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  368 KELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 820          

HSP 3 Score: 53.5286 bits (127), Expect = 1.726e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:   34 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 117          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Human
Match: MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:HGNC Symbol;Acc:HGNC:18957])

HSP 1 Score: 116.316 bits (290), Expect = 8.667e-26
Identity = 120/443 (27.09%), Postives = 184/443 (41.53%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         +   T+LI  I    F +  +     I  +      P      P I    P N P F PA H  S    DST+ F P         P  Y     +     S++PD+                    + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  439 ELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------IGSETSLI--IHRGGFFS-PWKTPKPIMDRWENQGSPQTSLSAPAI----PQNLP-FPPALHRSSF--PDSTEAFDPRK-------PDPYELYEKSRAIYESRRPDY--------------------KELDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 829          

HSP 2 Score: 55.8398 bits (133), Expect = 4.099e-7
Identity = 98/475 (20.63%), Postives = 168/475 (35.37%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF----IPDTFYESKKTNTIKYS-----QPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++       + +     + P +          L L             RQD     +       RQ P  Y  P      D  Q P       P   Y     +T +Y      QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  598 KELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 1050          

HSP 3 Score: 53.5286 bits (127), Expect = 1.926e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:  262 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 345          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Human
Match: MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:HGNC Symbol;Acc:HGNC:18957])

HSP 1 Score: 116.316 bits (290), Expect = 1.109e-25
Identity = 122/452 (26.99%), Postives = 186/452 (41.15%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         +   T+LI  I    F +  +     I  +      P      P I    P N P F PA H  S    DST+ F P         P  Y     +     S++PD+                    + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  593 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------IGSETSLI--IHRGGFFS-PWKTPKPIMDRWENQGSPQTSLSAPAI----PQNLP-FPPALHRSSF--PDSTEAFDPRK-------PDPYELYEKSRAIYESRRPDY--------------------KELDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 992          

HSP 2 Score: 55.8398 bits (133), Expect = 4.296e-7
Identity = 98/473 (20.72%), Postives = 167/473 (35.31%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF----IPDTFYESKKTNTIKYS-----QPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
             DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++       + +     + P +          L L             RQD     +       RQ P  Y  P      D  Q P       P   Y     +T +Y      QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  763 LDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 1213          

HSP 3 Score: 52.7582 bits (125), Expect = 3.101e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:  425 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 508          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Human
Match: MAGI2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:HGNC Symbol;Acc:HGNC:18957])

HSP 1 Score: 115.931 bits (289), Expect = 1.266e-25
Identity = 122/452 (26.99%), Postives = 185/452 (40.93%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         +   T+LI  I    F +  +     I  +      P      P I    P N P F PA H  S    DST+ F P                         ++PD  P   YE  +          + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  455 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------IGSETSLI--IHRGGFFS-PWKTPKPIMDRWENQGSPQTSLSAPAI----PQNLP-FPPALHRSSF--PDSTEAFDP-------------------------RKPD--PYELYEKSRAIYESRRPDYKELDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 854          

HSP 2 Score: 56.225 bits (134), Expect = 3.158e-7
Identity = 98/473 (20.72%), Postives = 167/473 (35.31%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF----IPDTFYESKKTNTIKYS-----QPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
             DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++       + +     + P +          L L             RQD     +       RQ P  Y  P      D  Q P       P   Y     +T +Y      QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  625 LDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 1075          

HSP 3 Score: 53.1434 bits (126), Expect = 2.382e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:  287 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 370          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 157.918 bits (398), Expect = 2.070e-39
Identity = 138/519 (26.59%), Postives = 237/519 (45.66%), Query Frame = 2
Query:  503 AERFDVVLKKGNQGFGLTLV-DDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK-----IIQASRMRSHH----NPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQD----STKLFQPENCKTLR----QIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVE--RDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
             E     + KG +G G TL+ +D      + ++VK++   GPA   G+++ GDIL   N   ++G    E   +F  +   E++ + V +     I  A+R+ + +      + D+    + K   GFGF + +  +  ++ K+        L++  D I  +    +   PH Q+V +L++ P  +     V R +        + +F+          Y +   N+          +  + P       PA    S   +D    +T   QP            IP+S   PS+  +   +  P++IP + Y  K         P + ++V L R P  GFGFRL+GG E    + +G I+  G  ++ G +  GD I++I+  + E  +HSE V LL+ AA++ + KL +  R SR +P     GSL         +VLL R+  + FGFV++S+ +      +G+I PGS A +C  L +GDR++AVNG     L + D I +IK S L++ +T+
Sbjct:  221 GELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLME-GDTIVELDGRNVRPIPHTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFR----------YGEPQTNM----------MDSAAPLPVRSKTPAERQTSRTEEDQNVRNTLQRQPAVTSEWEGMSSAIPASRMRPSSTTLGFAT--PNYIPLSQYNQK---------PSDLITVSLIRKPV-GFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKL-IVRRPSRTDPAR--RGSLNSAGPSGSYDVLLHRNENDGFGFVLMSSQHKNGST-VGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTI 702          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 157.532 bits (397), Expect = 2.344e-39
Identity = 138/519 (26.59%), Postives = 237/519 (45.66%), Query Frame = 2
Query:  503 AERFDVVLKKGNQGFGLTLV-DDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK-----IIQASRMRSHH----NPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQD----STKLFQPENCKTLR----QIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVE--RDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
             E     + KG +G G TL+ +D      + ++VK++   GPA   G+++ GDIL   N   ++G    E   +F  +   E++ + V +     I  A+R+ + +      + D+    + K   GFGF + +  +  ++ K+        L++  D I  +    +   PH Q+V +L++ P  +     V R +        + +F+          Y +   N+          +  + P       PA    S   +D    +T   QP            IP+S   PS+  +   +  P++IP + Y  K         P + ++V L R P  GFGFRL+GG E    + +G I+  G  ++ G +  GD I++I+  + E  +HSE V LL+ AA++ + KL +  R SR +P     GSL         +VLL R+  + FGFV++S+ +      +G+I PGS A +C  L +GDR++AVNG     L + D I +IK S L++ +T+
Sbjct:  195 GELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLME-GDTIVELDGRNVRPIPHTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFR----------YGEPQTNM----------MDSAAPLPVRSKTPAERQTSRTEEDQNVRNTLQRQPAVTSEWEGMSSAIPASRMRPSSTTLGFAT--PNYIPLSQYNQK---------PSDLITVSLIRKPV-GFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKL-IVRRPSRTDPAR--RGSLNSAGPSGSYDVLLHRNENDGFGFVLMSSQHKNGST-VGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTI 676          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 157.147 bits (396), Expect = 2.386e-39
Identity = 135/517 (26.11%), Postives = 235/517 (45.45%), Query Frame = 2
Query:  503 AERFDVVLKKGNQGFGLTLV-DDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK-----IIQASRMRSHH----NPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDST--KLFQPENCKTLRQIPSSYSTPSANLIPDVS----QQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVE--RDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
             E     + KG +G G TL+ +D      + ++VK++   GPA   G+++ GDIL   N   ++G    E   +F  +   E++ + V +     I  A+R+ + +      + D+    + K   GFGF + +  +  ++ K+        L++  D I  +    +   PH Q+V +L++ P  +     V R +        + +F+          Y +   N+          +  + P       PA    S   +D       Q +   T      S + P++ + P  +      P++IP + Y  K         P + ++V L R P  GFGFRL+GG E    + +G I+  G  ++ G +  GD I++I+  + E  +HSE V LL+ AA++ + KL +  R SR +P     GSL         +VLL R+  + FGFV++S+ +      +G+I PGS A +C  L +GDR++AVNG     L + D I +IK S L++ +T+
Sbjct:  168 GELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLME-GDTIVELDGRNVRPIPHTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFR----------YGEPQTNM----------MDSAAPLPVRSKTPAERQTSRTEEDQNVRNTLQRQPAVTSEWEGMSSAIPASRMRPSSTTLGFATPNYIPLSQYNQK---------PSDLITVSLIRKPV-GFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKL-IVRRPSRTDPAR--RGSLNSAGPSGSYDVLLHRNENDGFGFVLMSSQHKNGST-VGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTI 649          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 157.532 bits (397), Expect = 3.751e-39
Identity = 135/517 (26.11%), Postives = 235/517 (45.45%), Query Frame = 2
Query:  503 AERFDVVLKKGNQGFGLTLV-DDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK-----IIQASRMRSHH----NPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDST--KLFQPENCKTLRQIPSSYSTPSANLIPDVS----QQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVE--RDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
             E     + KG +G G TL+ +D      + ++VK++   GPA   G+++ GDIL   N   ++G    E   +F  +   E++ + V +     I  A+R+ + +      + D+    + K   GFGF + +  +  ++ K+        L++  D I  +    +   PH Q+V +L++ P  +     V R +        + +F+          Y +   N+          +  + P       PA    S   +D       Q +   T      S + P++ + P  +      P++IP + Y  K         P + ++V L R P  GFGFRL+GG E    + +G I+  G  ++ G +  GD I++I+  + E  +HSE V LL+ AA++ + KL +  R SR +P     GSL         +VLL R+  + FGFV++S+ +      +G+I PGS A +C  L +GDR++AVNG     L + D I +IK S L++ +T+
Sbjct:  420 GELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLME-GDTIVELDGRNVRPIPHTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFR----------YGEPQTNM----------MDSAAPLPVRSKTPAERQTSRTEEDQNVRNTLQRQPAVTSEWEGMSSAIPASRMRPSSTTLGFATPNYIPLSQYNQK---------PSDLITVSLIRKPV-GFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKL-IVRRPSRTDPAR--RGSLNSAGPSGSYDVLLHRNENDGFGFVLMSSQHKNGST-VGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTI 901          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 157.147 bits (396), Expect = 4.705e-39
Identity = 135/517 (26.11%), Postives = 235/517 (45.45%), Query Frame = 2
Query:  503 AERFDVVLKKGNQGFGLTLV-DDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK-----IIQASRMRSHH----NPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDST--KLFQPENCKTLRQIPSSYSTPSANLIPDVS----QQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVE--RDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
             E     + KG +G G TL+ +D      + ++VK++   GPA   G+++ GDIL   N   ++G    E   +F  +   E++ + V +     I  A+R+ + +      + D+    + K   GFGF + +  +  ++ K+        L++  D I  +    +   PH Q+V +L++ P  +     V R +        + +F+          Y +   N+          +  + P       PA    S   +D       Q +   T      S + P++ + P  +      P++IP + Y  K         P + ++V L R P  GFGFRL+GG E    + +G I+  G  ++ G +  GD I++I+  + E  +HSE V LL+ AA++ + KL +  R SR +P     GSL         +VLL R+  + FGFV++S+ +      +G+I PGS A +C  L +GDR++AVNG     L + D I +IK S L++ +T+
Sbjct:  420 GELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLME-GDTIVELDGRNVRPIPHTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFR----------YGEPQTNM----------MDSAAPLPVRSKTPAERQTSRTEEDQNVRNTLQRQPAVTSEWEGMSSAIPASRMRPSSTTLGFATPNYIPLSQYNQK---------PSDLITVSLIRKPV-GFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKL-IVRRPSRTDPAR--RGSLNSAGPSGSYDVLLHRNENDGFGFVLMSSQHKNGST-VGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTI 901          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Fly
Match: Magi (gene:FBgn0034590 transcript:FBtr0342874)

HSP 1 Score: 130.183 bits (326), Expect = 2.327e-30
Identity = 73/189 (38.62%), Postives = 112/189 (59.26%), Query Frame = 2
Query: 1433 ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            E   V L R    GFGFR++GG EEG QV +G I+P G  DQ   IN GD I+ I+  +    +H +VV+L+ E+A    G++ + +R+ R         S ++ R   +V+++R   E FGFVI+S+ N      IG++ PGS A++C EL +GDRI+AVN     G+ + DV+ +IK S L++ +T+
Sbjct:  925 ELTEVTLERQ-ALGFGFRIVGGTEEGSQVTVGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESA--LRGQVTMILRRRRTPLLQQAPVSTQLRRYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTI 1110          

HSP 2 Score: 52.373 bits (124), Expect = 2.371e-6
Identity = 28/86 (32.56%), Postives = 41/86 (47.67%), Query Frame = 2
Query: 1430 QETVSVQLTRSP---------TKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAA 1660
            Q  VS QL R P          +GFGF ++  +       IG +IP  P D+CG +  GD I+ +N       +H +VV L+ E+ 
Sbjct: 1018 QAPVSTQLRRYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESG 1103          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Fly
Match: Magi (gene:FBgn0034590 transcript:FBtr0071636)

HSP 1 Score: 130.183 bits (326), Expect = 2.327e-30
Identity = 73/189 (38.62%), Postives = 112/189 (59.26%), Query Frame = 2
Query: 1433 ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            E   V L R    GFGFR++GG EEG QV +G I+P G  DQ   IN GD I+ I+  +    +H +VV+L+ E+A    G++ + +R+ R         S ++ R   +V+++R   E FGFVI+S+ N      IG++ PGS A++C EL +GDRI+AVN     G+ + DV+ +IK S L++ +T+
Sbjct:  925 ELTEVTLERQ-ALGFGFRIVGGTEEGSQVTVGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESA--LRGQVTMILRRRRTPLLQQAPVSTQLRRYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTI 1110          

HSP 2 Score: 52.373 bits (124), Expect = 2.371e-6
Identity = 28/86 (32.56%), Postives = 41/86 (47.67%), Query Frame = 2
Query: 1430 QETVSVQLTRSP---------TKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAA 1660
            Q  VS QL R P          +GFGF ++  +       IG +IP  P D+CG +  GD I+ +N       +H +VV L+ E+ 
Sbjct: 1018 QAPVSTQLRRYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESG 1103          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Fly
Match: Magi (gene:FBgn0034590 transcript:FBtr0342873)

HSP 1 Score: 130.183 bits (326), Expect = 2.327e-30
Identity = 73/189 (38.62%), Postives = 112/189 (59.26%), Query Frame = 2
Query: 1433 ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            E   V L R    GFGFR++GG EEG QV +G I+P G  DQ   IN GD I+ I+  +    +H +VV+L+ E+A    G++ + +R+ R         S ++ R   +V+++R   E FGFVI+S+ N      IG++ PGS A++C EL +GDRI+AVN     G+ + DV+ +IK S L++ +T+
Sbjct:  925 ELTEVTLERQ-ALGFGFRIVGGTEEGSQVTVGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESA--LRGQVTMILRRRRTPLLQQAPVSTQLRRYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTI 1110          

HSP 2 Score: 52.373 bits (124), Expect = 2.371e-6
Identity = 28/86 (32.56%), Postives = 41/86 (47.67%), Query Frame = 2
Query: 1430 QETVSVQLTRSP---------TKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAA 1660
            Q  VS QL R P          +GFGF ++  +       IG +IP  P D+CG +  GD I+ +N       +H +VV L+ E+ 
Sbjct: 1018 QAPVSTQLRRYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESG 1103          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0335521)

HSP 1 Score: 72.7886 bits (177), Expect = 1.486e-12
Identity = 52/196 (26.53%), Postives = 88/196 (44.90%), Query Frame = 2
Query: 1475 FGFRLMGGAEEGC--------QVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEP-HSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAV-----NPTEPCGIG----RINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDG 2008
             GF ++GG +  C         ++I  I+P G   +CG +  GD I+ +N     K TH + V  L +       ++ LT+   +H+P   G      V      VLL+++  E  G  I   +     NP +P   G    +IN    A +   L +G R+L VNG S  G  ++D + +++++   I++ V  G
Sbjct: 1154 LGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGD----EIKLTI---QHDPLPPGFQSIEVVYVKTEEVLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKG 1342          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0335522)

HSP 1 Score: 71.633 bits (174), Expect = 2.995e-12
Identity = 52/196 (26.53%), Postives = 88/196 (44.90%), Query Frame = 2
Query: 1475 FGFRLMGGAEEGC--------QVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEP-HSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAV-----NPTEPCGIG----RINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDG 2008
             GF ++GG +  C         ++I  I+P G   +CG +  GD I+ +N     K TH + V  L +       ++ LT+   +H+P   G      V      VLL+++  E  G  I   +     NP +P   G    +IN    A +   L +G R+L VNG S  G  ++D + +++++   I++ V  G
Sbjct: 1154 LGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGD----EIKLTI---QHDPLPPGFQSIEVVYVKTEEVLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKG 1342          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Zebrafish
Match: magi2b (membrane associated guanylate kinase, WW and PDZ domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-141211-6])

HSP 1 Score: 119.783 bits (299), Expect = 4.412e-27
Identity = 123/465 (26.45%), Postives = 198/465 (42.58%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNT--PDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK----SRHEPHSGIHGSLKVERDCR-------------NVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEI-TVRDGDINRLKTIKYELPRHSSPELQFTETPETFSDLPTQPVSIM 2128
            ++++  + K   GFGF + +     +V +V        L +  D I  I +  +    H QVV LLK  P        + R TT      S      + +    S  + +S  + P         G   P  T     +P +    L + D   L+  E  + + +                S+QP   P T  +S     ++Y +    V V L R  T GFGFR++GG E    + IGAII N P ++ G +  GD ++ ++      + H  V+ L+  AA+  NG++ LTVR+     + +P     GS       R             +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRI+AVN  S   + + D++K+IK + L + +  + + D+N   +         SP +    +P+T S   TQ    M
Sbjct:  475 ELLSLTITKGAEGFGFTIADSPTGQRVKQVLEPQGCPGLCE-GDLIVEINQKCLQGLNHTQVVQLLKDCPVGTEATLVIQRGTTAGGEDFSTWWTGKVMWDPQGSPQTGLSATLLPH--------GAPHPAQTLHRSSVPDSEAFHLGKPDPYDLY--EKSRAIYE----------------SRQP-LPPRTLTDS---TGVEYQE----VEVHLLREKT-GFGFRILGGDEAVQAIVIGAIIENSPAERDGRLRPGDELVSVDRMPVGGRPHRYVIDLMHAAAR--NGQVTLTVRRRVLTQQSQPCEENGGSANQNSSPRGHAVCPVNLPPTTDVVIHRKESEGFGFVIISSLNRPETTNTITVPHKIGRIIEGSPADRCGKLKVGDRIMAVNCQSIINMPHADIVKLIKDAGLTVTLHIIPEEDVNGAHSAPTS--EKQSPMVAQKHSPQTQSSPATQQSPTM 899          

HSP 2 Score: 72.0182 bits (175), Expect = 2.923e-12
Identity = 98/451 (21.73%), Postives = 177/451 (39.25%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII----------------QASRMRSHH------NPNYDMINFYLQKTEGGFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNES-----FQNMDYSMNSSIYSKISRNI-----------------DPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTL----RQIPSSYSTPSANLIPDVSQQPDFI---PDTFYESKKTNTIKYSQPQET--VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAK 1663
            +  +V L +   GFG  ++     + ++ + + AI ++ PA + G ++PGD L + +++ + G     VI +         + LTV + +                Q S  R H        P  D++  + +++EG FGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K       LH     D      + ++E       Q       SS  ++ S  +                  PL  +Q PG   +    T +           RQD     +P+ C+      RQ P  Y  P    + D  Q P      P    + ++ +   Y +PQ+    +V+L +S  KGFGF + GG E    +++  +  +GP  + G +  GD II+IN  ST   +H+  + L+    +
Sbjct:  648 QEVEVHLLREKTGFGFRILGG--DEAVQAIVIGAIIENSPAERDGRLRPGDELVSVDRMPVGGRPHRYVIDLMHAAARNGQVTLTVRRRVLTQQSQPCEENGGSANQNSSPRGHAVCPVNLPPTTDVV-IHRKESEG-FGFVIISSLNRPETTNTITVPHKIGRIIEGSPADRCGKLKVGDRIMAVNCQSIINMPHADIVKLIKDAGLTVTLHIIPEEDVNGAHSAPTSEKQSPMVAQKHSPQTQSSPATQQSPTMAHPSPPAPHPSPATTQPSPLLVDQSPGAPHANQAGTGNKKHTQKSEVKARQD----VKPDICQAAYTDYRQPPVDYRHPP---VADYRQPPTMEYRHPPALIDYRQHSIADY-RPQDYDYFTVELEKS-VKGFGFSIRGGREYKMDLFVLRLAEDGPAVRNGRMRVGDQIIEINGESTRDMSHARAIELIKAGGR 1085          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Zebrafish
Match: magi2b (membrane associated guanylate kinase, WW and PDZ domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-141211-6])

HSP 1 Score: 118.627 bits (296), Expect = 1.016e-26
Identity = 125/466 (26.82%), Postives = 200/466 (42.92%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISG---PCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK----SRHEPHSGIHGSLKVERDCR-------------NVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEI-TVRDGDINRLKTIKYELPRHSSPELQFTETPETFSDLPTQPVSIM 2128
            ++++  + K   GFGF + +     +V +V        L +  D I  I +  +    H QVV LLK  P        + R TT  +       F + D           ++  DP      P  G+S    P   P      H  S+   ++  L +P+      +  + Y           S+QP   P T  +S     ++Y +    V V L R  T GFGFR++GG E    + IGAII N P ++ G +  GD ++ ++      + H  V+ L+  AA+  NG++ LTVR+     + +P     GS       R             +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRI+AVN  S   + + D++K+IK + L + +  + + D+N   +         SP +    +P+T S   TQ    M
Sbjct:  613 ELLSLTITKGAEGFGFTIADSPTGQRVKQVLEPQGCPGLCE-GDLIVEINQKCLQGLNHTQVVQLLKDCPVGTEATLVIQRGTTAGL-------FTSWD----------PAKQWDP---QGSPQTGLSATLLPHGAPHPAQTLHRSSVPDSEAFHLGKPDPYDLYEKSRAIYE----------SRQP-LPPRTLTDS---TGVEYQE----VEVHLLREKT-GFGFRILGGDEAVQAIVIGAIIENSPAERDGRLRPGDELVSVDRMPVGGRPHRYVIDLMHAAAR--NGQVTLTVRRRVLTQQSQPCEENGGSANQNSSPRGHAVCPVNLPPTTDVVIHRKESEGFGFVIISSLNRPETTNTITVPHKIGRIIEGSPADRCGKLKVGDRIMAVNCQSIINMPHADIVKLIKDAGLTVTLHIIPEEDVNGAHSAPTS--EKQSPMVAQKHSPQTQSSPATQQSPTM 1034          

HSP 2 Score: 53.1434 bits (126), Expect = 1.567e-6
Identity = 51/206 (24.76%), Postives = 93/206 (45.15%), Query Frame = 2
Query: 1079 SISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQD--STKLFQPENCKTL----RQIPSSYSTPSANLIPDVSQQPDFI---PDTFYESKKTNTIKYSQPQET--VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAK 1663
            S+S    ++M      S  ++ +  +DP     M GI  +   + P  +P+  +L   R +  + +  +P+ C+      RQ P  Y  P    + D  Q P      P    + ++ +   Y +PQ+    +V+L +S  KGFGF + GG E    +++  +  +GP  + G +  GD II+IN  ST   +H+  + L+    +
Sbjct: 1075 SVSQAGLESM---QTGSAMTQAAPVLDP----GMTGIQTTIIGSVPVPVPSQLYLHDTRSEVKARQDVKPDICQAAYTDYRQPPVDYRHPP---VADYRQPPTMEYRHPPALIDYRQHSIADY-RPQDYDYFTVELEKS-VKGFGFSIRGGREYKMDLFVLRLAEDGPAVRNGRMRVGDQIIEINGESTRDMSHARAIELIKAGGR 1268          

HSP 3 Score: 50.8322 bits (120), Expect = 8.627e-6
Identity = 29/89 (32.58%), Postives = 45/89 (50.56%), Query Frame = 2
Query: 1382 TFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            T Y  K   T   +Q + T    + +    GFGF ++GG E    + + ++IP GP  Q   ++ GDVI+ IN+      TH++VV L 
Sbjct:  407 TIYREKPPFTRDATQLKGTFLTTVLQKSNMGFGFTIIGGDEPDEFLQVKSVIPEGPAAQDSKMDTGDVIVYINDICVLGTTHADVVKLF 495          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Zebrafish
Match: magi2b (membrane associated guanylate kinase, WW and PDZ domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-141211-6])

HSP 1 Score: 118.627 bits (296), Expect = 1.104e-26
Identity = 125/466 (26.82%), Postives = 200/466 (42.92%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISG---PCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK----SRHEPHSGIHGSLKVERDCR-------------NVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEI-TVRDGDINRLKTIKYELPRHSSPELQFTETPETFSDLPTQPVSIM 2128
            ++++  + K   GFGF + +     +V +V        L +  D I  I +  +    H QVV LLK  P        + R TT  +       F + D           ++  DP      P  G+S    P   P      H  S+   ++  L +P+      +  + Y           S+QP   P T  +S     ++Y +    V V L R  T GFGFR++GG E    + IGAII N P ++ G +  GD ++ ++      + H  V+ L+  AA+  NG++ LTVR+     + +P     GS       R             +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRI+AVN  S   + + D++K+IK + L + +  + + D+N   +         SP +    +P+T S   TQ    M
Sbjct:  613 ELLSLTITKGAEGFGFTIADSPTGQRVKQVLEPQGCPGLCE-GDLIVEINQKCLQGLNHTQVVQLLKDCPVGTEATLVIQRGTTAGL-------FTSWD----------PAKQWDP---QGSPQTGLSATLLPHGAPHPAQTLHRSSVPDSEAFHLGKPDPYDLYEKSRAIYE----------SRQP-LPPRTLTDS---TGVEYQE----VEVHLLREKT-GFGFRILGGDEAVQAIVIGAIIENSPAERDGRLRPGDELVSVDRMPVGGRPHRYVIDLMHAAAR--NGQVTLTVRRRVLTQQSQPCEENGGSANQNSSPRGHAVCPVNLPPTTDVVIHRKESEGFGFVIISSLNRPETTNTITVPHKIGRIIEGSPADRCGKLKVGDRIMAVNCQSIINMPHADIVKLIKDAGLTVTLHIIPEEDVNGAHSAPTS--EKQSPMVAQKHSPQTQSSPATQQSPTM 1034          

HSP 2 Score: 52.7582 bits (125), Expect = 2.154e-6
Identity = 51/206 (24.76%), Postives = 93/206 (45.15%), Query Frame = 2
Query: 1079 SISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQD--STKLFQPENCKTL----RQIPSSYSTPSANLIPDVSQQPDFI---PDTFYESKKTNTIKYSQPQET--VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAK 1663
            S+S    ++M      S  ++ +  +DP     M GI  +   + P  +P+  +L   R +  + +  +P+ C+      RQ P  Y  P    + D  Q P      P    + ++ +   Y +PQ+    +V+L +S  KGFGF + GG E    +++  +  +GP  + G +  GD II+IN  ST   +H+  + L+    +
Sbjct: 1075 SVSQAGLESM---QTGSAMTQAAPVLDP----GMTGIQTTIIGSVPVPVPSQLYLHDTRSEVKARQDVKPDICQAAYTDYRQPPVDYRHPP---VADYRQPPTMEYRHPPALIDYRQHSIADY-RPQDYDYFTVELEKS-VKGFGFSIRGGREYKMDLFVLRLAEDGPAVRNGRMRVGDQIIEINGESTRDMSHARAIELIKAGGR 1268          

HSP 3 Score: 50.8322 bits (120), Expect = 9.351e-6
Identity = 29/89 (32.58%), Postives = 45/89 (50.56%), Query Frame = 2
Query: 1382 TFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            T Y  K   T   +Q + T    + +    GFGF ++GG E    + + ++IP GP  Q   ++ GDVI+ IN+      TH++VV L 
Sbjct:  407 TIYREKPPFTRDATQLKGTFLTTVLQKSNMGFGFTIIGGDEPDEFLQVKSVIPEGPAAQDSKMDTGDVIVYINDICVLGTTHADVVKLF 495          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Zebrafish
Match: wu:fi36a10 (wu:fi36a10 [Source:ZFIN;Acc:ZDB-GENE-030131-6139])

HSP 1 Score: 118.242 bits (295), Expect = 1.166e-26
Identity = 119/431 (27.61%), Postives = 184/431 (42.69%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRD-TTNLIRSI-----SNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQET--VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKS----RHEPHSGIH-----------GSLK---VERDCR------NVLLTRSPEEEFGFVIVSAVNPTEPC----GIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            ++++  L K  GGFGF + +C    +V  +      + LLK  D I  I R  +    H QVV +LK  P    ++  V+R   T+ ++S+     +    Q  D    SSI +      +P                 P  +P               F P+  +                    S  P   P   Y   K+  ++ S+P  T  + V + R+   GFGFR++GG      VYIGAI+P G  ++ G +  GD +I I+    + K+H +V+ L+  AA+  NG++ LTVR+       E   G++           GS K   VE          +V L R   E FGFVI+++ N   P      IGRI  GS  ++   L +GDRI AVNG S   L + D++++IK +   + +TV
Sbjct:  573 ELVSVPLVKGPGGFGFAIADCPLGQKVKMILDAQWCRGLLK-GDVIKEINRQNVQTLSHAQVVDILKDLPVGSEVNVLVLRGGQTSPVKSLKPITPAMPITQKQDIITTSSISTDTPSPAEP----------------APQSLP---------------FPPQLIR--------------------SSSPKLDPTELY--LKSKAMQDSKPINTKELDVFIKRNQETGFGFRVLGGEGPDQPVYIGAIVPLGAAEKDGRLRAGDELICIDGVPVKGKSHKQVLELMTNAAR--NGQVMLTVRRKLTFQDREEDDGVYPPAPQALSLVNGSPKPSHVEVSGHSHPQPYDVTLQRKDNEGFGFVILTSKNKPPPGVIPHKIGRIIEGSPTDRSGHLKVGDRISAVNGQSIIDLSHNDIVQLIKEAGNAVTLTV 947          

HSP 2 Score: 50.8322 bits (120), Expect = 8.154e-6
Identity = 26/83 (31.33%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 1760 NVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLN--IEITVR 2002
            +V + R+ E  FGF ++    P +P  IG I P   AEK   L  GD ++ ++G   +G  +K V++++ ++  N  + +TVR
Sbjct:  736 DVFIKRNQETGFGFRVLGGEGPDQPVYIGAIVPLGAAEKDGRLRAGDELICIDGVPVKGKSHKQVLELMTNAARNGQVMLTVR 818          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Zebrafish
Match: wu:fi36a10 (wu:fi36a10 [Source:ZFIN;Acc:ZDB-GENE-030131-6139])

HSP 1 Score: 118.242 bits (295), Expect = 1.685e-26
Identity = 121/431 (28.07%), Postives = 186/431 (43.16%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRD-TTNLIRSI-----SNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQET--VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKS-----RHE--------PH--SGIHGSLK---VERDCR------NVLLTRSPEEEFGFVIVSAVNPTEPC----GIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            ++++  L K  GGFGF + +C    +V  +      + LLK  D I  I R  +    H QVV +LK  P    ++  V+R   T+ ++S+     +    Q  D    SSI +      +P                 P  +P               F P+  +                    S  P   P   Y   K+  ++ S+P  T  + V + R+   GFGFR++GG      VYIGAI+P G  ++ G +  GD +I I+    + K+H +V+ L+  AA+  NG++ LTVR+      R E        P   S ++GS K   VE          +V L R   E FGFVI+++ N   P      IGRI  GS  ++   L +GDRI AVNG S   L + D++++IK +   + +TV
Sbjct:  573 ELVSVPLVKGPGGFGFAIADCPLGQKVKMILDAQWCRGLLK-GDVIKEINRQNVQTLSHAQVVDILKDLPVGSEVNVLVLRGGQTSPVKSLKPITPAMPITQKQDIITTSSISTDTPSPAEP----------------APQSLP---------------FPPQLIR--------------------SSSPKLDPTELY--LKSKAMQDSKPINTKELDVFIKRNQETGFGFRVLGGEGPDQPVYIGAIVPLGAAEKDGRLRAGDELICIDGVPVKGKSHKQVLELMTNAAR--NGQVMLTVRRKLTFQDREEDDGVYPPAPQALSLVNGSPKPSHVEVSGHSHPQPYDVTLQRKDNEGFGFVILTSKNKPPPGVIPHKIGRIIEGSPTDRSGHLKVGDRISAVNGQSIIDLSHNDIVQLIKEAGNAVTLTV 947          

HSP 2 Score: 50.8322 bits (120), Expect = 8.050e-6
Identity = 26/83 (31.33%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 1760 NVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLN--IEITVR 2002
            +V + R+ E  FGF ++    P +P  IG I P   AEK   L  GD ++ ++G   +G  +K V++++ ++  N  + +TVR
Sbjct:  736 DVFIKRNQETGFGFRVLGGEGPDQPVYIGAIVPLGAAEKDGRLRAGDELICIDGVPVKGKSHKQVLELMTNAARNGQVMLTVR 818          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Xenopus
Match: gdf5 (growth differentiation factor 5 [Source:Xenbase;Acc:XB-GENE-481784])

HSP 1 Score: 129.798 bits (325), Expect = 5.684e-30
Identity = 155/603 (25.70%), Postives = 246/603 (40.80%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK--------------------IIQASRMRSHHNPNYDMINFYLQKT-------------------------------------EGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPD--FIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEG--CQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------SRHEPHSG--------------------IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
               +LKK N GFG T++     D  + L+VK++  +GPA + G ++ GD++   N+  ++G    +V+K+F+ V   +S+ L + +                    +I+   +  +   NY+    Y+ +T                                       GFGF + +     +V ++    DVQ    L   D I  I +  + +  H +VV LLK+ P         V + T+L+  I    F    +S   S  SK  R+         P   +S P   P+  F P  H  S    DST+ F P         P  Y     +                YES++    KY+   E + V L R  + GFGFR++GG E G    + IGA+I  G  D+ G +  GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                 S    HS                       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVN  S   + + D++K+IK + L++ + +
Sbjct:  417 LSTILKKSNMGFGFTIIGGDEPD--EFLQVKSVIPEGPAAQDGKMETGDVIVYINEACVLGYTHADVVKIFQSVPIGQSVNLVLCRGYPLPYDPEDSANNLVSPLAVIERPPVVVNGRNNYETYLEYISRTPLENTFPPPPPTHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DVQGCPGLFEGDLIVEINQQNVQNLNHLEVVELLKECP---------VGNETSLV--IQRGGF----FSPWKS--SKPVRS---------PQTSLSAPSLPPNVPFAPMLHRSSF--PDSTEAFDPRK-------PDPYELYEKSR-------------AIYESRR----KYNTFSE-LDVHLRRQES-GFGFRILGGDEPGQPVSILIGAVIAMGSADRDGRLRPGDELLYVDGIPVAGKTHRYVIDLMHNAAR--NGQVNLTVRRKVLSIADTCPENGRSPGSASTQHSSPRSDSAYPNSNHSAPCNPSPPEGFTSQSMQSSDVVIHRKENEGFGFVIISSLNRPESGATIAVPHKIGRIIEGSPADRCGKLKVGDRILAVNSQSIINMPHADIVKLIKDAGLSVTLCI 958          

HSP 2 Score: 56.6102 bits (135), Expect = 2.277e-7
Identity = 100/468 (21.37%), Postives = 167/468 (35.68%), Query Frame = 2
Query:  494 YHIAERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII-------------QASRMRSHHNPNYDMI----------------NFYLQ-----------KTEGGFGFIL----------GNCKDEHQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYST---PSANLIPDVSQQP--DFI-PDTFYESKKTN--------TIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            Y+     DV L++   GFG  ++          + + A+   G A + G ++PGD L   + I + G     VI +         + LTV + +               S    H +P  D                   F  Q           K   GFGF++                H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T+          +  E   +   + +S   S +++   P+   Q P    S         P  H L            P     L+   SSY +      ++ PD+ Q P  D+  P T Y     +         I + Q  +  +V+L +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  723 YNTFSELDVHLRRQESGFGFRILGGDEPGQPVSILIGAVIAMGSADRDGRLRPGDELLYVDGIPVAGKTHRYVIDLMHNAARNGQVNLTVRRKVLSIADTCPENGRSPGSASTQHSSPRSDSAYPNSNHSAPCNPSPPEGFTSQSMQSSDVVIHRKENEGFGFVIISSLNRPESGATIAVPHKIGRIIEGSPADRCGKLKVGDRILAVNSQSIINMPHADIVKLIK----DAGLSVTLC--------IVPQEELNSPASAPSSEKQSPMAQQHSPMA-QQSPVAQQS---------PVAHSL------------PPQPLQLQGHESSYRSEVKARQDVKPDIRQPPFTDYRQPSTDYRQPPVDYRHPPVHSLIFHLQDYDYFTVELEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVKLLLKR 1151          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Xenopus
Match: gdf5 (growth differentiation factor 5 [Source:Xenbase;Acc:XB-GENE-481784])

HSP 1 Score: 119.783 bits (299), Expect = 4.353e-27
Identity = 126/454 (27.75%), Postives = 193/454 (42.51%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPD--FIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----SRHE-PHSGI--------HGSLKVERDCRN------------------------VLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    DVQ    L   D I  I +  + +  H +VV LLK+ P         V + T+L+  I    F +           K S+ I   + NQ  P   +S P   P+  F P  H  S    DST+ F P                               PD +   +K+  I  S   + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G +  GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+      R+  P +G         H S + +    N                        V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVN  S   + + D++K+IK + L++ + +
Sbjct:  193 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DVQGCPGLFEGDLIVEINQQNVQNLNHLEVVELLKECP---------VGNETSLV--IQRGGFFSP---------WKSSKPIMERWENQGSPQTSLSAPSLPPNVPFAPMLHRSSF--PDSTEAFDPRK-----------------------------PDPYELYEKSRAIYESPDYKELDVHLRRQ-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLRPGDELLYVDGIPVAGKTHRYVIDLMHNAAR--NGQVNLTVRRKVLSIGRYTCPENGRSPGSASTQHSSPRSDSAYPNSNHSAPCNPSPPEGFTSQSMQSSDVVIHRKENEGFGFVIISSLNRPESGATIAVPHKIGRIIEGSPADRCGKLKVGDRILAVNSQSIINMPHADIVKLIKDAGLSVTLCI 589          

HSP 2 Score: 54.6842 bits (130), Expect = 6.605e-7
Identity = 103/491 (20.98%), Postives = 174/491 (35.44%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII--------------QASRMRSHHNPNYDMI----------------NFYLQ-----------KTEGGFGFIL----------GNCKDEHQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLI-PDV--SQQPDFI-----PDTFYESKKTNTIKYSQPQ-------ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLT 1774
            +  DV L++   GFG  ++     +  + + + A+   G A + G ++PGD L   + I + G     VI +         + LTV + +                S    H +P  D                   F  Q           K   GFGF++                H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L      +  +   + S+E    M    +            P+ ++  P      P        +       RQD     +       RQ  + Y  P  +   P V   QQP  I     P   Y     +T ++  P        +  +V+L +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L ++  R   H   + SL  +R+  + L+T
Sbjct:  359 KELDVHLRRQESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLRPGDELLYVDGIPVAGKTHRYVIDLMHNAARNGQVNLTVRRKVLSIGRYTCPENGRSPGSASTQHSSPRSDSAYPNSNHSAPCNPSPPEGFTSQSMQSSDVVIHRKENEGFGFVIISSLNRPESGATIAVPHKIGRIIEGSPADRCGKLKVGDRILAVNSQSIINMPHADIVKLIKDAGLSVTLCIVPQEELNSPASAPSSEKQSPMAQQHSPMAQQSPVAQQSPVAHSLPPQ-----PLQLQGHESSYRSEVKARQDVKPDIRQPPFTDYRQPSTDYRQPPVDYRHPPVVDYQQPPPIDYRQPPLIEYRQHSPDTRQFPLPDYRQFQDYDYFTVELEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVKLLLK--RGTGHVPEYASLLPKRNGTDSLIT 835          

HSP 3 Score: 51.9878 bits (123), Expect = 4.614e-6
Identity = 26/86 (30.23%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
               +LKK N GFG T++     D  + L+VK++  +GPA + G ++ GD++   N+  ++G    +V+K+F+ V   +S+ L + +
Sbjct:   24 LSTILKKSNMGFGFTIIGGDEPD--EFLQVKSVIPEGPAAQDGKMETGDVIVYINEACVLGYTHADVVKIFQSVPIGQSVNLVLCR 107          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Xenopus
Match: gdf5 (growth differentiation factor 5 [Source:Xenbase;Acc:XB-GENE-481784])

HSP 1 Score: 117.857 bits (294), Expect = 3.147e-26
Identity = 126/454 (27.75%), Postives = 194/454 (42.73%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPD--FIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----SRHE-PHSGI--------HGSLKVERDCRN------------------------VLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    DVQ    L   D I  I +  + +  H +VV LLK+ P         V + T+L+  I    F +           K S+ I   + NQ  P   +S P   P+  F P  H  S    DST+ F P         P  Y     +                YES++   +      + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G +  GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+      R+  P +G         H S + +    N                        V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVN  S   + + D++K+IK + L++ + +
Sbjct:  592 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DVQGCPGLFEGDLIVEINQQNVQNLNHLEVVELLKECP---------VGNETSLV--IQRGGFFSP---------WKSSKPIMERWENQGSPQTSLSAPSLPPNVPFAPMLHRSSF--PDSTEAFDPRK-------PDPYELYEKS-------------RAIYESRRYFYLTTGPDYKELDVHLRRQ-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLRPGDELLYVDGIPVAGKTHRYVIDLMHNAAR--NGQVNLTVRRKVLSIGRYTCPENGRSPGSASTQHSSPRSDSAYPNSNHSAPCNPSPPEGFTSQSMQSSDVVIHRKENEGFGFVIISSLNRPESGATIAVPHKIGRIIEGSPADRCGKLKVGDRILAVNSQSIINMPHADIVKLIKDAGLSVTLCI 997          

HSP 2 Score: 53.9138 bits (128), Expect = 1.217e-6
Identity = 100/476 (21.01%), Postives = 167/476 (35.08%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII--------------QASRMRSHHNPNYDMI----------------NFYLQ-----------KTEGGFGFIL----------GNCKDEHQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLI-PDV--SQQPDFI-----PDTFYESKKTNTIKYSQPQ-------ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTV-RKSRHEPHSGI 1726
            +  DV L++   GFG  ++     +  + + + A+   G A + G ++PGD L   + I + G     VI +         + LTV + +                S    H +P  D                   F  Q           K   GFGF++                H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L      +  +   + S+E    M    +            P+ ++  P      P        +       RQD     +       RQ  + Y  P  +   P V   QQP  I     P   Y     +T ++  P        +  +V+L +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L + R + H P  G+
Sbjct:  767 KELDVHLRRQESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLRPGDELLYVDGIPVAGKTHRYVIDLMHNAARNGQVNLTVRRKVLSIGRYTCPENGRSPGSASTQHSSPRSDSAYPNSNHSAPCNPSPPEGFTSQSMQSSDVVIHRKENEGFGFVIISSLNRPESGATIAVPHKIGRIIEGSPADRCGKLKVGDRILAVNSQSIINMPHADIVKLIKDAGLSVTLCIVPQEELNSPASAPSSEKQSPMAQQHSPMAQQSPVAQQSPVAHSLPPQ-----PLQLQGHESSYRSEVKARQDVKPDIRQPPFTDYRQPSTDYRQPPVDYRHPPVVDYQQPPPIDYRQPPLIEYRQHSPDTRQFPLPDYRQFQDYDYFTVELEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVKLLLKRGTGHVPEYGM 1230          

HSP 3 Score: 51.6026 bits (122), Expect = 6.818e-6
Identity = 26/86 (30.23%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
               +LKK N GFG T++     D  + L+VK++  +GPA + G ++ GD++   N+  ++G    +V+K+F+ V   +S+ L + +
Sbjct:  423 LSTILKKSNMGFGFTIIGGDEPD--EFLQVKSVIPEGPAAQDGKMETGDVIVYINEACVLGYTHADVVKIFQSVPIGQSVNLVLCR 506          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Xenopus
Match: gdf5 (growth differentiation factor 5 [Source:Xenbase;Acc:XB-GENE-481784])

HSP 1 Score: 117.472 bits (293), Expect = 3.332e-26
Identity = 126/454 (27.75%), Postives = 194/454 (42.73%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPD--FIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----SRHE-PHSGI--------HGSLKVERDCRN------------------------VLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    DVQ    L   D I  I +  + +  H +VV LLK+ P         V + T+L+  I    F +           K S+ I   + NQ  P   +S P   P+  F P  H  S    DST+ F P         P  Y     +                YES++   +      + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G +  GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+      R+  P +G         H S + +    N                        V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVN  S   + + D++K+IK + L++ + +
Sbjct:  438 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DVQGCPGLFEGDLIVEINQQNVQNLNHLEVVELLKECP---------VGNETSLV--IQRGGFFSP---------WKSSKPIMERWENQGSPQTSLSAPSLPPNVPFAPMLHRSSF--PDSTEAFDPRK-------PDPYELYEKSR-------------AIYESRRYFYLTTGPDYKELDVHLRRQ-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLRPGDELLYVDGIPVAGKTHRYVIDLMHNAAR--NGQVNLTVRRKVLSIGRYTCPENGRSPGSASTQHSSPRSDSAYPNSNHSAPCNPSPPEGFTSQSMQSSDVVIHRKENEGFGFVIISSLNRPESGATIAVPHKIGRIIEGSPADRCGKLKVGDRILAVNSQSIINMPHADIVKLIKDAGLSVTLCI 843          

HSP 2 Score: 52.373 bits (124), Expect = 3.857e-6
Identity = 28/86 (32.56%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 1442 SVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +V+L +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  986 TVELEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVKLLLKR 1066          

HSP 3 Score: 51.9878 bits (123), Expect = 5.947e-6
Identity = 26/86 (30.23%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
               +LKK N GFG T++     D  + L+VK++  +GPA + G ++ GD++   N+  ++G    +V+K+F+ V   +S+ L + +
Sbjct:  269 LSTILKKSNMGFGFTIIGGDEPD--EFLQVKSVIPEGPAAQDGKMETGDVIVYINEACVLGYTHADVVKIFQSVPIGQSVNLVLCR 352          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Xenopus
Match: gdf5 (growth differentiation factor 5 [Source:Xenbase;Acc:XB-GENE-481784])

HSP 1 Score: 117.472 bits (293), Expect = 4.194e-26
Identity = 126/454 (27.75%), Postives = 195/454 (42.95%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPD--FIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----SRHE-PHSGI--------HGSLKVERDCRN------------------------VLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    DVQ    L   D I  I +  + +  H +VV LLK+ P         V + T+L+  I    F +           K S+ I   + NQ  P   +S P   P+  F P  H  S    DST+ F P         P  Y     +                YES++   +      + + V L R  + GFGFR++GG E G  + IGA+I  G  D+ G +  GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+      R+  P +G         H S + +    N                        V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVN  S   + + D++K+IK + L++ + +
Sbjct:  592 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DVQGCPGLFEGDLIVEINQQNVQNLNHLEVVELLKECP---------VGNETSLV--IQRGGFFSP---------WKSSKPIMERWENQGSPQTSLSAPSLPPNVPFAPMLHRSSF--PDSTEAFDPRK-------PDPYELYEKSR-------------AIYESRRYFYLTTGPDYKELDVHLRRQES-GFGFRILGGDEPGQPILIGAVIAMGSADRDGRLRPGDELLYVDGIPVAGKTHRYVIDLMHNAAR--NGQVNLTVRRKVLSIGRYTCPENGRSPGSASTQHSSPRSDSAYPNSNHSAPCNPSPPEGFTSQSMQSSDVVIHRKENEGFGFVIISSLNRPESGATIAVPHKIGRIIEGSPADRCGKLKVGDRILAVNSQSIINMPHADIVKLIKDAGLSVTLCI 997          

HSP 2 Score: 51.9878 bits (123), Expect = 4.704e-6
Identity = 28/86 (32.56%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 1442 SVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +V+L +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct: 1140 TVELEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVKLLLKR 1220          

HSP 3 Score: 51.6026 bits (122), Expect = 7.374e-6
Identity = 26/86 (30.23%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
               +LKK N GFG T++     D  + L+VK++  +GPA + G ++ GD++   N+  ++G    +V+K+F+ V   +S+ L + +
Sbjct:  423 LSTILKKSNMGFGFTIIGGDEPD--EFLQVKSVIPEGPAAQDGKMETGDVIVYINEACVLGYTHADVVKIFQSVPIGQSVNLVLCR 506          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Mouse
Match: Magi2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:MGI Symbol;Acc:MGI:1354953])

HSP 1 Score: 118.627 bits (296), Expect = 7.438e-27
Identity = 121/452 (26.77%), Postives = 185/452 (40.93%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         V   T+LI  I    F +  +     +  +      P      P +    P N P F PA H  S    DST+ F P                               PD +   +K+  I  S   + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  202 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------VGSETSLI--IHRGGFFS-PWKTPKPMMDRWENQGSPQTSLSAPAV----PQNLP-FPPALHRSSF--PDSTEAFDPRK-----------------------------PDPYELYEKSRAIYESPDYKELDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 599          

HSP 2 Score: 61.6178 bits (148), Expect = 3.996e-9
Identity = 101/472 (21.40%), Postives = 170/472 (36.02%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF-----IPDTFYESKKTNTIKYSQPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++   PL     +     + P +          L L             RQD     +       RQ P  Y  P      D SQ P        PDT    ++     Y QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  368 KELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQHSPLAQQSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYSQPPPLDYRQHSPDT----RQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 813          

HSP 3 Score: 53.5286 bits (127), Expect = 1.224e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:   34 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 117          

HSP 4 Score: 50.8322 bits (120), Expect = 7.985e-6
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query: 1472 GFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            GFGF ++GG E    + + ++IP+GP  Q G +  GDVI+ IN       TH++VV L 
Sbjct:   44 GFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLF 102          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Mouse
Match: Magi2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:MGI Symbol;Acc:MGI:1354953])

HSP 1 Score: 115.546 bits (288), Expect = 1.287e-25
Identity = 121/452 (26.77%), Postives = 186/452 (41.15%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         V   T+LI  I    F +  +     +  +      P      P +    P N P F PA H  S    DST+ F P         P  Y     +     S++PD+                    + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  592 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------VGSETSLI--IHRGGFFS-PWKTPKPMMDRWENQGSPQTSLSAPAV----PQNLP-FPPALHRSSF--PDSTEAFDPRK-------PDPYELYEKSRAIYESRRPDY--------------------KELDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 991          

HSP 2 Score: 62.003 bits (149), Expect = 3.319e-9
Identity = 104/485 (21.44%), Postives = 174/485 (35.88%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF-----IPDTFYESKKTNTIKYSQPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSR------HEPHS 1720
            +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++   PL     +     + P +          L L             RQD     +       RQ P  Y  P      D SQ P        PDT    ++     Y QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++         EPH+
Sbjct:  760 KELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQHSPLAQQSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYSQPPPLDYRQHSPDT----RQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKRGTGQVPEYDEPHA 1218          

HSP 3 Score: 53.1434 bits (126), Expect = 1.996e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:  424 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 507          

HSP 4 Score: 50.8322 bits (120), Expect = 9.113e-6
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query: 1472 GFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            GFGF ++GG E    + + ++IP+GP  Q G +  GDVI+ IN       TH++VV L 
Sbjct:  434 GFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLF 492          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Mouse
Match: Magi2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:MGI Symbol;Acc:MGI:1354953])

HSP 1 Score: 114.775 bits (286), Expect = 1.577e-25
Identity = 119/443 (26.86%), Postives = 183/443 (41.31%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         V   T+LI  I    F +  +     +  +      P      P +    P N P F PA H  S    DST+ F P                         ++PD  P   YE  +          + + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  438 ELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------VGSETSLI--IHRGGFFS-PWKTPKPMMDRWENQGSPQTSLSAPAV----PQNLP-FPPALHRSSF--PDSTEAFDP-------------------------RKPD--PYELYEKSRAIYESRRPDYKELDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 828          

HSP 2 Score: 61.6178 bits (148), Expect = 4.738e-9
Identity = 101/472 (21.40%), Postives = 170/472 (36.02%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF-----IPDTFYESKKTNTIKYSQPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++   PL     +     + P +          L L             RQD     +       RQ P  Y  P      D SQ P        PDT    ++     Y QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  597 KELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQHSPLAQQSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYSQPPPLDYRQHSPDT----RQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 1042          

HSP 3 Score: 53.5286 bits (127), Expect = 1.309e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:  261 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 344          

HSP 4 Score: 50.8322 bits (120), Expect = 7.797e-6
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query: 1472 GFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            GFGF ++GG E    + + ++IP+GP  Q G +  GDVI+ IN       TH++VV L 
Sbjct:  271 GFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLF 329          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Mouse
Match: Magi2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:MGI Symbol;Acc:MGI:1354953])

HSP 1 Score: 114.005 bits (284), Expect = 2.592e-25
Identity = 123/453 (27.15%), Postives = 189/453 (41.72%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYST-PSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         V   T+LI  I    F +  +     +  +      P      P +    P N P F PA H  S    DST+ F P         P  Y     +  I +  QQ   +P        ++   Y +    + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  202 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------VGSETSLI--IHRGGFFS-PWKTPKPMMDRWENQGSPQTSLSAPAV----PQNLP-FPPALHRSSF--PDSTEAFDPRK-------PDPYELYEKSRAIYESRQQ---VPPRTSFRMDSSGPDYKE----LDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 615          

HSP 2 Score: 62.003 bits (149), Expect = 3.198e-9
Identity = 106/501 (21.16%), Postives = 180/501 (35.93%), Query Frame = 2
Query:  431 FCTNRHMYSSLNSDPKIKSYLYHIA----ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF-----IPDTFYESKKTNTIKYSQPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +  +R +Y S    P   S+    +    +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++   PL     +     + P +          L L             RQD     +       RQ P  Y  P      D SQ P        PDT    ++     Y QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  355 YEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQHSPLAQQSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYSQPPPLDYRQHSPDT----RQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 829          

HSP 3 Score: 53.5286 bits (127), Expect = 1.141e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:   34 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 117          

HSP 4 Score: 50.8322 bits (120), Expect = 7.895e-6
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query: 1472 GFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            GFGF ++GG E    + + ++IP+GP  Q G +  GDVI+ IN       TH++VV L 
Sbjct:   44 GFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLF 102          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Mouse
Match: Magi2 (membrane associated guanylate kinase, WW and PDZ domain containing 2 [Source:MGI Symbol;Acc:MGI:1354953])

HSP 1 Score: 113.62 bits (283), Expect = 4.842e-25
Identity = 123/453 (27.15%), Postives = 189/453 (41.72%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYST-PSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         V   T+LI  I    F +  +     +  +      P      P +    P N P F PA H  S    DST+ F P         P  Y     +  I +  QQ   +P        ++   Y +    + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  592 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------VGSETSLI--IHRGGFFS-PWKTPKPMMDRWENQGSPQTSLSAPAV----PQNLP-FPPALHRSSF--PDSTEAFDPRK-------PDPYELYEKSRAIYESRQQ---VPPRTSFRMDSSGPDYKE----LDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 1005          

HSP 2 Score: 62.3882 bits (150), Expect = 2.309e-9
Identity = 109/514 (21.21%), Postives = 184/514 (35.80%), Query Frame = 2
Query:  431 FCTNRHMYSSLNSDPKIKSYLYHIA----ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF-----IPDTFYESKKTNTIKYSQPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSR------HEPHS 1720
            +  +R +Y S    P   S+    +    +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++   PL     +     + P +          L L             RQD     +       RQ P  Y  P      D SQ P        PDT    ++     Y QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++         EPH+
Sbjct:  745 YEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQHSPLAQQSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYSQPPPLDYRQHSPDT----RQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKRGTGQVPEYDEPHA 1232          

HSP 3 Score: 52.7582 bits (125), Expect = 2.122e-6
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                LKK N GFG T++     D  + L+VK++  DGPA + G ++ GD++   N++ ++G    +V+K+F+ V   +S+ L + +
Sbjct:  424 LSTTLKKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCR 507          

HSP 4 Score: 50.8322 bits (120), Expect = 9.523e-6
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query: 1472 GFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            GFGF ++GG E    + + ++IP+GP  Q G +  GDVI+ IN       TH++VV L 
Sbjct:  434 GFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLF 492          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q86UL8|MAGI2_HUMAN (Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3)

HSP 1 Score: 114.39 bits (285), Expect = 1.952e-24
Identity = 124/453 (27.37%), Postives = 189/453 (41.72%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYST-PSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         +   T+LI  I    F +  +     I  +      P      P I    P N P F PA H  S    DST+ F P         P  Y     +  I +  QQ   +P        ++   Y +    + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  593 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------IGSETSLI--IHRGGFFS-PWKTPKPIMDRWENQGSPQTSLSAPAI----PQNLP-FPPALHRSSF--PDSTEAFDPRK-------PDPYELYEKSRAIYESRQQ---VPPRTSFRMDSSGPDYKE----LDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 1006          

HSP 2 Score: 56.225 bits (134), Expect = 1.341e-6
Identity = 103/504 (20.44%), Postives = 178/504 (35.32%), Query Frame = 2
Query:  431 FCTNRHMYSSLNSDPKIKSYLYHIA----ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF----IPDTFYESKKTNTIKYS-----QPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +  +R +Y S    P   S+    +    +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++       + +     + P +          L L             RQD     +       RQ P  Y  P      D  Q P       P   Y     +T +Y      QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  746 YEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 1227          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9WVQ1|MAGI2_MOUSE (Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 3.455e-24
Identity = 123/453 (27.15%), Postives = 189/453 (41.72%), Query Frame = 2
Query:  788 MRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYST-PSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            M S      +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         V   T+LI  I    F +  +     +  +      P      P +    P N P F PA H  S    DST+ F P         P  Y     +  I +  QQ   +P        ++   Y +    + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  592 MASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------VGSETSLI--IHRGGFFS-PWKTPKPMMDRWENQGSPQTSLSAPAV----PQNLP-FPPALHRSSF--PDSTEAFDPRK-------PDPYELYEKSRAIYESRQQ---VPPRTSFRMDSSGPDYKE----LDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 1005          

HSP 2 Score: 62.003 bits (149), Expect = 2.560e-8
Identity = 106/501 (21.16%), Postives = 180/501 (35.93%), Query Frame = 2
Query:  431 FCTNRHMYSSLNSDPKIKSYLYHIA----ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH-----------NPNYDMINFYLQKTEG-------------------GFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF-----IPDTFYESKKTNTIKYSQPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +  +R +Y S    P   S+    +    +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH           N N+   +      EG                   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   +   + +S   S +++   PL     +     + P +          L L             RQD     +       RQ P  Y  P      D SQ P        PDT    ++     Y QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  745 YEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNSPTSAPSSEKQSPMAQQHSPLAQQSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYSQPPPLDYRQHSPDT----RQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 1219          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|O88382|MAGI2_RAT (Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 6.358e-24
Identity = 123/447 (27.52%), Postives = 190/447 (42.51%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQ-MPGIGISGPC--NTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYST-PSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------------------------------SRHEPHSG----IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            +++   + K   GFGF + +     +V ++    D+Q    L   D I  I +  + +  H +VV +LK  P         V   T+LI  I    F    +S   +    + R     + NQ  P   +S P    +  F PA H  S    DST+ F P         P  Y     +  I +  QQ   +P        ++   Y +    + V L R    GFGFR++GG E G  + IGA+I  G  D+ G ++ GD ++ ++      KTH  V+ L+  AA+  NG++NLTVR+                                   S H   S       G         +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVNG S   + + D++K+IK + L++ + +
Sbjct:  602 ELMTLTIVKGAKGFGFTIADSPTGQRVKQIL---DIQGCPGLCEGDLIVEINQQNVQNLSHTEVVDILKDCP---------VGSETSLI--IHRGGF----FSPWKTPKPMVDR-----WENQGSPQTSLSAPAVPQSLPFPPALHRSSF--PDSTEAFDPRK-------PDPYELYEKSRAIYESRQQ---VPPRTSFRMDSSGPDYKE----LDVHLRRM-ESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAAR--NGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYANSNHAAPSNNASPPEGFASHSLQTSDVIIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 1006          

HSP 2 Score: 62.3882 bits (150), Expect = 1.762e-8
Identity = 109/502 (21.71%), Postives = 180/502 (35.86%), Query Frame = 2
Query:  431 FCTNRHMYSSLNSDPKIKSYLYHIA----ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHHN-PNYDMINFY---------------------LQ--------KTEGGFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGIS--GPCNTPDFIPATHFLSLH------------RQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF-----IPDTFYESKKTNTIKYSQPQE--TVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            +  +R +Y S    P   S+    +    +  DV L++   GFG  ++     +  + + + A+   G A + G + PGD L   + I + G     VI +         + LTV + +                + +HH+ P  D   +                      LQ        K   GFGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K    +  L  T        +R I  E   N   + +S   S +++   PL     P    S   P +          L L             RQD     +       RQ P  Y  P      D SQ          PDT    ++     Y QPQ+    +V + +   KGFGF + GG E    +Y+  +  +GP  + G +  GD II+IN  ST   TH+  + L+    KS   ++ L +++
Sbjct:  746 YEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVHLRRMESGFGFRILGG--DEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYANSNHAAPSNNASPPEGFASHSLQTSDVIIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIK----DAGLSVT--------LRIIPQEELNNPTSAPSSEKQSPMAQQHSPLAQQHSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKARQDVKPDIRQPPFTDYRQPPLDYRQPPGG---DYSQPSPLDYRQHSPDT----RQYPLSDYRQPQDFDYFTVDMEKG-AKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMTHARAIELI----KSGGRRVRLLLKR 1221          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|A1A5G4|MAGI3_XENTR (Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Xenopus tropicalis OX=8364 GN=magi3 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.060e-23
Identity = 79/243 (32.51%), Postives = 123/243 (50.62%), Query Frame = 2
Query: 1355 SQQPDFIPDTFYESKKTNTIKYSQPQETVSVQL-TRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKS-------------RHEP--HSG--------IHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPC----GIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            S  P   P   Y  KK+  I   +P  T  + +  R    GFGFR++GG      +YIGAIIP G  ++ G +   D +I I+    + K+H +V+ L+  AA+  NG + LTVR+              +H P  H+G        +    K+  +  +V+L R   E FGFVI+++ N   P      IGR+  GS A++C +L +GDRI AVNG S   L + +++++IK +   + +TV
Sbjct:  698 SCSPKLDPSEVY--KKSKNIFEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQAIYIGAIIPLGAAEKDGRLRAADELICIDGVPVKGKSHKQVLDLMTNAAR--NGHVLLTVRRQIYYTDKQQEEEELQHTPPAHNGSPRLNRIEVSAIPKLPAEAYDVILQRKDNEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCRKLKVGDRISAVNGQSIVELSHDNIVQLIKDAGNTVTLTV 936          

HSP 2 Score: 55.8398 bits (133), Expect = 1.606e-6
Identity = 35/106 (33.02%), Postives = 57/106 (53.77%), Query Frame = 2
Query:  455 SSLNSDP-KIKSYLYHIAERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
            S    DP ++K  L H +      LKK   GFG T++     D  + L+VK + KDGPA + G I PGD++   N   ++G    EV++MF+L+   + + +T+ +
Sbjct:  392 SQFTRDPSQLKGALLHTS------LKKSAMGFGFTIIGGDRPD--EFLQVKNVLKDGPAAQDGKIAPGDVIVDINGTCVLGHTHAEVVQMFQLIPINQYVNMTLCR 489          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q4L1J4|MAGI1_RAT (Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Magi1 PE=1 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 6.775e-22
Identity = 164/701 (23.40%), Postives = 276/701 (39.37%), Query Frame = 2
Query:  524 LKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGD-----------------ILSAFNQIDIIGVLPDEVIKMFKL----------------VKEKESIVLT-----------VWKIIQASRMR--------------SHHNPN------------YDMINFYLQKTEGGFGFILGNCKDE--HQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIR-SISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNT----PDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQ----ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNL------TVRKSRHE-------------PHS---------GIHGSLKVERDCR------------------------NVLLTRSPEEEFGFVIVSAVNPTE-------------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLKTIKYELPRHSSPELQFTETPETFSDLPTQPVSIMKPISQFDKQIFRTFQQTPDE 2188
            L+K ++GFG T+V     D  + L++K++  DGPA   G ++ GD                 ++  F  I I   +  E+ + + L                + +KE I++              K  + S M+              SH  PN             ++I  ++ K   GFGF + +       +V ++  +   + L K  D I  + +  +    H+QVV +L + P+   +   V R    + + S  ++  +  D S NSS +S           + +  +  + P ++    P++ PA    +  + DS+   +P+  K   Q  S Y          +S  P          ++ N+  + + Q    +   + L R  T GFGFR++GG E G  +YIG I+P G  D  G +  GD +I ++ T    K+H  VV L+ +AAK  +  L +      TV K+ +E             P S         G   SL                               +V + R   E FGFVIVS+V+  E             P  IGRI  GS A++C +L +GDRILAVNG S     + D++ +IK +   + + +  GD +   T+     + ++  +  T  P       T+  +  KP SQF+   F+  Q T ++
Sbjct:  474 LRKSSRGFGFTVVGGDEPD--EFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTGKVSNMKDARPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRCRGL-KEGDLIVEVNKRNVQALTHNQVVDMLIECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKD-SQNSSQHS----------VSSLRSLHTASPSHSAQVLPEYPPA-DVPAPDQTDSSGQKKPDPFKIWAQSRSMYEDRP------MSPSPASGLSKGERDREINSTNFGECQIPDYQEQDIFLWRKET-GFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRRKVVFTVPKAENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIGSGGGGGSGVVSAVLQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIAT--ITTTHAPSQQGTQETRTTTKPKPDSQFE---FKGPQATQEQ 1147          

HSP 2 Score: 61.2326 bits (147), Expect = 3.706e-8
Identity = 35/108 (32.41%), Postives = 60/108 (55.56%), Query Frame = 2
Query: 1376 PDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            PD+ +E K     + +Q Q+  +V+L R   KGFGF L GG E    +Y+  +  +GP ++CG +  GD I++IN  +T+   HS  + L+    K+   ++ L +R+
Sbjct: 1132 PDSQFEFKGP---QATQEQDFYTVELERG-AKGFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEILEINGETTKNMKHSRAIELI----KNGGRRVRLFLRR 1231          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. TrEMBL
Match: A0A077Z874 (Membrane associated guanylate kinase, WW and PDZ OS=Trichuris trichiura OX=36087 GN=TTRE_0000410101 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.878e-41
Identity = 153/525 (29.14%), Postives = 235/525 (44.76%), Query Frame = 2
Query:  503 AERFDVVLKKGNQGFGLTLV-DDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKIIQASRMRSHHNPNYDMI--NFYLQKTEG--GFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCR----NVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLKTIKYELPR 2050
             E    VL KG++G G TLV  D      + L++K++   GPA K G ++ GD+L   N   ++G   DEVI++F+L+   + + L V +      +    +P+ D +  N YL   +G  GFGF + +     +V KV        LL+  D +  +    +    H  +V +L+  P        V R    +++S                    I+  +D                + P+      F SL R  +     P+  K   Q      TPS++     S  P+++P T Y     + + Y    + V+V L R PT GFGFRL+GG EEG  V +G ++P G   Q G +   D I++I+        H E V L+ +A++   G++ L VR+ R E    I   L    D R    +V + R   E FGFVI+S+VN      IGRI  GS A +C  L +GDRILAVNG     + + D++ +IK S   + +TV   D  R   + + L R
Sbjct:  167 GEMVTAVLVKGHKGLGFTLVGSDGTSRGQEFLQIKSVLPGGPAYKDGRLRMGDVLVFVNDTCVLGYSQDEVIRVFQLISVGQQVTLQVCR--GYPLLFDPCDPSTDFVTQNAYLHIVKGDMGFGFTIADSPYGQKVKKVLDRPRCHGLLE-GDILCQVNGRDVRRLNHAAIVDVLRDCP--------VGRQVAMVVQS-------------------GITSQVD---------------TSRPEHPVGHLFASLPRSKTPGAAPPKPAKPNAQNGGRTRTPSSSYF--ASATPNYVPATVY-----SNLAY----DYVTVNLLRHPT-GFGFRLLGGTEEGSHVRVGQLVPGGAASQDGRLRFNDEIVEIDGQCILNCGHQEAVDLMSDASR--RGRVKLVVRRPRTEFPRSISMPLS-SSDVRAYPFDVTVVRRENEGFGFVIISSVN-RAGSAIGRIINGSPAARCGRLRVGDRILAVNGIGILKMPHGDIVNLIKDSGYAVTLTVGSPDGGRFVFVTFFLLR 630          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. TrEMBL
Match: F1KSV9 (Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.202e-40
Identity = 150/530 (28.30%), Postives = 247/530 (46.60%), Query Frame = 2
Query:  530 KGNQGFGLTLV-DDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVW-----------KII--QASRMRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNG--------TGDVQLLLKT----NDKITNIGRVRIDHF---PHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENC-------KTLRQIPSSYST--PSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIH--GSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            KG +G G TL+ +D    + + L++K+I   GPA + G++  GD+L   N   ++G       ++F+ +   ES+ L V            KI+   A   RSH     D     ++K + GFGF +       +V K+           GD  L ++T           G+  + +F   PH ++V++L+  P   +    V R +          +F+  +    + + S   R+  P      P    S P   P   P  H LSL    +   + P N         T  +I  ++S   PS+  +   +  P+++P T           ++   ETV+V L R P  GFGFR++GG EEG  + +G I+P G   + G +  GD II+I+  +   ++H+  V L+ ++A  ANG + L VR+ +  P S       L V  +  +V+LTRS  + FGFVI+S+VN      IGRI  GS A +C +L +GDR++AVNG     L + +++ +IK S L++ +T+
Sbjct:  383 KGPKGLGFTLIGNDGSSIHEEFLQIKSIIPGGPAHRDGVLHMGDVLVYVNNECVLGATQSHACRIFQAINIGESVTLQVCRGYPLMLDPTNKIVTENAYAPRSH-----DEKEILIKKGDDGFGFTIFESLQGQRVKKILYPERCENLLEGDTLLEMRTTYPNGSPSKPFGQEVVTNFRGMPHHELVSVLRDCPVGFWAKLIVRRHSPRHRSRTPTAAFRYGE-QRGTPVPSLAPRSKTPAPQPPRPVKTYSSPSTLP---PVPHSLSLENGVAGGYYNPRNTIPRQHERGTHEEIYENFSRVRPSSTSLGFAT--PNYVPMTAL---------FNDGSETVTVNLIRKP-NGFGFRVVGGTEEGTCITVGQIVPGGAAAEDGRMRQGDEIIEIDGKNVVGESHATAVQLMQQSA--ANGHVKLIVRRQKEVPRSTSMPLNQLNVVLNTYDVVLTRSDHDGFGFVIISSVNKNGST-IGRIMEGSPAARCGQLRVGDRVIAVNGIDILSLAHNEIVNLIKDSGLSVRLTI 888          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. TrEMBL
Match: A0A3Q2XBK5 (Membrane associated guanylate kinase, WW and PDZ domain containing 3b OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 2.931e-38
Identity = 150/551 (27.22%), Postives = 250/551 (45.37%), Query Frame = 2
Query:  503 AERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTV---WKIIQASRMRSHHN-----PNY------------DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVR----DTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQ-ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVR-----KSRH-------EPHSGIHGSLKVER---------DCRNVLLTRSPEEEFGFVIV-SAVNPTE---PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
             + +   LKK +QGFG T++     D  + L+VK ++ DGPA     +  GD++   N + ++G    EV++MF+ +   + + + +   + +     + + H      PN             ++++  L K  GGFGF + +C    +V  +    D Q    L+  D I  I R  +    H QVV +LK FP    +   V+R         ++ +S   F    ++ +S ++    R + PL   Q P   ++ P   P   P TH                          S + P++++ P    Q D         +K + +  ++P  + + V L R    GFGFR++GG      VYIGAI+PNG  ++ G +  GD +I I+    + ++H +V+ L+  AA+  NG++ LTVR     + RH       E  + ++GS K+ R         +  ++ L R   E FGFVI+ S   P     P  IGRI  GS  ++C  LH+GDRI AVNG S   L + D++++IK +   + +TV
Sbjct:  395 GDMYRTALKKSSQGFGFTIIGGDRTD--EFLQVKNVFSDGPAANDNKMASGDVIVEINGLCVLGKTHPEVVQMFQSIPVNQYVDMVLCRGYALPPDVDLDTLHGVVAALPNGRQGESATGMLHPELVSVPLIKGPGGFGFAIADCPLGQKVKMIL---DAQWCRDLQKGDVIKEINRENVQTLSHAQVVDILKDFPVGSEVDVLVLRGGQTSPVKSLKPVSRHVFLPPLWNQHSVLFPTRRRWM-PLAI-QFPRHCLTTPTRAPCAPPTTH-------------------------QSGTPPNSDVSPSSPSQFD---------QKPSCLSSTEPHTKDIDVFLKRDIETGFGFRVLGGEGPQQPVYIGAIVPNGAAEKDGRLRAGDELIGIDGVMVKGRSHKQVLDLMTNAAR--NGQVMLTVRRKVIYRGRHATDEEAQEMPTLVNGSPKLPRLPMPSALDHESFDITLHRKESEGFGFVILTSKSRPPHGVIPHKIGRIIEGSPTDRCGLLHVGDRISAVNGRSILELSHNDIVQLIKEAGNVVTLTV 902          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. TrEMBL
Match: A0A0N4U6S4 (Uncharacterized protein OS=Dracunculus medinensis OX=318479 GN=DME_LOCUS7002 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.865e-37
Identity = 142/518 (27.41%), Postives = 238/518 (45.95%), Query Frame = 2
Query:  530 KGNQGFGLTLV-DDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKIIQ-------ASRMRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNG--------TGDVQLLLKTN-----DKITNIGRVRIDH--FPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFL---SLHRQDSTKLFQP--ENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            KG +G G TL+ +D      + L++K +   GPA + G+++PGD+L   N   ++G       ++F+ +   E + L V +  Q          + + +    D     ++K E GFGF +       +V K+           GD  L ++T+        T+I    ID    PH Q+V++L+  P   + H  V R++ N         F+  +   ++ + S + R+  P                 P   P +H     +L RQ    +     EN   LR  PSS S   A         P+++P         N + Y+   ETV+V L R P  GFGFR++GG+EEG  + IG ++P G     G +  GD I++I+  +   ++H+  V L  +AA  ANG + L VR+ +    S     +       +V+L R+  + FGFVI+S+ N      IG+I  GS A +C +L +GDR++AVNG     L + +++ +I+ S L++ +T+
Sbjct:  165 KGVKGLGFTLIGNDGSSLYEEFLQIKNVIPGGPAHRDGVLRPGDVLVFVNNECVLGATQSHACRIFQSINVGEMVSLRVCRGYQLFIDPCNKIVLENAYTKFQDEREILIRKGEDGFGFTIFESLQGQRVKKILYPERCENLLEGDTLLQIRTSYPNGSPTSTDIQEQIIDFRGMPHHQLVSILRDCPVGFWAHLLVRRNSPNHRSRTPTAGFRYGE-QRSTPVPSVMPRSRTP----------------APQPTPGSHSNPRNTLPRQYEKHIINDTYENLSHLR--PSSTSLGFAT--------PNYVP--------INPV-YNDSSETVTVNLIRKP-NGFGFRIVGGSEEGTMITIGQVVPGGAAADDGRLRPGDEIVEIDGKNVLGESHNTAVQLTQKAA--ANGHVKLVVRRPKECRRSAFSSDVNTLLTTYDVVLHRNETDGFGFVIISSANRIGST-IGKIIEGSAAARCGQLMIGDRVMAVNGIDIMNLPHNEIVDLIRDSGLSVRLTI 642          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. TrEMBL
Match: A0A3B5MNY1 (Membrane associated guanylate kinase, WW and PDZ domain containing 3b OS=Xiphophorus couchianus OX=32473 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 2.266e-37
Identity = 156/552 (28.26%), Postives = 254/552 (46.01%), Query Frame = 2
Query:  431 FCTNRHMYSSLNSDP-KIKSYLYHIAERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKIIQASRMRSHHNP-NYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRD-TTNLIRSISNESFQNMDYSMNSSIYSKISRN-IDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQP--ENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKS---RHEPHSG-----IHGSLKVER---------DCRNVLLTRSPEEEFGFVIVSAVNPTE----PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            FC    +     +DP ++K  +YH A      LKK +QGFG T++     D  + L+VK +  DGPA     +  GD++   N   ++G    EV++M++ +   + + + + +       +  H     ++++  L K  GGFGF + +C    +V  +    D Q    L+  D I  I R  +    H QVV +LK FP    +   V+R   T+ ++S+                   +S+N + PL Y   P   IS    +  F+  T  L     D+T    P   N  TLR    S  +P  +             + + +SK      Y++    + V L R    GFGFR++GG      VYIGAI+P+G  ++ G +  GD +I I+    + ++H +V+ L+  AA+  NG++ LTVR+    R E         ++GS K+ R         +  ++ L R   E FGFVI+++ +       P  IGRI  GS  ++C  LH+GDRI AVNG S   L + D++++IK +   + +TV
Sbjct:  391 FCKGSML--GFTADPSQLKGEMYHTA------LKKSSQGFGFTIIGGDRTD--EFLQVKNVLSDGPAALDNKMASGDVIVEINGTCVLGKTHPEVVQMYQSIPINQYVDMVLCRGYPLPPDQPLHGMLQPELVSVPLVKGPGGFGFAIADCPLGQKVKMIL---DAQWCRGLQKGDVIKEINRQNVQSLSHAQVVDILKDFPVGSEVSVLVLRGGQTSPVKSLK-----------------PVSKNALFPLSYPLFPHGDISFNLISKHFVLHTETLDTI-ADATPQALPYHSNTSTLR----SSDSPKRDAT-----------EMYLKSKALLEKPYTK---DIDVFLKRDIETGFGFRVLGGEGPQQPVYIGAIVPSGAAEKDGRLRAGDELIGIDGVMVKGRSHKQVLDLMTNAAR--NGQVMLTVRRKVIYRDEDIQEMTPVLVNGSPKLPRLPMPSALDHESFDITLHRKENEGFGFVILTSKSKPPYGVIPHKIGRIIEGSPTDRCGLLHVGDRISAVNGRSIIELSHNDIVQLIKEAGTVVTLTV 891          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Cavefish
Match: wu:fi36a10 (wu:fi36a10 [Source:ZFIN;Acc:ZDB-GENE-030131-6139])

HSP 1 Score: 153.295 bits (386), Expect = 1.405e-37
Identity = 145/548 (26.46%), Postives = 238/548 (43.43%), Query Frame = 2
Query:  518 VVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK-----------------IIQASRMR--SHHNPNY------DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRD-TTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQET--VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKS-------------RHEPHSGIHGSLK---------VERDCRNVLLTRSPEEEFGFVIVSAVNPTEPC----GIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
              L+K  QGFG T++     D  + L+VK + +DGPA +   I  GD++   N   ++G    +V++MF+ +   + + + + +                  +Q  +++      P        ++++  L K  GGFGF + +C    +V  +      + LLK  D I  I R  +    H QVV +LK  P    ++  V+R   T+ ++S+                                       PC     I   H +S +   S    QPE       IP S   P  N++   S  P   P   Y   K+  I  S+P  T  + V + R+   GFGFR++GG      VYIGAI+P G  ++ G +  GD ++ I+    + K+H +V+ L+  AA+  NG++ LTVR+               H   + ++GS K          + +  ++ L R   E FGFVI+++ N   P      IGRI  GS  ++C +L +GDRI AVNG S   L + D++++IK +   + +TV
Sbjct:  412 TALRKSPQGFGFTIIGGDRPD--EFLQVKNVLRDGPAAQDNKISSGDVIVDINGTCVLGKTHADVVQMFQSISINQYVDMVLCRGYPLPEDAGTSDDGTGDAVQPPQLQDVQPRAPELSTLLQPELVSVPLVKGPGGFGFAIADCPLGQKVKMILDAQWCRGLLK-GDVIKEINRQNVQTLSHAQVVDILKDLPVGAEVNVLVLRGGQTSPVKSLK--------------------------------------PCAAAMPITQKHEISTNTVSSESPSQPE------PIPQSLPFP-PNMV--RSSSPKLDPSELY--LKSKAILDSKPSNTKELDVFIKRNQESGFGFRVLGGEGPDQPVYIGAIVPLGAAEKDGRLRAGDELLCIDGIPVKGKSHKQVLELMTNAAR--NGQVMLTVRRKLTYTDGKEEDSGPAHIAPAQVNGSPKPPHIEVPSPSQPEPYDITLQRKDNEGFGFVILTSKNKPPPGVIPHKIGRIIEGSPTDRCGKLKVGDRISAVNGQSIVDLSHNDIVQLIKQAGNTVTLTV 905          

HSP 2 Score: 62.7734 bits (151), Expect = 1.632e-9
Identity = 79/320 (24.69%), Postives = 125/320 (39.06%), Query Frame = 2
Query: 1421 SQPQETVSVQLTRSPTKGFGFRLMGGAEE---GCQVY-IGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIH-------------GSLKVERDCRNVLLTRS-------------PEEEFGFVIVSAVNPTEPC----------GIG----------------RINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLKTIKYELPRHSSPELQFTETPE-----TFSDLPTQPVSIMKPISQFDKQIFRT-FQQTPDEVL 2194
            SQP E   + L R   +GFGF ++    +   G   + IG II   P D+CG +  GD I  +N  S    +H+++V L+ +A  +    L +   +    P SG               G     RD RN L T               P+ E G +I S   P + C          G G                R+     A K   +H+GD+I+ +NG  T+G+ +   I++I+     + + +R G        + ++P H+  E+  T  P      +  D P+ P S+  P     +  F T +   PDE L
Sbjct:  816 SQP-EPYDITLQRKDNEGFGFVILTSKNKPPPGVIPHKIGRIIEGSPTDRCGKLKVGDRISAVNGQSIVDLSHNDIVQLIKQAGNTVT--LTVLPEEEHSGPPSGTSSAKQSPASQHKAVGQQAASRDDRNGLETEERKEGVAWTEYKSLPKSEMGTMITSG--PKQGCFLVELERGARGFGFSLRGGKEYNMGLFILRLAEDGPALKDGRIHVGDQIVEINGEPTQGITHTRAIELIQAGGTKVLLLLRPG--------QGQIPDHNVKEMTTTGPPANILRYSAPDEPSMPASLSSPSLSPSEGTFSTSWISVPDEHL 1122          

HSP 3 Score: 55.8398 bits (133), Expect = 2.228e-7
Identity = 62/240 (25.83%), Postives = 105/240 (43.75%), Query Frame = 2
Query: 1394 SKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTL-------------------LDEAAKSANGKLNLTVRKSRH---EPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIG-RINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV---RDGDINRLKTIK 2035
            S K  T   SQ Q  +     R   +GFGF ++GG      + +  ++ +GP  Q   I+ GDVI+DIN T    KTH++VV +                   L E A +++      V+  +    +P +    +L ++ +  +V L + P   FGF I         C +G ++     A+ C  L  GD I  +N  + + L +  V+ I+K   +  E+ V   R G  + +K++K
Sbjct:  394 SGKGFTRDPSQLQGAILRTALRKSPQGFGFTIIGGDRPDEFLQVKNVLRDGPAAQDNKISSGDVIVDINGTCVLGKTHADVVQMFQSISINQYVDMVLCRGYPLPEDAGTSDDGTGDAVQPPQLQDVQPRAPELSTL-LQPELVSVPLVKGP-GGFGFAIAD-------CPLGQKVKMILDAQWCRGLLKGDVIKEINRQNVQTLSHAQVVDILKDLPVGAEVNVLVLRGGQTSPVKSLK 624          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Cavefish
Match: magi3b (membrane associated guanylate kinase, WW and PDZ domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-060503-301])

HSP 1 Score: 148.288 bits (373), Expect = 5.115e-36
Identity = 158/598 (26.42%), Postives = 262/598 (43.81%), Query Frame = 2
Query:  470 DP-KIKSYLYHIAERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKL--------------------VKEKESIVLTVWKIIQAS----RMRSHHNPNY--DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQ-ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKS---RHEPHSG--------------IHGSLK---------VERDCRNVLLTRSPEEEFGFVIVSAVNPTEPC----GIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV--RDGDIN-RLKTIKYELPRHSSPELQFTE 2080
            DP ++K  LYH A      L+K +QGFG T++     D  + L+VK +  DGPA     +  GD++   N   ++G    +V++MF+                     V+E    V+T   +I       +  +H       ++++  L K  GGFGF + +C    +V  +      + LLK  D I  I R  +    H QVV +LK+ P    ++  V+R      R    ES  ++  ++ SS          P    +M                           ST L   + C  +   P + +  S+ L P  S + D    + + +K   T+  + PQ + + V + R    GFGFR++GG      VYIGAIIP G  ++ G +  GD ++ I+  + + K+H +V+ L+  AA+  NG++ L+VR+    R E                  ++GS +         ++ +  ++ L R   E FGFVI+++ +   P      IGRI  GS  ++C  L +GDRI AVNG S   L + D++++IK +   + +TV   DG+ N  ++ ++ EL       L  TE
Sbjct:  341 DPTQLKGDLYHTA------LRKSSQGFGFTIIGGDRPD--EFLQVKNVLADGPAAHDNKMSSGDVIVEINGALVLGKTHADVVQMFQCIPINQYVDMVLCRGYSLPPDVEEDMGEVVTAVPLINGQPLLVKGETHEGAMLQPELVSVPLVKGPGGFGFAIADCPLGQKVKMILDAQWCRGLLK-GDVIKEINRQNVQTLSHAQVVDILKELPVGSEVNLLVLRGGE---RETKRESLGHLVMTVFSS---------SPFQRQEM---------------------------STSLEALDRCHDV-GAPQALTYYSSTL-PCSSPRRDT---SLHRTKPKATVDTTLPQYKELDVFIKRDQETGFGFRVLGGEGPEQPVYIGAIIPQGAAEKDGRLWAGDELMGIDGITVKGKSHKQVLDLMTNAAR--NGQVLLSVRRKVIYRGEFRDNDDEDDGVQSVAPVLVNGSPRPPRIQVPSVLDHESFDITLHRKDSEGFGFVILTSKSKPPPGVIPHKIGRIIEGSPTDRCGLLSVGDRISAVNGQSIIELSHNDIVQLIKDAGHTVTLTVVPEDGEYNLDMEEMRDELAWAEYKTLPITE 883          

HSP 2 Score: 62.7734 bits (151), Expect = 1.526e-9
Identity = 57/235 (24.26%), Postives = 106/235 (45.11%), Query Frame = 2
Query: 1433 ETVSVQLTRSPTKGFGFRLMGGAEE---GCQVY-IGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSA-------NGKLNLTVRKSRHEPHSGIHGSLKV-----------ERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGD---INRLKTIKYELPRHSSP 2062
            E+  + L R  ++GFGF ++    +   G   + IG II   P D+CGL++ GD I  +N  S  + +H+++V L+ +A  +        +G+ NL + + R E     + +L +           ++ C  V L R     FGF +           I R+     A     + +GD+I+ +NG  T+G+ +   I++I+     + + +R G     +  +++  E P  S P
Sbjct:  767 ESFDITLHRKDSEGFGFVILTSKSKPPPGVIPHKIGRIIEGSPTDRCGLLSVGDRISAVNGQSIIELSHNDIVQLIKDAGHTVTLTVVPEDGEYNLDMEEMRDELAWAEYKTLPITEKGTLCVTGSKQGCILVELERG-SRGFGFSLRGGTEYNMGLYILRLAEDGPALLDGRIQVGDQIVEINGEPTQGISHTRAIELIQAGGNKVLLLLRPGQGLVSDNSESVYPEFPTASEP 1000          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Cavefish
Match: magi2a (membrane associated guanylate kinase, WW and PDZ domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-050810-4])

HSP 1 Score: 116.316 bits (290), Expect = 3.978e-26
Identity = 77/248 (31.05%), Postives = 122/248 (49.19%), Query Frame = 2
Query: 1376 PDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHE-----PHSGIH-GSLKVERD---------------------------CRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            PD +    K+  +  S+  + V V L R    GFGFR++GG E G  + IGAII N P D+ G +  GD ++ ++      K H  V+ L+  AA+  NG++ +T+R+         P +G   GS+  +                               +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRILAVN  S   + + D++K+IK + L++ + +
Sbjct:  558 PDPYDLYAKSRAMYESRQFQEVEVNLRRE-KSGFGFRILGGEEAGQPILIGAIIENSPADKDGRLRPGDELLSVDGIPVAGKPHRYVIDLMHGAAR--NGQVKMTIRRRAQNTGDQCPQNGRSPGSISTQHSSPRSDLNSGTFSNNSAPTEMAANQSLQASDVIIQRKESEGFGFVIISSLNRPETAAAAAVPHKIGRIIEGSPADRCGKLKVGDRILAVNNQSIVSMAHADIVKLIKDAGLSVTLRI 802          

HSP 2 Score: 54.6842 bits (130), Expect = 4.072e-7
Identity = 39/133 (29.32%), Postives = 65/133 (48.87%), Query Frame = 2
Query: 1301 RQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            RQ+P+    P +  +PD  QQ DF  D F                  +V+L +S  KGFGF + GG E    +++  +  +GP  + G +  GD II+IN  +T + TH+  + L+    KS   ++ L +++
Sbjct:  904 RQLPTD---PRSFALPDYRQQQDF--DFF------------------TVELDKS-VKGFGFSIRGGREYKMDLFVLRLAEDGPAIRNGRMRVGDQIIEINGETTREMTHARAIELI----KSGGRRVRLLLKR 1008          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Cavefish
Match: magi2b (membrane associated guanylate kinase, WW and PDZ domain containing 2b [Source:ZFIN;Acc:ZDB-GENE-141211-6])

HSP 1 Score: 110.538 bits (275), Expect = 2.666e-24
Identity = 70/209 (33.49%), Postives = 109/209 (52.15%), Query Frame = 2
Query: 1433 ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCR-------------NVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            + V V L R  T GFGFR++GG E    + IGAII N P ++ G +  GD ++ ++      + H  V+ L+  AA+  NG++ LTVR+    P      +       R             +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C +L +GDRI+AVN  S   + + D++K+IK + L + + +
Sbjct:  777 QEVEVHLLREKT-GFGFRILGGDEAVQAIVIGAIIENSPAERDGRLRPGDELVSVDRMPVAGRPHRYVIDLMHAAAR--NGQVTLTVRRRVLPPQPKNGAATNQSSSPRGHAVCPVNLPPTTDVVIHRKETEGFGFVIISSLNRPENTTTISVPHKIGRIIEGSPADRCGKLKVGDRIMAVNSQSIINMPHADIVKLIKDAGLTVTLHI 982          

HSP 2 Score: 70.0922 bits (170), Expect = 8.311e-12
Identity = 95/425 (22.35%), Postives = 173/425 (40.71%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKII------------QASRMRSHH------NPNYDMINFYLQKTEGGFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNS-SIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKT----LRQIPSSYSTPSANLIPDVSQQP--DFIPDTFYESKKTNTIKYSQPQET--VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAK 1663
            +  +V L +   GFG  ++     + ++ + + AI ++ PA + G ++PGD L + +++ + G     VI +         + LTV + +            Q+S  R H        P  D++  + ++TEG FGF++ +  +           H++ ++      D    LK  D+I  +    I + PH  +V L+K       LH     D +    + ++E    +    +S    S  +    P   +  P      P  T             RQD     +P+ C+      RQ P  Y  P    + D  Q P  D+         + ++I   +PQ+    +V+L +S  KGFGF + GG E    +++  +  +GP  + G +  GD II+IN  ST   +H+  + L+    +
Sbjct:  777 QEVEVHLLREKTGFGFRILGG--DEAVQAIVIGAIIENSPAERDGRLRPGDELVSVDRMPVAGRPHRYVIDLMHAAARNGQVTLTVRRRVLPPQPKNGAATNQSSSPRGHAVCPVNLPPTTDVV-IHRKETEG-FGFVIISSLNRPENTTTISVPHKIGRIIEGSPADRCGKLKVGDRIMAVNSQSIINMPHADIVKLIKDAGLTVTLHIIPEEDVSGPHSAPTSEKQSPLVGQKHSPQTQSSPAAQQSPTVVHPSPPAPHPSPATTQPSPQLVESEVKARQD----VKPDICQPPYTDYRQPPVDYRHPP---VADYRQPPTMDYRHPPPLIDYRQHSIPDYRPQDYDYFTVELEKS-VKGFGFSIRGGREYKMDLFVLRLAEDGPAIRNGRMRVGDQIIEINGESTRDMSHARAIELIKAGGR 1189          

HSP 3 Score: 51.9878 bits (123), Expect = 2.855e-6
Identity = 33/90 (36.67%), Postives = 49/90 (54.44%), Query Frame = 2
Query: 1382 TFYESKKTNTIKYSQPQET-VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            T Y  K   T   +Q + T +S  L +S + GFGF ++GG E    + + ++IP GP  Q G +  GDVI+ IN+      TH++VV L 
Sbjct:  407 TIYREKPPFTRDATQLKGTFLSTALQKS-SMGFGFTIIGGDEPDEFLQVKSVIPEGPAAQDGKMATGDVIVYINDICVLGTTHADVVKLF 495          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Cavefish
Match: magi1a (membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1-like [Source:NCBI gene;Acc:103040795])

HSP 1 Score: 99.7525 bits (247), Expect = 6.568e-21
Identity = 107/451 (23.73%), Postives = 178/451 (39.47%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL-------LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNES--FQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEE--------FGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLKTIKYELPRHSSPELQFTETPETFSDLPTQP 2116
            ++I  +++K + GFGF + +C          G    Q++       LK  D +  + +  +    H+QVV LL K PR   +   V R     + + +  S   +  D S  SS +S  S       +   P   +            +        + T   +P+  K   Q  S Y +     +PD  +Q     D F   K T                      GFGFR++GG E G  +YIG I+  G  D+ G +  GD +I ++ T+   K+H  VV L+ +AAK   G +NLTVR+      S     L        +  T +P+          FGF +           + R+     A +  ++ +GD IL +NG ST+ + +   I++IK+      + ++ GD +     +Y+ P    P       P+  S++ T P
Sbjct:  597 ELITVHMEKGDKGFGFTIADCGS----GTCGGQKVKQIVDYPRCRGLKEGDILVEVNKRNVQSMSHNQVVDLLSKCPRGSEVTMLVQRGKNRPLPAAAPRSCPLERKD-SQGSSQHSVCSHRS---THTDSPARAVP--------PLPSLPPLEPPANGTLQKKPDPFKIWAQSRSMYES----RMPDSQEQ-----DIFLWRKDT----------------------GFGFRILGGNEPGEPIYIGHIVKYGAADEDGRLRSGDELICVDGTAVVGKSHQLVVQLMQQAAK--QGHVNLTVRRKTGYGESSNASLLTNAEKIATITTTHTPQSSSEPRDSKGFGFSLRGGKEYNMDLYVLRLAEDGAAVRNGKMRVGDEILEINGESTKNMKHSRAIELIKNGGRRARLVLKRGDGS---VPEYDGPNDGYPA---PPGPQNLSEMRTMP 992          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003180.1 (pep scaffold:Pmarinus_7.0:GL477326:20216:45383:1 gene:ENSPMAG00000002903.1 transcript:ENSPMAT00000003180.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.298e-16
Identity = 68/301 (22.59%), Postives = 128/301 (42.52%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNL-IRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGI---GISGPCNTPDFI--PATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK 1699
            ++++  + K   GFGF + +     ++ ++  +    L L+  D I  I    +    H  VVTLLK+          + R   +L   S   ++++  D          ++R+  P  ++Q P +   GI+ P   P +   PA  F    RQ+++++++                                P + YE  +    +     + +++ L R    GFGFR++GG E G  + IGAI+P G  D  G +  GD ++ ++      K+H  V+ L+ +AA+  NG + LT+ +
Sbjct:  230 ELVSVKIVKGRAGFGFTIADSPSGQRIKQILDS-RRGLELREGDLILEINGRSVRECSHMDVVTLLKECATGAQASMLLQRGEVDLPAASQMQQAYERHDSQ------GSLTRDSPPRRFSQPPALPPAGIAPPHAQPSYRRPPAEEFRG--RQEASRVYED-------------------------------PQSLYEDSQRVCARAGNSYQEITIHLRRQ-EAGFGFRILGGEELGQPIRIGAIVPGGSADLDGRMRSGDELVSVDGIPVSGKSHRSVIGLMQQAAR--NGLVALTIHR 487          

HSP 2 Score: 48.1358 bits (113), Expect = 9.371e-6
Identity = 35/115 (30.43%), Postives = 51/115 (44.35%), Query Frame = 2
Query: 1304 QIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            ++PS  ST     IP V+      P T +     N    SQ  E    +L R  T GFGF + GG E    ++I  +   GP  +   +  GD I++IN  ST    H+  + L+
Sbjct:  667 RLPSITSTSVLTFIPSVA---SLDPSTLF----NNLYLCSQDGEYFVAELERGNT-GFGFSIRGGKEYSMDLFILRVAEEGPAIRQSRMRVGDQIMEINGESTRDMMHARAIELI 773          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001444.1 (pep scaffold:Pmarinus_7.0:GL476357:122445:266872:1 gene:ENSPMAG00000001288.1 transcript:ENSPMAT00000001444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 1.341e-15
Identity = 76/246 (30.89%), Postives = 111/246 (45.12%), Query Frame = 2
Query: 1433 ETVSVQLTRSPTKGFGFRLMGGAEE----GCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTST-EKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHE-PHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVN--PTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLK-----TIKY--ELPRHSSPELQFTETPETFSDLPTQPVSI 2125
            E+V++ L      GFG  L GG       G  + IG I P+ P ++CGL+  GD I+ +N   T E  + +EV   L E A   +  L +    +    P SG            +V L +    E G  I S  +  P+EP  I  I  GSVA +   L  GDR+LA+N +  E     + + I++ SD  +++ VR  + N  +      I Y  EL RH  P L  T    + +D PT P+ I
Sbjct:  338 ESVALHLASDGGPGFGLHLQGGTFSTDVFGAPLLIGYIEPDSPAERCGLLQPGDRILSVNGIPTAELGSLAEVSQYLHEQALVGSASLEVEFDVAESVIPSSGTF----------HVTLPKKKGVELGITITSPTHRKPSEPLVITEIKKGSVAHRLGTLEPGDRLLAINHTRLETSSVDETVHILQQSDDFVKLKVRKDEDNSDEQEASGAISYSVELRRHGGP-LGIT---ISGTDEPTDPILI 569          

HSP 2 Score: 53.5286 bits (127), Expect = 2.051e-7
Identity = 44/177 (24.86%), Postives = 77/177 (43.50%), Query Frame = 2
Query: 1475 FGFRLMGGAEEGCQ----VYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCG------IGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHS 1975
            FGF + GG +   +    + +  +   GP D+ G +  GD ++ +     +  +  E   +L ++ + A   +   V  S  E      G L VE       + ++     G  +       E CG      I +I P S+AE+C  LH+GDRIL+V+GS  E +  ++   ++  S
Sbjct:   23 FGFVVRGGVQSDKKKSRPIVVSHVRQGGPADRDGTLKAGDRLLAVEGIPVQGLSLCEASVVLKQSGQDARVLVEYDV--SVMESVQNATGPLLVE-------IRKTSGANLGISL-----SKESCGMKQIVVIDKIRPASIAERCGALHVGDRILSVDGSGVEQMSVEEASVLLACS 185          

HSP 3 Score: 51.2174 bits (121), Expect = 1.034e-6
Identity = 49/188 (26.06%), Postives = 84/188 (44.68%), Query Frame = 2
Query: 1556 QCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSR-----HEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLKTIKYELPRHSSPELQFTETPETFSDL 2104
            + G +  GD ++ IN+T  E  +  E V +L ++    +  + L VRK        E    I  S+++ R    + +T S  +E          PT+P  I  + P  +AE+   +H+GD+ILA++G S +G    + I +++          R G+I  LK  K    +  S    F + P T  D+
Sbjct:  483 RLGTLEPGDRLLAINHTRLETSSVDETVHILQQS----DDFVKLKVRKDEDNSDEQEASGAISYSVELRRHGGPLGITISGTDE----------PTDPILIASLTPDGLAERTGAIHVGDQILAIDGMSLKGKPLSEAIALLQ----------RAGEIVALKIKKRTAGQPQSANSAF-KAPGTLGDV 645          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010851.1 (pep scaffold:Pmarinus_7.0:GL477227:46102:76179:-1 gene:ENSPMAG00000009830.1 transcript:ENSPMAT00000010851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.580e-10
Identity = 47/180 (26.11%), Postives = 88/180 (48.89%), Query Frame = 2
Query: 1475 FGFRLMGGAEEGCQ----VYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGI-GRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            FGF + GGA E       + +  + P GP D+ G +  GD +++++  S    +H+E + +L E  + A  ++   V  S  +  +   G L VE       + ++P    G  + S  +  +P  I  +I P SVAE+C  LH GD+IL+++G+  E     +  +++  +  N+ + +
Sbjct:   19 FGFVIRGGAHEQRHKSRPILVTCVRPGGPADREGTLKAGDRLLNVDGMSLHGVSHAEALAILRECGQEATLQIEYDV--SIMDSVTNASGPLLVE-------VAKTPGSSLGVSLSSPGHLHKPTIIIDKIRPASVAERCGALHAGDQILSIDGTGMEHCSLLEATQLLASATDNVRLEI 189          

HSP 2 Score: 55.4546 bits (132), Expect = 5.793e-8
Identity = 55/193 (28.50%), Postives = 82/193 (42.49%), Query Frame = 2
Query: 1556 QCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHE---PHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAV--NPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINR-----LKTIKY--ELPRHSSP-ELQFTETPETF 2095
            +CG++  GD ++ +    TE+ T  EV  LL EAA  A G+  L V     E   P SG            +V L +    E G  I S       +P  I  +  GSVA +   L  GD++LA++G   +    +D   I++  D  + + +R  D N         I Y  EL R+  P  +  + T E F
Sbjct:  362 RCGVLQMGDRLLAVGGVPTEEATLDEVHQLLREAA--AGGRTRLQVEFDVAESVVPSSGTF----------HVKLPKRRGVELGITISSPAYRKAGDPLVISDVKKGSVAHRTGTLEPGDQLLAIDGVRLDHCSMEDAAHILRQGDELVRLKIRKDDDNSDELEGTGAISYTVELKRYGGPLGITISGTEEPF 542          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: lin7a (lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-040426-1665])

HSP 1 Score: 57.3806 bits (137), Expect = 1.144e-9
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 2
Query: 1469 KGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVR 1696
            +G GF +MGG E+   +YI  IIP G  D+ G +  GD ++ +N  S E + H + V LL    K A G + L VR
Sbjct:   88 EGLGFNIMGGKEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELL----KQAQGTVKLVVR 159          

HSP 2 Score: 53.5286 bits (127), Expect = 2.552e-8
Identity = 26/73 (35.62%), Postives = 43/73 (58.90%), Query Frame = 2
Query: 1784 EEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVR 2002
            +E  GF I+       P  I RI PG VA++   L  GD++L+VNG S EG H++  ++++K +   +++ VR
Sbjct:   87 DEGLGFNIMGGKEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKQAQGTVKLVVR 159          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: LIN7B (lin-7 homolog B, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17788])

HSP 1 Score: 56.6102 bits (135), Expect = 1.857e-9
Identity = 30/76 (39.47%), Postives = 41/76 (53.95%), Query Frame = 2
Query: 1469 KGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVR 1696
            +G GF +MGG E+   +YI  IIP G  D+ G +  GD ++ +N  S E + H   V LL    K A G + L VR
Sbjct:   78 EGLGFNVMGGKEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHERAVELL----KQAQGSVKLVVR 149          

HSP 2 Score: 52.373 bits (124), Expect = 4.687e-8
Identity = 25/73 (34.25%), Postives = 44/73 (60.27%), Query Frame = 2
Query: 1784 EEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVR 2002
            +E  GF ++       P  I RI PG VA++   L  GD++L+VNG S EG H++  ++++K +  ++++ VR
Sbjct:   77 DEGLGFNVMGGKEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHERAVELLKQAQGSVKLVVR 149          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO42539 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S157])

HSP 1 Score: 108.227 bits (269), Expect = 5.617e-24
Identity = 71/232 (30.60%), Postives = 112/232 (48.28%), Query Frame = 2
Query: 1472 GFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPH----SGIH---------------------------------------GSLKVER-------------DCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            GFGFR++GG E+  QV IG I+   P    G +  GD I+ ++  S     H +V++L+  AA+  NG++ L VR+ +  P     SG+                                        GS +  R             D R++ L R   E FGFVI+S+V+ +    IGRI  GS A++C EL++GD+++AVNG+S  G+H+ D++  IK S L++ + +
Sbjct:  693 GFGFRIVGGKEDNTQVAIGTIVDGTPAAADGRLRRGDEILYVDGVSVIDGYHRDVISLMKSAAQ--NGQVTLGVRRRQTMPGRSTPSGVRRTSQSNSVRLTSRSAGNLTELARRDEYEPNGFRSPSERAGSTRDRRRSESDKLQPDIPMDYRDITLNRGAHEGFGFVILSSVHKSGST-IGRIIQGSPADRCRELYVGDKLVAVNGTSIVGMHHSDIVNTIKQSGLSVTLRI 921          

HSP 2 Score: 54.299 bits (129), Expect = 2.347e-7
Identity = 23/60 (38.33%), Postives = 37/60 (61.67%), Query Frame = 2
Query: 1469 KGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            +GFGF ++GG + G  + I +I+P+G   + G +  GD +I +N  S   KTH EVV++ 
Sbjct:  352 RGFGFTIIGGDQSGELLQIKSIVPDGAAAKDGKLRTGDALIKVNGRSVVNKTHQEVVSMF 411          

HSP 3 Score: 49.2914 bits (116), Expect = 7.325e-6
Identity = 26/98 (26.53%), Postives = 49/98 (50.00%), Query Frame = 2
Query: 1370 FIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAK 1663
            F P    ES+     +  +  + + ++L R   +G+GF + GG E    +Y+  I   G  D  G I  GD +++IN  ST+   H++ ++++   +K
Sbjct: 1027 FKPRPKSESELMRDPRTGEVTQVLEIELIRK-NQGYGFSIRGGQEMDMPIYVLKIAEGGVADLDGRIKVGDEVLEINGRSTQHMLHTDAISMIRGGSK 1123          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 59.3066 bits (142), Expect = 6.623e-10
Identity = 49/199 (24.62%), Postives = 87/199 (43.72%), Query Frame = 2
Query: 1433 ETVSVQLTRSPTKGFGFRLMGG-----AEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCG-----IGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            ET+ + L R  + G GF + GG      ++   +YI  +IP G   Q G +   D I+ +N T+T    H + V    +A K+A  ++ L   K R    +            R  ++     +  GF I          G     I +I  G  A++   L +GD+I++VN  + E + ++D ++++K +   + I V
Sbjct:    3 ETLEITLERGGS-GLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAV----DALKAAGSQVTLVREKKRGNAPT------------REEIVLIKGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVV 184          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO34828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNC4])

HSP 1 Score: 56.225 bits (134), Expect = 2.594e-9
Identity = 35/114 (30.70%), Postives = 59/114 (51.75%), Query Frame = 2
Query: 1403 TNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSR---HEPHSGIHGS 1735
            T    YS  ++   V L + P +G G  L GG E G  +YI  ++P G    CG +   DVI+ +N  S ++ T+ E +++L    ++   ++ L V++SR   + P+ G  GS
Sbjct:   30 TQYTDYSAEEQPFEVHLIKGP-QGLGMSLTGG-ESGGPIYIKRLVPGGSAALCGQLQVNDVILQVNGKSLDRLTYREALSIL----RNCPPEVRLLVKRSRGSSYPPYPGYRGS 137          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO47722 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLN6])

HSP 1 Score: 56.225 bits (134), Expect = 6.207e-9
Identity = 27/66 (40.91%), Postives = 38/66 (57.58%), Query Frame = 2
Query: 1469 KGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKS 1666
            +G GF +MGG E+   +YI  IIP G  D+ G +  GD ++ +N  S E + H + V LL EA  S
Sbjct:  100 EGLGFNVMGGREQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGENHEKAVDLLKEAQGS 165          

HSP 2 Score: 47.7506 bits (112), Expect = 4.861e-6
Identity = 23/73 (31.51%), Postives = 42/73 (57.53%), Query Frame = 2
Query: 1784 EEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVR 2002
            +E  GF ++       P  I RI PG VA++   L  GD++L+VNG S EG +++  + ++K +  ++ + V+
Sbjct:   99 DEGLGFNVMGGREQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGENHEKAVDLLKEAQGSVRLVVK 171          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO45624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE9])

HSP 1 Score: 54.6842 bits (130), Expect = 4.486e-8
Identity = 44/169 (26.04%), Postives = 82/169 (48.52%), Query Frame = 2
Query: 1469 KGFGFRLMGGAEEGC-QVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKH 1972
            +G G  ++GG +     +YI  I P  P ++CG +  GD ++ +N+      TH+  + +L    K+    + LTV + + +P          + D   V L +  +   G  +   V  T    +  + P  VA K   +  GDR+L+VNG ST+GL +++V+ ++++
Sbjct:    7 QGIGLMVIGGLDTPLGMLYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVL----KNTPPLVKLTVARKK-DPDR--------DSDVFTVELKKDSKGSLGIHVSGGVG-TNCIDVRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQN 161          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Medaka
Match: wu:fi36a10 (membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 [Source:NCBI gene;Acc:101159504])

HSP 1 Score: 118.242 bits (295), Expect = 1.277e-26
Identity = 120/436 (27.52%), Postives = 188/436 (43.12%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRD-TTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQ---IPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQET--VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHG-------------------------SLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPC----GIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDIN 2017
            ++++  L K  GGFGF + +C    +V  +      + LLK  D I  I R  +    H QVV +LK       +   V+R   T+ ++S+               + + +S  +      Q        P   P  +P  H  S H     +     + +TL Q    P+S    S  L    S  P   PD      ++  I  S+P  T  + V + R+   GFGFR++GG      VYIGAI+P G  ++ G +  GD ++ I+    + K+H +V+ L+  AA+  NG + LTVR  R   H+ + G                          L    +  +V L R   E FGFVI+++ N   P      IGRI  GS  ++  ++ +GDRI AVNG S   L + D++++IK +   + +TV   D N
Sbjct:  593 ELVSVPLVKGPGGFGFAIADCPLGQKVKMILDAQWCRGLLK-GDVIKEINRQNVQTLSHSQVVDILKDLAVGSEVSVLVLRGGQTSPVKSLK-------------PVTAPVSHTVSQPVLEQ-------APLPVPQQLP--HPPSHHHLQQQQQEMISSTETLTQSDVTPNSLPVSSGTL---RSSSPK--PDASELYLRSKAILDSKPPNTKELDVFIKRNQESGFGFRVLGGEGPDQPVYIGAIVPYGAAEKDGRLRAGDELLCIDGIPVKGKSHKQVLELMTNAAR--NGHVMLTVR--RRLAHADVAGEEANGPQSQQVSSSPKMPRVEAPNSGLPTRPESFDVTLHRRDNEGFGFVILTSKNKPPPGVIPHKIGRIIEGSPTDRLGQMKVGDRISAVNGLSIMELSHNDIVQLIKDAGNTVTLTVVPEDDN 996          

HSP 2 Score: 51.9878 bits (123), Expect = 3.102e-6
Identity = 29/84 (34.52%), Postives = 48/84 (57.14%), Query Frame = 2
Query: 1445 VQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVR 1696
            V+L RS  +GFGF L GG E    +YI  +  +GP  + G I+ GD I++IN   T+  TH+  + L+    ++   +++L +R
Sbjct: 1056 VELERS-QRGFGFSLRGGKEYNMGLYILRLAEDGPALKDGRIHVGDKIVEINGEPTQGITHTRAIELI----QAGGNRVHLLLR 1134          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Medaka
Match: magi3b (membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 [Source:NCBI gene;Acc:101160155])

HSP 1 Score: 117.857 bits (294), Expect = 1.917e-26
Identity = 118/430 (27.44%), Postives = 189/430 (43.95%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRD-TTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQ-ETVSVQLTRSPTKGFGFRLMGGAEEGCQ-------VYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------SRHEPHSGIHGSLKVER---------DCRNVLLTRSPEEEFGFVIVSAVNPTE----PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            ++++  L K  GGFGF + +C    +V  +    D Q    L+  D I  I R  +    H QVV +LK FP    ++  V+R   T+ ++S+  +  Q +  SM +                 + G+  + P            L+ H           N  TLR                 S  P       Y   K   ++  QP  + + V L R    GFGFR++GG  EG Q       VYIGAI+PNG  ++ G +  GD +I I+    + ++H +V+ L+  AA+  NG++ L+VR+            +      ++GS ++ R         +  ++ L R   E FGFVI+++ +       P  IGRI  GS  ++C  LH+GDRI AVNG S   L + D++++IK +   + +TV
Sbjct:  584 ELVSVPLVKGPGGFGFAIADCPLGQKVKMIL---DAQWCRGLQKGDVIKEIDRQNVQTLSHAQVVDILKDFPVGSEVNVLVLRGGQTSPVKSL--KPRQELTASMET-----------------LDGVTDATP----------QALTYH----------SNTSTLRS----------------SDSPKREATEMYLKSKA-LLESRQPHTKDIDVFLKRDIETGFGFRVLGG--EGPQQPNVFPQVYIGAIVPNGAAEKDGRLRAGDELIGIDGVMVKGRSHKQVLDLMTNAAR--NGQVMLSVRRKVMYRDVADDEGQEMAPVLVNGSPRLPRIPMPSALDHESFDITLHRKDAEGFGFVILTSKSKPPHGVIPHKIGRIIEGSPTDRCGLLHVGDRISAVNGRSIIELSHNDIVQLIKDAGNVVTLTV 950          

HSP 2 Score: 55.0694 bits (131), Expect = 3.450e-7
Identity = 32/92 (34.78%), Postives = 52/92 (56.52%), Query Frame = 2
Query:  461 LNSDP-KIKSYLYHIAERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLV 733
              +DP ++K  LYH +      LKK +QGFG T++     D  + L+VK +  DGPA +   +  GD++   N++ ++G    EV+KMF+ V
Sbjct:  393 FTADPSQLKGELYHTS------LKKSSQGFGFTIIGGDRTD--EFLQVKNVLSDGPAAQDNKMASGDVIVEINRMCVLGRTHPEVVKMFQSV 476          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Medaka
Match: magi3b (membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 [Source:NCBI gene;Acc:101160155])

HSP 1 Score: 117.472 bits (293), Expect = 2.354e-26
Identity = 118/430 (27.44%), Postives = 189/430 (43.95%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLL--LKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRD-TTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQ-ETVSVQLTRSPTKGFGFRLMGGAEEGCQ-------VYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRK-----------SRHEPHSGIHGSLKVER---------DCRNVLLTRSPEEEFGFVIVSAVNPTE----PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            ++++  L K  GGFGF + +C    +V  +    D Q    L+  D I  I R  +    H QVV +LK FP    ++  V+R   T+ ++S+  +  Q +  SM +                 + G+  + P            L+ H           N  TLR                 S  P       Y   K   ++  QP  + + V L R    GFGFR++GG  EG Q       VYIGAI+PNG  ++ G +  GD +I I+    + ++H +V+ L+  AA+  NG++ L+VR+            +      ++GS ++ R         +  ++ L R   E FGFVI+++ +       P  IGRI  GS  ++C  LH+GDRI AVNG S   L + D++++IK +   + +TV
Sbjct:  584 ELVSVPLVKGPGGFGFAIADCPLGQKVKMIL---DAQWCRGLQKGDVIKEIDRQNVQTLSHAQVVDILKDFPVGSEVNVLVLRGGQTSPVKSL--KPRQELTASMET-----------------LDGVTDATP----------QALTYH----------SNTSTLRS----------------SDSPKREATEMYLKSKA-LLESRQPHTKDIDVFLKRDIETGFGFRVLGG--EGPQQPNVFPQVYIGAIVPNGAAEKDGRLRAGDELIGIDGVMVKGRSHKQVLDLMTNAAR--NGQVMLSVRRKVMYRDVADDEGQEMAPVLVNGSPRLPRIPMPSALDHESFDITLHRKDAEGFGFVILTSKSKPPHGVIPHKIGRIIEGSPTDRCGLLHVGDRISAVNGRSIIELSHNDIVQLIKDAGNVVTLTV 950          

HSP 2 Score: 55.0694 bits (131), Expect = 3.974e-7
Identity = 32/92 (34.78%), Postives = 52/92 (56.52%), Query Frame = 2
Query:  461 LNSDP-KIKSYLYHIAERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLV 733
              +DP ++K  LYH +      LKK +QGFG T++     D  + L+VK +  DGPA +   +  GD++   N++ ++G    EV+KMF+ V
Sbjct:  393 FTADPSQLKGELYHTS------LKKSSQGFGFTIIGGDRTD--EFLQVKNVLSDGPAAQDNKMASGDVIVEINRMCVLGRTHPEVVKMFQSV 476          

HSP 3 Score: 50.8322 bits (120), Expect = 7.349e-6
Identity = 26/73 (35.62%), Postives = 39/73 (53.42%), Query Frame = 2
Query: 1430 QETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            Q  ++V+L R P +GFGF L GG E    +YI  +  +GP    G I+ GD I++IN        H+  + L+
Sbjct: 1022 QGCLTVELERGP-RGFGFSLRGGTEYNMGLYILRLAEDGPAQMDGRIHVGDEIVEINGEPARGIYHTRAIDLI 1093          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Medaka
Match: magi2b (membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 [Source:NCBI gene;Acc:101173221])

HSP 1 Score: 116.316 bits (290), Expect = 6.009e-26
Identity = 119/452 (26.33%), Postives = 188/452 (41.59%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGD-VQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDF-IPDTFYESKKTNTIKYSQ-PQ-ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDC----------------------------------------------RNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            +++   + K   GFGF + +     +V +V   G      L   D I  + +  +    H +VV LLK+ P        V  + T LI+ +          S       ++  + DP   +  P   +SGP       P T F +          QP++  +               +PD ++  D   PD +   +K+  I  S+ P+ E V V L R  T GFGFR++GG E    + IGAII N P ++ G +  GD +I ++      K H  V+ L+  AA+  NG+++LTVR+    P +  HG       C                                               +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C  L +G+RILAVNG S   + + D++K+IK + L + + +
Sbjct:  622 ELLTVTMVKGAEGFGFTIADSPTGQRVKQVLEPGSQAASGLIEGDLILEVNQQPVAAAGHGRVVELLKECP--------VGAEATLLIQRVGTGHISPWKAS------KQLPDHWDP---HGSPQANLSGPV----LPPGTPFPN----------QPQHRTS---------------VPDSTEGFDLNKPDPYDLYEKSRAIYESRRPEYEEVEVHLLREKT-GFGFRILGGDEAVQAIVIGAIIENTPAERDGRLQPGDELISVDKNVVAGKPHKYVIDLMHAAAR--NGQVSLTVRRRVQMPAASPHGIFSAGEPCPVNGRSPGSVSTQHSSPRSDAASAAGPNAASVPVTAVAPEGSALQTSDVVIHRKENEGFGFVIISSLNRPENPTVITVPHKIGRIIEGSPADRCGRLKVGNRILAVNGQSIINMPHADIVKLIKDAGLTVTLHI 1024          

HSP 2 Score: 53.1434 bits (126), Expect = 1.594e-6
Identity = 27/86 (31.40%), Postives = 48/86 (55.81%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                L+K N GFG T++     D  + L+VK++  DGPA + G +  GD++   N I ++G    +V+K+F+ V   +S+ L + +
Sbjct:  433 LSTALQKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMDTGDVIVYINDICVLGTTHADVVKLFQSVPIGQSVTLVLCR 516          

HSP 3 Score: 52.373 bits (124), Expect = 2.628e-6
Identity = 26/74 (35.14%), Postives = 42/74 (56.76%), Query Frame = 2
Query: 1442 SVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAK 1663
            +V+L +S TKGFGF + GG E    +++  +  +GP  + G +  GD II+IN  ST   TH+  + L+    +
Sbjct: 1212 TVELEKS-TKGFGFSIRGGREYSMDLFVLRLAEDGPAIRNGRMRVGDQIIEINGDSTRDMTHARAIELIKAGGR 1284          

HSP 4 Score: 51.6026 bits (122), Expect = 4.016e-6
Identity = 33/90 (36.67%), Postives = 50/90 (55.56%), Query Frame = 2
Query: 1382 TFYESKKTNTIKYSQPQET-VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            T Y  K   T   +Q + T +S  L +S   GFGF ++GG E    + + ++IP+GP  Q G ++ GDVI+ IN+      TH++VV L 
Sbjct:  413 TIYREKPLFTRDPTQLKGTFLSTALQKS-NMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMDTGDVIVYINDICVLGTTHADVVKLF 501          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Medaka
Match: magi2b (membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 [Source:NCBI gene;Acc:101173221])

HSP 1 Score: 113.235 bits (282), Expect = 3.769e-25
Identity = 136/488 (27.87%), Postives = 208/488 (42.62%), Query Frame = 2
Query:  815 DMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSL--HRQ---DSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKK---TNTIKYSQPQ-ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPH-------------SGIHGSLKVER-----------------------DCRNVLLTRSPEEEFGFVIVSAVNPTE-------PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLKTIKYELP--RHSSPELQFTETPETFSDLPTQP 2116
            +++   + K   GFGF + +     +V K  G+     L++  D I  + +  +    H +VV LLK+ P        V  + T LI+ +          S       ++  + DP   +  P   +SGP       P T F +   HR    DST+ F           P  Y         D+ ++   I    YES+K   T  +  S P+ E V V L R  T GFGFR++GG E    + IGAII N P ++ G +  GD +I ++      K H  V+ L+  AA+  NG+++LTVR+    P              S  H S + +                           +V++ R   E FGFVI+S++N  E       P  IGRI  GS A++C  L +G+RILAVNG S   + + D++K+IK + L + + +    I    T  +  P     SP +Q   +P+T   L  QP
Sbjct:  455 ELLTVTMVKGAEGFGFTIADSPTGQRV-KQPGSQAASGLIE-GDLILEVNQQPVAAAGHGRVVELLKECP--------VGAEATLLIQRVGTGHISPWKAS------KQLPDHWDP---HGSPQANLSGPV----LPPGTPFPNQPQHRTSVPDSTEGFD-------LNKPDPY---------DLYEKSRAI----YESRKCVFTARLSGSGPEYEEVEVHLLREKT-GFGFRILGGDEAVQAIVIGAIIENTPAERDGRLQPGDELISVDKNVVAGKPHKYVIDLMHAAAR--NGQVSLTVRRRVQMPGEPCPVNGRSPGSVSTQHSSPRSDAASAAGPNAASVPVTAVAPEGSALQTSDVVIHRKENEGFGFVIISSLNRPENPTVITVPHKIGRIIEGSPADRCGRLKVGNRILAVNGQSIINMPHADIVKLIKDAGLTVTLHI----IPEEGTCSHSGPSSEKQSPMIQ-KHSPQTQPSLVAQP 891          

HSP 2 Score: 60.4622 bits (145), Expect = 7.315e-9
Identity = 103/476 (21.64%), Postives = 162/476 (34.03%), Query Frame = 2
Query:  506 ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKIIQ-------------ASRMRSHHNPNYDMINFYL--------------------------QKTEGGFGFILGNCKDE----------HQVAKV--NGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGP----------------CNTPDFIPATHFLSLH---RQDSTKLFQPENCKTLRQIPSSYSTPSA---------------NLI-----PDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAK 1663
            E  +V L +   GFG  ++     + ++ + + AI ++ PA + G +QPGD L + ++  + G     VI +         + LTV + +Q              S    H +P  D  +                             +K   GFGF++ +  +           H++ ++      D    LK  ++I  +    I + PH  +V L+K       LH      T          S         S +  K S    P    Q PG G + P                  T    P  H L      RQD    F        RQ P  Y  P                  L+     P  +Q P  IP  F            Q  +  +V+L +S TKGFGF + GG E    +++  +  +GP  + G +  GD II+IN  ST   TH+  + L+    +
Sbjct:  627 EEVEVHLLREKTGFGFRILGG--DEAVQAIVIGAIIENTPAERDGRLQPGDELISVDKNVVAGKPHKYVIDLMHAAARNGQVSLTVRRRVQMPGEPCPVNGRSPGSVSTQHSSPRSDAASAAGPNAASVPVTAVAPEGSALQTSDVVIHRKENEGFGFVIISSLNRPENPTVITVPHKIGRIIEGSPADRCGRLKVGNRILAVNGQSIINMPHADIVKLIKDAGLTVTLHIIPEEGTC---------SHSGPSSEKQSPMIQKHSPQTQPSLVAQ-PGQGGTHPGQVVLQPSQTAAQPGQLQTHTQSPVFHLLRSEVKARQDVKPDFHHPPFTDYRQPPVDYRHPPVTDYRQPPTLDYRHPPGLLDFRQHPAAAQFPLGIPSDFR----------LQDYDYFTVELEKS-TKGFGFSIRGGREYSMDLFVLRLAEDGPAIRNGRMRVGDQIIEINGDSTRDMTHARAIELIKAGGR 1079          

HSP 3 Score: 53.1434 bits (126), Expect = 1.285e-6
Identity = 27/86 (31.40%), Postives = 48/86 (55.81%), Query Frame = 2
Query:  512 FDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWK 769
                L+K N GFG T++     D  + L+VK++  DGPA + G +  GD++   N I ++G    +V+K+F+ V   +S+ L + +
Sbjct:  266 LSTALQKSNMGFGFTIIGGDEPD--EFLQVKSVIPDGPAAQDGKMDTGDVIVYINDICVLGTTHADVVKLFQSVPIGQSVTLVLCR 349          

HSP 4 Score: 52.373 bits (124), Expect = 2.556e-6
Identity = 33/90 (36.67%), Postives = 50/90 (55.56%), Query Frame = 2
Query: 1382 TFYESKKTNTIKYSQPQET-VSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLL 1648
            T Y  K   T   +Q + T +S  L +S   GFGF ++GG E    + + ++IP+GP  Q G ++ GDVI+ IN+      TH++VV L 
Sbjct:  246 TIYREKPLFTRDPTQLKGTFLSTALQKS-NMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMDTGDVIVYINDICVLGTTHADVVKLF 334          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000026494.1 (SMESG000026494.1)

HSP 1 Score: 1253.81 bits (3243), Expect = 0.000e+0
Identity = 611/616 (99.19%), Postives = 612/616 (99.35%), Query Frame = 2
Query:  449 MYSSLNSDPKIKSYLYHIAERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKIIQASRMRSHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLKTIKYELPRHSSPELQFTETPETFSDLPTQPVSIMKPISQFDKQIFRTFQQTPDEVLDESDKPIQGSYIQSIKSGDYQSSNDLLSSLAQKR 2296
            MYSSLNSDPKIKSYLYHIAERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKIIQASRMR HHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIP THFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYS P ETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKV+RDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLKTIKYELPRHSSPELQFTETPETFSDLPTQPVSIMKPISQFDKQIFRTFQQTPDEVLDESDKPIQGSYIQSIKSGDYQSSNDLLSSLAQKR
Sbjct:    1 MYSSLNSDPKIKSYLYHIAERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPGDILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKIIQASRMRPHHNPNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKITNIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQNMDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPTTHFLSLHRQDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKTNTIKYSHPPETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVDRDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRDGDINRLKTIKYELPRHSSPELQFTETPETFSDLPTQPVSIMKPISQFDKQIFRTFQQTPDEVLDESDKPIQGSYIQSIKSGDYQSSNDLLSSLAQKR 616          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000030959.1 (SMESG000030959.1)

HSP 1 Score: 103.99 bits (258), Expect = 2.703e-22
Identity = 61/179 (34.08%), Postives = 104/179 (58.10%), Query Frame = 2
Query: 1472 GFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPT-EPCG--IGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            GFGFR++GGAE+  ++ IG ++P+G   + G+I  GD ++ +N        H +VV L++ AA+   G + L +R+S     S +    ++  D   V L RS  E FGFVIV+++  +    G  IG++   S A+KC  L +GDRIL+VNG+S   + ++ +++ IK+   N+ + +
Sbjct: 1065 GFGFRIIGGAEDNTKITIGPLVPDGAAIRSGMIKEGDELVSVNGAGVVGALHKKVVQLVEAAARL--GSVTLGLRRSS---KSNLTPQRRIPFD---VTLARSENEGFGFVIVTSMTRSGSHVGEYIGKLIENSPAQKCGLLRVGDRILSVNGNSVSRMRHEKIVQTIKNCGRNVTLRI 1235          

HSP 2 Score: 71.2478 bits (173), Expect = 2.747e-12
Identity = 55/211 (26.07%), Postives = 92/211 (43.60%), Query Frame = 2
Query: 1445 VQLTRSPTKGFGFRLMGG-AEEGCQV--YIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCR---------------------NVLLTRSPEEEFGFVIVSAVNPTE-PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVR 2002
            V L RS  +GFGF ++      G  V  YIG +I N P  +CGL+  GD I+ +N  S  +  H ++V  +    ++   +++    +  H   + I+     ++                        +V L R   + FGF I    +  + P  + RI     A++   L +GD+IL +NG ST G+ +   I II+    +I + VR
Sbjct: 1154 VTLARSENEGFGFVIVTSMTRSGSHVGEYIGKLIENSPAQKCGLLRVGDRILSVNGNSVSRMRHEKIVQTIKNCGRNVTLRISPVPEEGGHSGPTSINSYESSDQGSSIRSSNASYQKSDTNSSGDVDFDVTLNRG-SKGFGFSIRGGQDFNKMPLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVR 1363          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000030959.1 (SMESG000030959.1)

HSP 1 Score: 103.99 bits (258), Expect = 2.739e-22
Identity = 61/179 (34.08%), Postives = 104/179 (58.10%), Query Frame = 2
Query: 1472 GFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPT-EPCG--IGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            GFGFR++GGAE+  ++ IG ++P+G   + G+I  GD ++ +N        H +VV L++ AA+   G + L +R+S     S +    ++  D   V L RS  E FGFVIV+++  +    G  IG++   S A+KC  L +GDRIL+VNG+S   + ++ +++ IK+   N+ + +
Sbjct: 1065 GFGFRIIGGAEDNTKITIGPLVPDGAAIRSGMIKEGDELVSVNGAGVVGALHKKVVQLVEAAARL--GSVTLGLRRSS---KSNLTPQRRIPFD---VTLARSENEGFGFVIVTSMTRSGSHVGEYIGKLIENSPAQKCGLLRVGDRILSVNGNSVSRMRHEKIVQTIKNCGRNVTLRI 1235          

HSP 2 Score: 71.2478 bits (173), Expect = 2.605e-12
Identity = 55/211 (26.07%), Postives = 92/211 (43.60%), Query Frame = 2
Query: 1445 VQLTRSPTKGFGFRLMGG-AEEGCQV--YIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCR---------------------NVLLTRSPEEEFGFVIVSAVNPTE-PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVR 2002
            V L RS  +GFGF ++      G  V  YIG +I N P  +CGL+  GD I+ +N  S  +  H ++V  +    ++   +++    +  H   + I+     ++                        +V L R   + FGF I    +  + P  + RI     A++   L +GD+IL +NG ST G+ +   I II+    +I + VR
Sbjct: 1154 VTLARSENEGFGFVIVTSMTRSGSHVGEYIGKLIENSPAQKCGLLRVGDRILSVNGNSVSRMRHEKIVQTIKNCGRNVTLRISPVPEEGGHSGPTSINSYESSDQGSSIRSSNASYQKSDTNSSGDVDFDVTLNRG-SKGFGFSIRGGQDFNKMPLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVR 1363          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000057909.1 (SMESG000057909.1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.765e-10
Identity = 30/76 (39.47%), Postives = 43/76 (56.58%), Query Frame = 2
Query: 1469 KGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVR 1696
            +G GF +MGG E+   +YI  IIP G  D+ G +  GD ++ +N  S E + H + V LL    K+A G + L VR
Sbjct:   98 EGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLL----KAAQGTVKLVVR 169          

HSP 2 Score: 51.2174 bits (121), Expect = 6.022e-7
Identity = 25/73 (34.25%), Postives = 41/73 (56.16%), Query Frame = 2
Query: 1784 EEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVR 2002
            EE  GF ++       P  I RI PG VA++   L  GD++L+VNG S E  H++  + ++K +   +++ VR
Sbjct:   97 EEGLGFNVMGGKEQNSPIYISRIIPGGVADRYGGLKRGDQLLSVNGISVENEHHEKAVDLLKAAQGTVKLVVR 169          
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000009125.1 (SMESG000009125.1)

HSP 1 Score: 63.1586 bits (152), Expect = 8.194e-10
Identity = 51/183 (27.87%), Postives = 85/183 (46.45%), Query Frame = 2
Query: 1457 RSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRS-PEEEFGFVIVSAVNPT-EPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITV 1999
            +S + G   + +     G  + I  ++P     +CG I  GD+++ ++    EK T +E V LL  ++ S    L + ++K    P S   G+ + +     V L R  P + +G VI    +   +P  I  INP SVA    +L  GD+IL++NG S  G      +K++      + ITV
Sbjct:  587 QSGSLGINLQALVTRTTGEPLLISKVLPGSAASRCGCIAPGDLLLALDKKPIEKCTLAEAVHLLQNSSDS----LTVRIKKGSPLPKSS-SGTSQSDFGVFTVDLKRELPCQPWGIVISGTDDSIDQPILIDSINPASVASGVSKLSSGDQILSINGHSLRGYTLTQAMKMLHQYPDQVRITV 764          

HSP 2 Score: 63.1586 bits (152), Expect = 8.406e-10
Identity = 55/208 (26.44%), Postives = 100/208 (48.08%), Query Frame = 2
Query: 1418 YSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSRHEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAV--NPTE--PCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIK-HSD---LNIEITVRDGDIN 2017
            Y +    ++V + +   +  G  + GGA+ G    I  I P    ++  +   GD II IN  ST    H E+V+L+    KS+  K++L +     E  + I   +K+++    +  +   +E FGFV       +P++  P  +  I PGSVA++   +  GD+I++      + L  ++VI +++ H D   L IE +V   D++
Sbjct:   34 YQEKISRINVDIIKKDNETLGLTVSGGADRGETPVIANIRPGSIAERSDIFLIGDHIISINGISTSSLCHQEIVSLV----KSSKPKISLIIDYELPE-KTEIQKEIKIKQASLTLPKSDDVDEGFGFVARGGYCKDPSKMRPLTVMHIRPGSVADRDGRIKPGDKIVSFGNCKVDHLTPENVIALLREHRDKLTLTIEYSVASVDMS 236          

HSP 3 Score: 60.077 bits (144), Expect = 8.202e-9
Identity = 34/94 (36.17%), Postives = 52/94 (55.32%), Query Frame = 2
Query: 1724 IHGSLKVERDCRNVLLTR-SPEEEFGFVIVSAVNPTEPCGIGRINPGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVR 2002
            IH S  + R+   + L R +P E FG  +   ++P +   I  I P S A +C  L+L D I+ VNG STE +   DV+ +I  S+ N+E+ +R
Sbjct: 1062 IHSSSTLSRNIMTIRLCRKTPTESFGIGVSEGLSP-KGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENNLELLIR 1154          

HSP 4 Score: 50.8322 bits (120), Expect = 4.793e-6
Identity = 33/93 (35.48%), Postives = 50/93 (53.76%), Query Frame = 2
Query: 1439 VSVQLTR-SPTKGFGFRLMGGAEEGCQ---VYIGAIIPNGPVDQCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSR 1705
            ++++L R +PT+ FG     G  EG      +I AI PN P  +C  +N  D II +N  STE    S+VVTL+ ++  +    L L +RK +
Sbjct: 1073 MTIRLCRKTPTESFGI----GVSEGLSPKGTFISAIKPNSPASRCASLNLYDEIIQVNGLSTENMRCSDVVTLISQSENN----LELLIRKRK 1157          
The following BLAST results are available for this feature:
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAGI24.825e-2726.99membrane associated guanylate kinase, WW and PDZ d... [more]
MAGI25.042e-2726.99membrane associated guanylate kinase, WW and PDZ d... [more]
MAGI28.667e-2627.09membrane associated guanylate kinase, WW and PDZ d... [more]
MAGI21.109e-2526.99membrane associated guanylate kinase, WW and PDZ d... [more]
MAGI21.266e-2526.99membrane associated guanylate kinase, WW and PDZ d... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
magi-12.070e-3926.59MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-12.344e-3926.59MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-12.386e-3926.11MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-13.751e-3926.11MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-14.705e-3926.11MAGI (Membrane Associated Guanylate kinase Inverte... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Magi2.327e-3038.62gene:FBgn0034590 transcript:FBtr0342874[more]
Magi2.327e-3038.62gene:FBgn0034590 transcript:FBtr0071636[more]
Magi2.327e-3038.62gene:FBgn0034590 transcript:FBtr0342873[more]
scrib1.486e-1226.53gene:FBgn0263289 transcript:FBtr0335521[more]
scrib2.995e-1226.53gene:FBgn0263289 transcript:FBtr0335522[more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
magi2b4.412e-2726.45membrane associated guanylate kinase, WW and PDZ d... [more]
magi2b1.016e-2626.82membrane associated guanylate kinase, WW and PDZ d... [more]
magi2b1.104e-2626.82membrane associated guanylate kinase, WW and PDZ d... [more]
wu:fi36a101.166e-2627.61wu:fi36a10 [Source:ZFIN;Acc:ZDB-GENE-030131-6139][more]
wu:fi36a101.685e-2628.07wu:fi36a10 [Source:ZFIN;Acc:ZDB-GENE-030131-6139][more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdf55.684e-3025.70growth differentiation factor 5 [Source:Xenbase;Ac... [more]
gdf54.353e-2727.75growth differentiation factor 5 [Source:Xenbase;Ac... [more]
gdf53.147e-2627.75growth differentiation factor 5 [Source:Xenbase;Ac... [more]
gdf53.332e-2627.75growth differentiation factor 5 [Source:Xenbase;Ac... [more]
gdf54.194e-2627.75growth differentiation factor 5 [Source:Xenbase;Ac... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Magi27.438e-2726.77membrane associated guanylate kinase, WW and PDZ d... [more]
Magi21.287e-2526.77membrane associated guanylate kinase, WW and PDZ d... [more]
Magi21.577e-2526.86membrane associated guanylate kinase, WW and PDZ d... [more]
Magi22.592e-2527.15membrane associated guanylate kinase, WW and PDZ d... [more]
Magi24.842e-2527.15membrane associated guanylate kinase, WW and PDZ d... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86UL8|MAGI2_HUMAN1.952e-2427.37Membrane-associated guanylate kinase, WW and PDZ d... [more]
sp|Q9WVQ1|MAGI2_MOUSE3.455e-2427.15Membrane-associated guanylate kinase, WW and PDZ d... [more]
sp|O88382|MAGI2_RAT6.358e-2427.52Membrane-associated guanylate kinase, WW and PDZ d... [more]
sp|A1A5G4|MAGI3_XENTR3.060e-2332.51Membrane-associated guanylate kinase, WW and PDZ d... [more]
sp|Q4L1J4|MAGI1_RAT6.775e-2223.40Membrane-associated guanylate kinase, WW and PDZ d... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A077Z8741.878e-4129.14Membrane associated guanylate kinase, WW and PDZ O... [more]
F1KSV96.202e-4028.30Membrane-associated guanylate kinase, WW and PDZ d... [more]
A0A3Q2XBK52.931e-3827.22Membrane associated guanylate kinase, WW and PDZ d... [more]
A0A0N4U6S41.865e-3727.41Uncharacterized protein OS=Dracunculus medinensis ... [more]
A0A3B5MNY12.266e-3728.26Membrane associated guanylate kinase, WW and PDZ d... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wu:fi36a101.405e-3726.46wu:fi36a10 [Source:ZFIN;Acc:ZDB-GENE-030131-6139][more]
magi3b5.115e-3626.42membrane associated guanylate kinase, WW and PDZ d... [more]
magi2a3.978e-2631.05membrane associated guanylate kinase, WW and PDZ d... [more]
magi2b2.666e-2433.49membrane associated guanylate kinase, WW and PDZ d... [more]
magi1a6.568e-2123.73membrane-associated guanylate kinase, WW and PDZ d... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003180.11.298e-1622.59pep scaffold:Pmarinus_7.0:GL477326:20216:45383:1 g... [more]
ENSPMAT00000001444.11.341e-1530.89pep scaffold:Pmarinus_7.0:GL476357:122445:266872:1... [more]
ENSPMAT00000010851.11.580e-1026.11pep scaffold:Pmarinus_7.0:GL477227:46102:76179:-1 ... [more]
lin7a1.144e-939.47lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
LIN7B1.857e-939.47lin-7 homolog B, crumbs cell polarity complex comp... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO425395.617e-2430.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460596.623e-1024.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348282.594e-930.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477226.207e-940.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456244.486e-826.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wu:fi36a101.277e-2627.52membrane-associated guanylate kinase, WW and PDZ d... [more]
magi3b1.917e-2627.44membrane-associated guanylate kinase, WW and PDZ d... [more]
magi3b2.354e-2627.44membrane-associated guanylate kinase, WW and PDZ d... [more]
magi2b6.009e-2626.33membrane-associated guanylate kinase, WW and PDZ d... [more]
magi2b3.769e-2527.87membrane-associated guanylate kinase, WW and PDZ d... [more]
back to top
BLAST of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026494.10.000e+099.19SMESG000026494.1[more]
SMESG000030959.12.703e-2234.08SMESG000030959.1[more]
SMESG000030959.12.739e-2234.08SMESG000030959.1[more]
SMESG000057909.14.765e-1039.47SMESG000057909.1[more]
SMESG000009125.18.194e-1027.87SMESG000009125.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000377 ID=SMED30000377|Name=Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2569bp
CTGACTGATGTGGCCTGAATGTCGACAAACTAAATATTAATTCTTCTCGG
CTGGTACACGATTTACTTTTATGATTTGCATTGATGATATGCTAAGACAC
GTCTGCGTGATGCTTGGTGAATAATCGTCCTTTCGGTACCAGCGAACTGT
CGCATCGAGAGATTAGTACACGCCTGGACATGCTGTGCACACTGATTCCT
GGTGCCATCTCTGCCTCCAAGGCTGCCAACAGTCAATAGTGTCGCACTAT
TTATCACCACGTGTGTCACCTATCATGCTTAAGAGAAATCTTCTATAATC
GTTTCTCACTATGTGTAAATTTCTCGATGATTATCAGTGATCAATAAATT
GGCACATGCTCAACTCCAACTGCCCTTCCTATTCTACCCTTACGAGATCC
ACAGAATCGTCGAATACAACTAGAGAAAGCTTTTGCACGAACCGGCACAT
GTACAGCTCTCTGAATTCGGATCCGAAAATCAAATCATATTTATACCATA
TAGCTGAGAGGTTTGATGTGGTTTTGAAAAAAGGAAACCAAGGATTCGGT
TTGACACTTGTTGACGACTTGTTCATTGACAACATTAAACTCCTCAAAGT
CAAAGCCATTTACAAAGACGGACCTGCAGGAAAGTGCGGCATAATTCAGC
CCGGGGACATTTTAAGTGCCTTCAACCAGATCGACATCATTGGTGTTCTG
CCAGACGAAGTCATAAAAATGTTCAAACTGGTTAAAGAGAAAGAGTCAAT
AGTTCTAACTGTTTGGAAAATTATTCAAGCATCCAGAATGAGATCCCATC
ACAATCCGAACTACGATATGATCAATTTCTATTTACAAAAGACCGAAGGA
GGATTCGGATTCATTCTTGGTAACTGCAAGGACGAGCACCAAGTGGCGAA
AGTCAACGGGACGGGTGATGTGCAATTACTGTTGAAGACCAATGATAAAA
TAACCAACATTGGGAGAGTAAGGATAGATCATTTCCCTCACGATCAAGTT
GTGACCCTCCTGAAGAAATTTCCAAGAAATCATTTCCTTCATTTTACAGT
AGTAAGAGACACGACAAACCTAATCAGATCTATTTCGAATGAGAGCTTCC
AAAATATGGACTATTCAATGAATTCATCCATTTATTCAAAAATCTCCAGA
AACATTGACCCACTATTTTACAATCAAATGCCAGGAATCGGCATAAGTGG
CCCGTGCAATACCCCAGATTTCATTCCTGCCACTCATTTCTTGTCTCTGC
ATAGACAAGATTCTACTAAATTATTCCAACCTGAGAACTGCAAGACTTTA
CGCCAAATTCCATCTTCTTATTCAACACCAAGTGCAAATTTGATTCCAGA
TGTTTCCCAACAGCCTGACTTTATCCCAGATACTTTCTACGAATCTAAAA
AAACTAACACTATCAAATATTCTCAGCCTCAAGAAACTGTTTCTGTCCAA
CTAACAAGATCACCGACGAAAGGATTTGGATTCAGATTAATGGGAGGTGC
CGAAGAAGGATGTCAAGTGTATATTGGAGCCATAATTCCCAATGGACCAG
TGGATCAGTGTGGTTTGATAAACTGTGGAGATGTAATCATTGATATAAAC
AATACGTCAACCGAGAAAAAAACGCATTCGGAAGTTGTTACTCTGCTTGA
CGAAGCTGCCAAGTCAGCTAATGGTAAATTGAATTTAACTGTCAGAAAAT
CTCGACATGAACCGCACTCAGGGATTCATGGATCACTAAAGGTAGAAAGA
GATTGCCGAAATGTGCTTTTGACTAGAAGCCCAGAGGAAGAATTTGGATT
TGTGATAGTGAGTGCCGTTAATCCCACTGAACCGTGCGGAATTGGACGCA
TCAATCCAGGAAGTGTTGCAGAAAAATGCCATGAGTTACATCTCGGGGAC
AGAATACTAGCAGTTAATGGCAGCAGTACAGAAGGGTTACATTATAAAGA
TGTAATAAAGATAATCAAACATAGTGACCTAAATATTGAGATTACAGTAC
GAGATGGAGACATCAATCGGTTGAAAACAATAAAATATGAACTTCCTCGG
CATTCTTCTCCAGAGCTACAATTTACAGAAACACCAGAAACATTCTCTGA
TCTGCCTACGCAGCCAGTATCAATCATGAAGCCAATTAGTCAGTTTGACA
AGCAAATATTCAGAACTTTTCAACAGACTCCCGATGAGGTACTTGATGAA
AGTGATAAACCAATCCAGGGGTCATATATACAGTCAATCAAGTCAGGAGA
TTATCAATCTTCAAACGACCTTTTATCTTCACTGGCTCAAAAACGATGAC
AAAATTTATTCAAAAAAAAGGTCTTCATTGCAAATTATGAACAATTCTGC
CATCAGTGTTTCTGTTTTTGAGTCGAGTTTCTAATTTAACAGGAATAAAT
GACATATTTTGTGCACGTTATTTGGAAAAGGATTTTTTTTTCTCGGAAAT
ATCATTTGGAAATGCTTAATTGTAGGTTTTTAAATGATGAGGTTTAGGCA
ATAAATGAGCCGTTTGTTTTTAAAGTGGAGCATGTTCATTTGTGTAAATC
AAACTTTTTATTTTCTTCA
back to top

protein sequence of SMED30000377-orf-1

>SMED30000377-orf-1 ID=SMED30000377-orf-1|Name=SMED30000377-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=648bp
MLNSNCPSYSTLTRSTESSNTTRESFCTNRHMYSSLNSDPKIKSYLYHIA
ERFDVVLKKGNQGFGLTLVDDLFIDNIKLLKVKAIYKDGPAGKCGIIQPG
DILSAFNQIDIIGVLPDEVIKMFKLVKEKESIVLTVWKIIQASRMRSHHN
PNYDMINFYLQKTEGGFGFILGNCKDEHQVAKVNGTGDVQLLLKTNDKIT
NIGRVRIDHFPHDQVVTLLKKFPRNHFLHFTVVRDTTNLIRSISNESFQN
MDYSMNSSIYSKISRNIDPLFYNQMPGIGISGPCNTPDFIPATHFLSLHR
QDSTKLFQPENCKTLRQIPSSYSTPSANLIPDVSQQPDFIPDTFYESKKT
NTIKYSQPQETVSVQLTRSPTKGFGFRLMGGAEEGCQVYIGAIIPNGPVD
QCGLINCGDVIIDINNTSTEKKTHSEVVTLLDEAAKSANGKLNLTVRKSR
HEPHSGIHGSLKVERDCRNVLLTRSPEEEFGFVIVSAVNPTEPCGIGRIN
PGSVAEKCHELHLGDRILAVNGSSTEGLHYKDVIKIIKHSDLNIEITVRD
GDINRLKTIKYELPRHSSPELQFTETPETFSDLPTQPVSIMKPISQFDKQ
IFRTFQQTPDEVLDESDKPIQGSYIQSIKSGDYQSSNDLLSSLAQKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR041489PDZ_6
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 372..450
e-value: 2.9E-15
score: 66.7
coord: 478..552
e-value: 2.1E-10
score: 50.6
coord: 62..140
e-value: 6.3E-8
score: 42.3
coord: 165..236
e-value: 0.0089
score: 25.2
IPR001478PDZ domainPFAMPF00595PDZcoord: 364..446
e-value: 1.0E-10
score: 41.8
IPR001478PDZ domainPROSITEPS50106PDZcoord: 469..552
score: 15.983
IPR001478PDZ domainPROSITEPS50106PDZcoord: 54..138
score: 11.119
IPR001478PDZ domainPROSITEPS50106PDZcoord: 363..436
score: 16.003
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 458..555
e-value: 9.3E-19
score: 69.4
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 149..252
e-value: 4.4E-10
score: 41.2
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 343..457
e-value: 2.9E-24
score: 87.3
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 46..148
e-value: 6.7E-15
score: 56.7
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 32..138
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 459..554
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 150..240
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 345..452
IPR041489PDZ domain 6PFAMPF17820PDZ_6coord: 82..137
e-value: 5.0E-8
score: 32.7
coord: 496..549
e-value: 5.5E-9
score: 35.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR10316:SF40LD27118Pcoord: 50..552
NoneNo IPR availablePANTHERPTHR10316MEMBRANE ASSOCIATED GUANYLATE KINASE-RELATEDcoord: 50..552
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 53..136
e-value: 8.54954E-9
score: 50.6431
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 364..447
e-value: 1.64389E-19
score: 81.0738
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 468..549
e-value: 7.73226E-19
score: 79.1478