dynein heavy chain domain-containing protein 1-like

Overview
Namedynein heavy chain domain-containing protein 1-like
Smed IDSMED30000376
Uniprot Best hitDynein heavy chain domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DNHD1 PE=2 SV=2 (E=3.27862e-23)
Length (bp)11755
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dynein heavy chain domain-containing protein 1-like (SMED30000376) t-SNE clustered cells

Violin plots show distribution of expression levels for dynein heavy chain domain-containing protein 1-like (SMED30000376) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dynein heavy chain domain-containing protein 1-like (SMED30000376) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dynein heavy chain domain-containing protein 1-like (SMED30000376) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000376

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000376SMESG000076398.1 SmedASXL_004861SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30000376SMESG000076398.1 SmedASXL_007844SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30000376SMESG000076398.1 SmedASXL_014239SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30000376SMESG000076398.1 SmedASXL_014240SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30000376SMESG000076398.1 SmedASXL_018276SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000376SMESG000076398.1 dd_Smed_v6_8984_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30000376SMESG000076398.1 dd_Smed_v4_8984_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Human
Match: DNHD1 (dynein heavy chain domain 1 [Source:HGNC Symbol;Acc:HGNC:26532])

HSP 1 Score: 113.235 bits (282), Expect = 2.260e-24
Identity = 72/255 (28.24%), Postives = 124/255 (48.63%), Query Frame = 3
Query:  948 HLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGW-RSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYL---IKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNIT 1700
            +L+++   YLN    R    YSL VV   +V PEHYIFS FGI+H  P      M+L  W+   +L+  L+ +PF K  L+RK F  W +++ +   H  + K+L  +L+     +G  +L I+RLL E+  + +LP EL            ++     A   L   +     +  +V+E    + + LQ  +VQ+       + SIY+++++    +Q L        +LG F +LV++M+   ++ +    IT
Sbjct:  289 YLKKIHFLYLNVAPSRYFRPYSLMVVPPDKVNPEHYIFSPFGILHVHPVEGSETMTLGTWHHHCVLWQQLQFIPFFKYCLLRKSFTCWKKNVRLQGLH-RLQKFLENHLLLAVPHFGAGLLHISRLLQELHSVSWLPQELDRCYELLDLQTALAEEKHKALRLLHRCLNLCTSILRLVHEDTYHMQQCLQ-ERVQNCDRIRTGQGSIYLQRVQHKQLEQKLKQAEAWWLQLGKFARLVDYMICQSLISVLEEQIT 541          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Human
Match: DNHD1 (dynein heavy chain domain 1 [Source:HGNC Symbol;Acc:HGNC:26532])

HSP 1 Score: 114.005 bits (284), Expect = 6.827e-24
Identity = 72/255 (28.24%), Postives = 124/255 (48.63%), Query Frame = 3
Query:  948 HLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGW-RSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYL---IKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNIT 1700
            +L+++   YLN    R    YSL VV   +V PEHYIFS FGI+H  P      M+L  W+   +L+  L+ +PF K  L+RK F  W +++ +   H  + K+L  +L+     +G  +L I+RLL E+  + +LP EL            ++     A   L   +     +  +V+E    + + LQ  +VQ+       + SIY+++++    +Q L        +LG F +LV++M+   ++ +    IT
Sbjct:  289 YLKKIHFLYLNVAPSRYFRPYSLMVVPPDKVNPEHYIFSPFGILHVHPVEGSETMTLGTWHHHCVLWQQLQFIPFFKYCLLRKSFTCWKKNVRLQGLH-RLQKFLENHLLLAVPHFGAGLLHISRLLQELHSVSWLPQELDRCYELLDLQTALAEEKHKALRLLHRCLNLCTSILRLVHEDTYHMQQCLQ-ERVQNCDRIRTGQGSIYLQRVQHKQLEQKLKQAEAWWLQLGKFARLVDYMICQSLISVLEEQIT 541          

HSP 2 Score: 88.5817 bits (218), Expect = 3.362e-16
Identity = 149/803 (18.56%), Postives = 298/803 (37.11%), Query Frame = 3
Query: 3321 WKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRYKLL---VRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVF-------HYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLF-------------------DEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWL---MKYPLQVLLVADKIFFAKTLRKALTDPGH-EIASFKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSS-KSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVT------------IQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLL 5591
            WK   F+ F  + A E+   W TE A           +++     + EF S++P   +L S      + Q     +G   +   + LT+  L+   + E +  +  +  +   +  A +      RYW  ++               LH  +E       P   R++ ++ R    + ++              ++   F++ + + L++ I +S+  +       K  D  K+    V  +  L     +    Q+KW+FL ++  E      + +  + F  ++     L+      P+V          SP  +    Q+  +  +++         + GII ++E ++  V  HFPRLFFL D +L+ LL  +       +  ++   FP V  + F                        A++++   GE + L  P+       +WL   E   +  L   ++ C+  +      + +  K                         ++ + NK  ++       L  + W+     +P Q +LVA+++ +   + +AL + G   + S  +  +    N++         ++L  +R  S +  L+V+   H +I A+L+E    S    F +   +KY  G    +++  S +     +             I      FLY+YEY+   R     + + E+  + +LL L      T++G     K  I  S ++ LGR L  +     I ++    Y  GAL  G+ L +    ++  G +S + + L +L  L
Sbjct: 1035 WKCMAFAKFSPAMAQEKTEGWLTEAARMSTTLELHSPVLQHCMRILGEFRSYLPLLTKLGSLHPQSLNCQCLLRALGLGSLQTIELLTLGQLLTYPLLEFADRINQVWQNENERIHAQETIRRLQRYWEARQLRL--------LNFILHVPYEP------PASERSKRQVLRSPQWEVVD--------------KDSGTFILSDYSNLQDSIQESLQVLSKILAIEKSGDLNKIALEWVAIMHGLGALLEVWLTFQQKWIFLNKVLHEMKIQFPNADLNSRFKVMDDQYRTLMRISVADPMVLSLVVPSAERSPYFQGQQLQQLLQAGSVE---------LEGIIMSLESVLYGVCAHFPRLFFLSDSELVALLAARLESCEAQL--WVRRCFPHVHAVSFRSCPTGEKNTDDWESSPNTQTQVEALAVLGAGGEEVKLQGPLPLHPDLPKWLASLEKCLRLALVHMLQGCVAARLARGPSLGEALK-------------------------QLPKQNKLYLQ-------LYVQHWIDLVQAFPWQCVLVAEEVVWRAEMEEALLEWGTLAMVSMHMRKLEVLVNFMRAQRASQGGQSLPSVRQTSLLSALLVMAVTHRDI-AQLLEQHQVSDLTDFHWVRQLKYHLG--SPHIIPKSPLQSLKTIASSEPSLSPAACWIDVLGRSFLYNYEYLG-PRLGPLPSLLPERPALVLLLALEEVACGTVLGPNGVGKRAIVNSLAQALGRQLVMLPCSPQIEAQCLSNYLNGALQGGAWLLLEKVHQLPPGLLSALGQRLGELHHL 1762          

HSP 3 Score: 73.559 bits (179), Expect = 9.996e-12
Identity = 88/363 (24.24%), Postives = 166/363 (45.73%), Query Frame = 2
Query: 9500 YLDFSMAVFNHLFEVFRVKTESKIQRVESAMKSVKNAXXXXXXXXXXXXXXXXXXASLNVDISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKN--------MLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDD 10564
            +LDF +  F  L +   +K ++K QRV++A+++++    +    ++ +  L+++L      +S     ++Q K  Y   L +C  QE LI+ L    + L+ + ++ L ++S  +L  L  ++  D    EEI++Y  PPE V  + + +  L  ++  W   K+++   + Y+EL++F K+ I + +   L  +L    +   +L  VS+ AASL+ WL+A+L Y        P    L  V+  ++  Q+ LG  + +          +  EH   LAK    +    +   K  S           M + + T ++ WT Q  +       +    L    + +YL  FP   R E+LD+
Sbjct: 3115 FLDF-LDTFLMLQQQTILKIKNKAQRVQNALENLRMLIKEHGTHANLIFDLEQQLKDSGKSLSMFQQQLEQSKLLYKQQLEECRHQENLIENLARQRDALQAQREAFLEQMSKAFLEPLSQLQVAD---FEEIRSYRAPPESVVRVTDAMCDLFHHETGWASAKQLLCTEDFYQELVFFPKEKITDSELIKLHLILKAPGMDDAALRAVSRPAASLAAWLWAVLHYGLAHCRGLPTDLLLQQVEATLTREQARLGYYQFQAQ--------ETLEHNLALAKMVEDAQASHNCVAKTLSQAQCGQYHKWPMKAALLTPMRAWTTQLQKLKGRCMTVFGDTLLCSAAIIYLGPFPPLRRQELLDE 3465          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 81.2629 bits (199), Expect = 5.911e-14
Identity = 61/260 (23.46%), Postives = 125/260 (48.08%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS---RFPLAMRNEVLDDI 10567
            L + ++ +L E  P    A+  + +L+   I EIK+Y +PP  V  +++ V +L G + +W E K  + + N  + L+ FDKD+I +K  K +           + +  VS AA SL  W+ A+  Y  L R + P+   + A   ++   Q+ L + + +   + + LE+   ++ E LA+++ +  +  + + K++    ++S +      W +       L +DL   +   +++  +LS    F    R+E+++ I
Sbjct: 3080 LADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEE---TVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQI 3336          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 81.2629 bits (199), Expect = 5.911e-14
Identity = 61/260 (23.46%), Postives = 125/260 (48.08%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS---RFPLAMRNEVLDDI 10567
            L + ++ +L E  P    A+  + +L+   I EIK+Y +PP  V  +++ V +L G + +W E K  + + N  + L+ FDKD+I +K  K +           + +  VS AA SL  W+ A+  Y  L R + P+   + A   ++   Q+ L + + +   + + LE+   ++ E LA+++ +  +  + + K++    ++S +      W +       L +DL   +   +++  +LS    F    R+E+++ I
Sbjct: 3080 LADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEE---TVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQI 3336          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 74.3294 bits (181), Expect = 4.593e-12
Identity = 59/242 (24.38%), Postives = 117/242 (48.35%), Query Frame = 2
Query: 9851 ALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS---RFPLAMRNEVLDDI 10567
            ALE++   D G   EIK+Y +PP  V  +++ V +L G + +W E K  + + N  + L+ FDKD+I +K  K +           + +  VS AA SL  W+ A+  Y  L R + P+   + A   ++   Q+ L + + +   + + LE+   ++ E LA+++ +  +  + + K++    ++S +      W +       L +DL   +   +++  +LS    F    R+E+++ I
Sbjct:   50 ALESLNKKDIG---EIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEE---TVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQI 285          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 80.1073 bits (196), Expect = 4.638e-14
Identity = 101/534 (18.91%), Postives = 215/534 (40.26%), Query Frame = 3
Query: 4008 DRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLLLQERSN 5609
            D+  +    L DL +    + E Q KW++LE IF   +        A+ F  V+ +   +L+ + +   +        V L  + S    LK  L ++++++N     + + ++  R  FPR +F+ D  L+E+L    S N Q I   M  +F  + R+ F          S TGE +                                  +V    E+  ++K  +                +  ++     +S+  +  +++L    +   +  L KYP QVL +A+++ F+ ++   L +   ++ SFK  L+ K   Y ++      ++ +  L++ S I +L+     HI+++ +L+ +   S  S+ +Q  +++   +              G + ++   S+F Y YEY   +   L  T +T++  + +   +Y        G   + K E  K+ + ++GR +   +    I   S  + F G +  G+    + F+ +    +S +S  +  ++  ++ R+ 
Sbjct: 1284 DKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGRGALPSE----ASRFSRVDSEYRAILNDVSKDARL--------VSLCSRQS----LKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQ--STNPQVIQTHMKKLFQGINRVQF----------SSTGETI--------------------------------ISMVSSEGETVPLSKAVRI---------------VPQVESWLQELSDEMRRTLKDLTAQAVADAQPSLAKYPSQVLCLAEEVKFSASIENNL-NGSSDLNSFKSQLLEKLKAYTNM----KVDDKVSDLKLKSLILDLI----HHIDVVDQLLTNQAKSINSWTWQRQLRFYLVN--------------GGIVLRQVSSEFEYTYEYQG-NYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAG 1718          

HSP 2 Score: 62.7734 bits (151), Expect = 7.377e-9
Identity = 53/178 (29.78%), Postives = 93/178 (52.25%), Query Frame = 2
Query: 9704 MKQMKESYGLALNQCISQEKLIKELTGPLN----ELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG-YDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNE--TLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGE 10216
            +K + ES   A +Q +S E+L K  T   N    E K K    L EV P    A   + ++   ++ EI++   PPE VRD+++ V L +G  D SWE +++ + K  + ++++ FD + I  + +K +T ++  +  +  + +    S AAA L+ W+ A L Y+ +  +I P  GE
Sbjct: 2831 LKAITESMSGAEDQKLSMEQL-KAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGILDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGE 3007          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 73.9442 bits (180), Expect = 3.570e-12
Identity = 53/246 (21.54%), Postives = 113/246 (45.93%), Query Frame = 2
Query: 9758 EKLIKELTGPLNELKEKS---KSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG--YDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDL 10480
            E+L KEL   L ++ EK    +++L +V P    A   ++ +    + E+K+   PP  V+  +E + +LLG      W+ I+++M+K +    +L FD + +  +  K + K + N     + +   S A   +  W  A L Y+ +  ++ P   EL  ++++ +    E   + VR   + + +     E+ +L+ + +++   +   + K++    +LS + +    W+     F Q M  L
Sbjct: 2269 EQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSL 2514          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 73.559 bits (179), Expect = 3.859e-12
Identity = 53/246 (21.54%), Postives = 114/246 (46.34%), Query Frame = 2
Query: 9758 EKLIKELTGPLNELKEKS---KSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYD--NSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDL 10480
            E+L KEL   L ++ EK    +++L +V P    A   ++ +    + E+K+   PP  V+  +E + +LLG +    W+ I+++M+K +    +L FD + +  +  K + K + N     + +   S A   +  W  A L Y+ +  ++ P   EL  ++++ +    E   + VR   + + +     E+ +L+ + +++   +   + K++    +LS + +    W+     F Q M  L
Sbjct: 3201 EQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSL 3446          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 73.559 bits (179), Expect = 3.859e-12
Identity = 53/246 (21.54%), Postives = 114/246 (46.34%), Query Frame = 2
Query: 9758 EKLIKELTGPLNELKEKS---KSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYD--NSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDL 10480
            E+L KEL   L ++ EK    +++L +V P    A   ++ +    + E+K+   PP  V+  +E + +LLG +    W+ I+++M+K +    +L FD + +  +  K + K + N     + +   S A   +  W  A L Y+ +  ++ P   EL  ++++ +    E   + VR   + + +     E+ +L+ + +++   +   + K++    +LS + +    W+     F Q M  L
Sbjct: 3201 EQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSL 3446          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 56.9954 bits (136), Expect = 3.943e-7
Identity = 56/272 (20.59%), Postives = 125/272 (45.96%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG-------------YDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLT-KVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKV-RTDLMR--QDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQF-HQLMQDLPRSILSFIISNMYLSRFPLAMRNEVL 10558
            LK +S++ L    P   +A+E +  +    +  +KT   PP  VR  +E V +LLG              ++ W   ++++  I+   ++  F +D + +K  K++  K L+ E    E++   S AA  L  W+ AI  Y  +S+ + P+   L   +    + +  L +++V R  L++  + L+    +  ++  K++ +  QI   + +++  + ++  +      W ++ T   H+    +P S+ S +  +++  + P+  R + L
Sbjct: 2198 LKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAE---VLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHEDSLSVPYSVGSSLALHVF-GKLPIDQREKEL 2465          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Fly
Match: kl-5 (gene:FBgn0267433 transcript:FBtr0346772)

HSP 1 Score: 84.3445 bits (207), Expect = 3.355e-15
Identity = 62/274 (22.63%), Postives = 122/274 (44.53%), Query Frame = 2
Query: 9755 QEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLL------LGYDNSWEEIKEIMVKINLY-EELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEV 10555
            +EK ++++   +    +  + +  +  P  +AA E +  L+   + E+K++  PP+ V  +   V +L      +  D SW+  +  M  ++ + + L+ +DK HI     K L   + +     E ++  S AAA L  W+  I R+ ++   + P+   LL  +++V  A+ +L  + +R   + + L     E+ E LAK++   D+     + ID    ++  + T    W +        +Q LP  IL       Y+  F  A R E+
Sbjct: 3200 EEKNVRQIEEDVTAKAKLCEEDFLKAQPALIAAQEALNTLNKNNLTELKSFGSPPDAVVSVCGAVLVLFSSKGKIPKDRSWKACRAFMGNVDKFLDNLINYDKKHIHPDVIKALQPYILDAEFSPEKILAKSSAAAGLCSWVININRFYDVYLVVEPKERALLESEKEVKDARDKLTALNLRLTELEEQLNALQMEYDEALAKKQKCQDEASKTAFTIDIANRLIGGLATEKIRWMESVKVLTFGIQQLPGDILIISCFISYVGCFTRAYRQEL 3473          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 80.1073 bits (196), Expect = 5.135e-14
Identity = 71/270 (26.30%), Postives = 118/270 (43.70%), Query Frame = 2
Query: 9794 ELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMK---------------VRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVL 10558
            EL   ++++L  V P   AA++ +  L+   I E+K+Y +PP  +  ++E V +LLG + +WE  K+++ +     +L  FD+DHI +K  K +     N  L  + +  VS A  SL  W+ AI  Y  + R + P+       QEK+  A   L + +               V  +L RQ LE K     EL AK + +  Q       ++    ++  +    + W +   Q     + LP   L  +    YL  F    R E+L
Sbjct: 3116 ELAATARADLEVVMPMIDAAVKALDALNKKDISEVKSYGRPPMKIEKVMEAVLILLGKEPTWENAKKVLSESTFLNDLKNFDRDHISDKTLKRIAIYTKNPELEPDKVAVVSLACKSLMQWIMAIENYGKVYRIVAPK-------QEKLDSAMKSLEEKQAALAAAKKKLEELQVVIEELYRQ-LEEKTNLLNELRAKEERLRKQ-------LERAIILVESLSGERERWIETVNQLDLSFEKLPGDCLLSVAFMSYLGAFDTKYREELL 3370          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Fly
Match: Dhc16F (gene:FBgn0283476 transcript:FBtr0074509)

HSP 1 Score: 75.8702 bits (185), Expect = 1.048e-12
Identity = 52/206 (25.24%), Postives = 97/206 (47.09%), Query Frame = 2
Query: 9734 ALNQCISQEKL-IKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQL-------GELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHK 10327
            A+ Q + ++++  KE       + E +  +L    P    A E ++ L    I E+K++  PP  V+  +E V +LLG   +W   K IM  IN  + L  +DK+H+ E   K + K + ++         VS+ A S+S W+ ++ +++ + + + P++        EL  V   +   Q EL  ++ +   +R  LE K  E +
Sbjct: 2678 AVKQSVLEDEMNAKEKAAVAQAISEDAGKDLEIAMPALREAEEALKGLTKADINELKSFTTPPALVQFCMEAVCILLGVKPTWASAKAIMADINFIKRLFEYDKEHMKEDTLKKVKKYIDHKDFVPAKFEKVSKVAKSMSMWVISMDKFSKVYKVVEPKIKRKEAAEAELKEVMTVLRQKQKELAAVEAKIQGLRDSLEEKQREFQ 2883          

HSP 2 Score: 59.6918 bits (143), Expect = 8.457e-8
Identity = 77/343 (22.45%), Postives = 150/343 (43.73%), Query Frame = 3
Query: 3684 NHHLRYW------ITKEFEFEEHRTDLRCQRSLHERFESIAISKT--PVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQ-LKKPQAKGDDRYKL--LVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSP---IGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELL-NCKFSQNIQSINRFMPSIFPAVKRLLFDE---------ATNAI-SLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYI 4637
            N   R+W      + ++F F+E    ++    +H  F+ +AI +    + ++   E++  +  K +E   ++     + +++ +++F++    +L+  + DS ++I  +   +  G  + K+   + A++    +     +CQ  W++LE IF      +     A  F  V+K     + Q K+  L         + KVL+           +RLL+LI R       +E  ++  R  FPR +FL + +L+E+L   +  Q +Q   R     F A+ RL F           ATN I + +S  GE+L   K +  R +  +WL + E     + K Y+
Sbjct:  911 NLRARHWAEIEDLLNRKF-FQEKDILIQTYEDVHA-FDDVAIGEALMQISSQATGEVQLENMLKGIETTWKETELSIVPHHDAKDVFILAGTEELQAVLDDSNVNINTIAASKFVGPIKSKVDEWINAMDQFAKTFESWMDCQGAWIYLEAIFASADIQRQLPHEAKMFFTVDKSFKETVRQAKKVALALPTMSSVDVHKVLVEN---------NRLLDLISR------GLEAYLEVKRVVFPRFYFLSNDELLEILAQTRIPQAVQPHLR---KCFDAIYRLEFGSKEGGDGKMVATNDIVAFLSPEGEKLQFGKGLKARGAVEEWLSKVEEAMFVSCKRYM 1233          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Fly
Match: Dhc64C (gene:FBgn0261797 transcript:FBtr0073359)

HSP 1 Score: 68.1662 bits (165), Expect = 2.468e-10
Identity = 62/285 (21.75%), Postives = 138/285 (48.42%), Query Frame = 2
Query: 9698 SHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSK---SNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNS-WEEIKEIMVKINLYEELLY-FDKDHI-DEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQ-DLEVKVY--EHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS 10525
            + +KQM +    A  + I  +++   L     +++EK K   ++L +V P  + A   ++++    + E++T   PP  V+  +E + LLLG + + W+ I+ ++++ N    ++  F  ++I D+ + K+ +K L+N   + E +   S A   +  W  A + Y ++ + + P   EL +++E+  +    L   K   DL+ Q +  +  Y  E+ +L+++ +++   + + + K+D    +L  +    + W      F        +S +S II ++ LS
Sbjct: 3223 AKLKQMFQDQQEAEKKKIQSQEIQIRLADQTVKIEEKRKYVMADLAQVEPAVIDAQAAVKSIRKQQLVEVRTMANPPSVVKLALESICLLLGENATDWKSIRAVIMRENFINSIVSNFGTENITDDVREKMKSKYLSNPDYNFEKVNRASMACGPMVKWAIAQIEYADMLKRVEPLREELRSLEEQADV---NLASAKETKDLVEQLERSIAAYKEEYAQLISQAQAIKTDLENVQAKVDRSIALLKSLNIERERWESTSETF--------KSQMSTIIGDVLLS 3496          

HSP 2 Score: 57.7658 bits (138), Expect = 3.568e-7
Identity = 50/203 (24.63%), Postives = 95/203 (46.80%), Query Frame = 3
Query: 4071 ECQEKWLFLERIFEEESFVQAHLET-AANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAI-SLISQTGERLDLYKPVCP--RNSASQWLKEFELVFKSTLKFYIESCLVQQSEE 4667
            + Q +W++LE IF   + ++  L    + F +++ + L L+ ++ +SP V     I  V   Q+  E      RL +L+ ++   +    E ++  R  FPR +F+ D  L+E++    S+NI  + +    +F  V  +L +E  N I  + S+ GE +    PV        ++WL   E      ++F + S L Q  ++
Sbjct: 1529 DVQRRWVYLEGIFSGSADIKTLLPVETSRFQSISSEFLGLMKKVTKSPKVMDVLNIPAV---QRSLE------RLADLLGKIQKALG---EYLERERTSFPRFYFVGDEDLLEIIGN--SKNIARLQKHFKKMFAGVAAILLNEENNVILGISSREGEEVHFMNPVSTVEHPKINEWLSLVE----KQMRFTLASLLAQAVQD 1713          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Fly
Match: Dhc64C (gene:FBgn0261797 transcript:FBtr0332748)

HSP 1 Score: 68.1662 bits (165), Expect = 2.574e-10
Identity = 62/285 (21.75%), Postives = 138/285 (48.42%), Query Frame = 2
Query: 9698 SHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSK---SNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNS-WEEIKEIMVKINLYEELLY-FDKDHI-DEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQ-DLEVKVY--EHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS 10525
            + +KQM +    A  + I  +++   L     +++EK K   ++L +V P  + A   ++++    + E++T   PP  V+  +E + LLLG + + W+ I+ ++++ N    ++  F  ++I D+ + K+ +K L+N   + E +   S A   +  W  A + Y ++ + + P   EL +++E+  +    L   K   DL+ Q +  +  Y  E+ +L+++ +++   + + + K+D    +L  +    + W      F        +S +S II ++ LS
Sbjct: 3232 AKLKQMFQDQQEAEKKKIQSQEIQIRLADQTVKIEEKRKYVMADLAQVEPAVIDAQAAVKSIRKQQLVEVRTMANPPSVVKLALESICLLLGENATDWKSIRAVIMRENFINSIVSNFGTENITDDVREKMKSKYLSNPDYNFEKVNRASMACGPMVKWAIAQIEYADMLKRVEPLREELRSLEEQADV---NLASAKETKDLVEQLERSIAAYKEEYAQLISQAQAIKTDLENVQAKVDRSIALLKSLNIERERWESTSETF--------KSQMSTIIGDVLLS 3505          

HSP 2 Score: 57.7658 bits (138), Expect = 3.227e-7
Identity = 50/203 (24.63%), Postives = 95/203 (46.80%), Query Frame = 3
Query: 4071 ECQEKWLFLERIFEEESFVQAHLET-AANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAI-SLISQTGERLDLYKPVCP--RNSASQWLKEFELVFKSTLKFYIESCLVQQSEE 4667
            + Q +W++LE IF   + ++  L    + F +++ + L L+ ++ +SP V     I  V   Q+  E      RL +L+ ++   +    E ++  R  FPR +F+ D  L+E++    S+NI  + +    +F  V  +L +E  N I  + S+ GE +    PV        ++WL   E      ++F + S L Q  ++
Sbjct: 1529 DVQRRWVYLEGIFSGSADIKTLLPVETSRFQSISSEFLGLMKKVTKSPKVMDVLNIPAV---QRSLE------RLADLLGKIQKALG---EYLERERTSFPRFYFVGDEDLLEIIGN--SKNIARLQKHFKKMFAGVAAILLNEENNVILGISSREGEEVHFMNPVSTVEHPKINEWLSLVE----KQMRFTLASLLAQAVQD 1713          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Zebrafish
Match: si:dkey-11m19.5 (si:dkey-11m19.5 [Source:ZFIN;Acc:ZDB-GENE-120709-97])

HSP 1 Score: 176.022 bits (445), Expect = 7.908e-43
Identity = 248/1126 (22.02%), Postives = 463/1126 (41.12%), Query Frame = 3
Query: 2289 DGFTELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYFYEQKLVKVKRYIHNLENTEKQVILSNRIFTVSXXXXXXXXXXXXXXXXXTISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIKTLIRV*PKGCTWNETLGNVIEAWKYSIVVHYELEDSARNIENVICGSRYSTVSDDVKEVLMEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVSLVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFE-SIAISKTP-VGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADS--IISIQLKKPQA----KGDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAIS---LISQTGERL---------DLYKP-VCPRNS---ASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLINKISKNENL-EQLRMLSAIQNLVVLNDRH---IEILAKLMEDPDCSSKSFVYQAIVKY---DTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYL 5573
            D  TE+F  C+          +W++DV    + W   +  T     SP  YE+ + K++ ++  + N  +    SN++FTV    I +++ +++    + +S  +   ++      I ++   ++ ++        FT     +  S       Q+ +  + SL + +R +   +   D     +V  LW+  +   ++A D V+ +  ++L T+ + + +L+       +   T G  ++  + ++ +  +L        N +C S++  +++   +     S++L G      +LD  F              V + Q R  +      W L+  S+ QI+ WK   F  F ++ A + +  W  +   F         ++++    +  F  F+    +L S     +HW+     IG  + DP  KLTV DL+  D++ H   +  +  D+  +    + F    R W T EF               H+RF  ++   +TP +G+       ++H                I++      F I  +  L     +S  I+S  L+ P      K  + + L ++ L++L     I    Q+KW+F+ R F E   V    E    F   +K    +++     P V  +  +          +  +L++  L  +  M  I  +   ++++ R  FPRL+ L D +LI+LL+ +      S+ + +   F  VK+L      N  S   L + T ER+         D Y P +CP  S      WL  FE      +K     CL  Q +     +K  K            +F++ D I+   H  S S++   EEL+  I         +YPLQ LLVAD++ +  T++++         + K     + H    LIN+ S + N     R+L+A++ L++L  +H    + L K+  D +    SF +Q ++KY      +  A+ L+PS   +  +V +    +Q  Y YEYI      +  T  TEQ  + ++L L S +   I G + S K   A      LGR +  +    S  S    +  LGAL +G+ L +++ D +  G +S++ ++L
Sbjct:  405 DAITEVFQLCESH--------SWLIDVHLFTSQWGSDSPKT-LRGCSPLKYEELIKKLQFWMDKVHNVPQFFNTSNKLFTVEISNIKKQIGSKLNIIAKDLSKLLYEDLQIRSKNLIAELKRAVEIMQSEPNSFHKFTVFADMVKQSEKMSGNMQQELKDLHSLQESVRQNYTQVALNDMISMKQVVDLWDCLVPLTKQAADKVSQQLPSMLETLDSNVSSLVNKLDNLVS-RATSGPYLDPDQNAMEMLVQL--------NTLC-SQFYVIAEQFNDQ-SRASEILRG-----HQLDLTF--------------VGVAQQR--IEARKGLWELISMSSTQIQEWKLLHFRKFVVTKAQDVVGSWIQKAETFAKVIPFHDALLQKNLQILQAFNQFLSVLSKLISPTLKHKHWRNISKAIGLAY-DPEWKLTVADLLSKDLQRHQNKINKICLDSKAETDMEQMFRALQRQWETAEFH--------------HKRFIIAVQQQQTPQLGDVLPQNAPKHH----------------ISDGGT---FTITGIETLLAHSKESVLILSDMLRSPYVDEFQKDVEHWLLFLQELDEL---LDIFERYQQKWIFISRTFNEN--VHQKFELQERFHPADKLFREIIEITVNDPHVCSFVHLSTRTEFSDTLQGQSLRAAFLNGLTTMEEISNHFLNVLESARSQFPRLYCLSDGELIKLLSLQLPAP-SSLLQLIQKCFTGVKQLDVQVEGNVCSTHDLTALTNERMLVHGIYGEFDEYVPFICPLKSNLNPVAWLGLFEQKLNQAVKLRFVKCLAIQQK-----SKHGK------------LFRDPDLIE---HNKSNSSEVAHEELLKLI--------SQYPLQCLLVADEVLWFSTIQESNCATADMWKTIKCQKAAQLHYLCQLINENSTDSNKNPSRRILTALRALIMLTLKHSCQADGLVKVKGDLE---TSFEWQKLMKYYLIPNANAIASDLLPSPEDQ--SVCVDILRTQLPYGYEYIGPENWTMVNTPSTEQAYMGIILALSSFKCAFISGPYMSGKQHAAVQLGYALGRQVVILKCCSSTRSSVISQTLLGALQNGAWLVLDSVDLLEQGTLSDLGQHL 1416          

HSP 2 Score: 99.7525 bits (247), Expect = 8.859e-20
Identity = 92/397 (23.17%), Postives = 189/397 (47.61%), Query Frame = 2
Query: 9416 LAEAHIYLNKYLYRIL--QRFGVAFDCNGKYLDFSMAVF---NHLFEVFRVKTESKIQRVESAMKSVKNAXXXXXXXXXXXXXXXXXXASLNVD----ISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQ------LGELLA-VQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVL 10558
            +A  H+  +KY   +L  Q FG    C   Y++  +  F   +HLFE  RV+ +S++ +V + +K + +  ++  +      +  +E     +D    + N A  + + K       +Q + +EK +  L   L  ++++ +    +VSP Y AALE ++ L    ++EI+ Y  PP+ V  +++I+ +L      W+  +++MV+ + ++EL +FD   +  +  + L  ++       +S+ ++S+A  SL  W+ A+ +Y  + R I PQ      L  L+A  +E++S+ + ++   + R D + +  E+   + + L A+  +   Q R+          +L   E ++K+W  +  +     Q +P   L    +  YL  F   +R E+L
Sbjct: 2814 MARIHLLASKYAVTLLHLQPFG----CRS-YVELMVQFFFFCHHLFEKNRVQ-DSRLGKVLAHVKDMTDTAARHTQKVLTFRAKCEEKQKC-IDQLQKLVNPAQKIWEQKH------HQSVQEEKWLSNLEDNLLRVQQQVQDAFKQVSPLYQAALEALQALSQSDLDEIRHYRMPPDGVVMVMDIICMLFNRPCGWDSSRQLMVQSSFFQELEFFDCSKLTNQTIQKLGHIIQTPCFQPDSVRDMSRACESLCRWVRAVYQYACIQRHIAPQKAKKQDLDYLMAESRERLSVLRLQMESERERLDELERQQELNKQDMELLKAQLSTAEAQERE-------SCAILKLAEHHIKDWISEGKEATLANQSIPGDALILAAAVTYLGPFGPDVRQELL 3190          

HSP 3 Score: 69.707 bits (169), Expect = 9.848e-11
Identity = 53/209 (25.36%), Postives = 98/209 (46.89%), Query Frame = 3
Query: 1092 DGTGVAM-SLTDWYRESILYCALKCMPFVKQFLVRKYFQGWR----SLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLY-SKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNIT 1700
            DG  + + +L +WYRE++L  A++ +PF +  L+RK F+ W      +TV  R       L   L+     +  ++L +ARL++E+ Q+++LP +     T   F   +      A   L +F      ++N    + Y+A Q  Q++  +  LY S  S++++       Q+ L+     +  LG+   L + M    +V I+   IT
Sbjct:    3 DGCSIELWTLAEWYREAVLCEAVREIPFFRDCLLRKIFKRWHRNVHKVTVKRR----IDILPSQLLIAVPQFRNALLHLARLIEELKQVRWLPQDPLRTYTLLDFQTALLEKKRTAQASLDRFLHCRAAVLNTVKDKSYQACQDLQMEVENVKLYQSSQSLHLQVSYLRKLQKELSQAEQAIQWLGNLASLADHMTVQNLVTISKGEIT 207          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Zebrafish
Match: si:dkey-11m19.5 (si:dkey-11m19.5 [Source:ZFIN;Acc:ZDB-GENE-120709-97])

HSP 1 Score: 176.022 bits (445), Expect = 7.908e-43
Identity = 248/1126 (22.02%), Postives = 463/1126 (41.12%), Query Frame = 3
Query: 2289 DGFTELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYFYEQKLVKVKRYIHNLENTEKQVILSNRIFTVSXXXXXXXXXXXXXXXXXTISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIKTLIRV*PKGCTWNETLGNVIEAWKYSIVVHYELEDSARNIENVICGSRYSTVSDDVKEVLMEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVSLVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFE-SIAISKTP-VGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADS--IISIQLKKPQA----KGDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAIS---LISQTGERL---------DLYKP-VCPRNS---ASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLINKISKNENL-EQLRMLSAIQNLVVLNDRH---IEILAKLMEDPDCSSKSFVYQAIVKY---DTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYL 5573
            D  TE+F  C+          +W++DV    + W   +  T     SP  YE+ + K++ ++  + N  +    SN++FTV    I +++ +++    + +S  +   ++      I ++   ++ ++        FT     +  S       Q+ +  + SL + +R +   +   D     +V  LW+  +   ++A D V+ +  ++L T+ + + +L+       +   T G  ++  + ++ +  +L        N +C S++  +++   +     S++L G      +LD  F              V + Q R  +      W L+  S+ QI+ WK   F  F ++ A + +  W  +   F         ++++    +  F  F+    +L S     +HW+     IG  + DP  KLTV DL+  D++ H   +  +  D+  +    + F    R W T EF               H+RF  ++   +TP +G+       ++H                I++      F I  +  L     +S  I+S  L+ P      K  + + L ++ L++L     I    Q+KW+F+ R F E   V    E    F   +K    +++     P V  +  +          +  +L++  L  +  M  I  +   ++++ R  FPRL+ L D +LI+LL+ +      S+ + +   F  VK+L      N  S   L + T ER+         D Y P +CP  S      WL  FE      +K     CL  Q +     +K  K            +F++ D I+   H  S S++   EEL+  I         +YPLQ LLVAD++ +  T++++         + K     + H    LIN+ S + N     R+L+A++ L++L  +H    + L K+  D +    SF +Q ++KY      +  A+ L+PS   +  +V +    +Q  Y YEYI      +  T  TEQ  + ++L L S +   I G + S K   A      LGR +  +    S  S    +  LGAL +G+ L +++ D +  G +S++ ++L
Sbjct:  405 DAITEVFQLCESH--------SWLIDVHLFTSQWGSDSPKT-LRGCSPLKYEELIKKLQFWMDKVHNVPQFFNTSNKLFTVEISNIKKQIGSKLNIIAKDLSKLLYEDLQIRSKNLIAELKRAVEIMQSEPNSFHKFTVFADMVKQSEKMSGNMQQELKDLHSLQESVRQNYTQVALNDMISMKQVVDLWDCLVPLTKQAADKVSQQLPSMLETLDSNVSSLVNKLDNLVS-RATSGPYLDPDQNAMEMLVQL--------NTLC-SQFYVIAEQFNDQ-SRASEILRG-----HQLDLTF--------------VGVAQQR--IEARKGLWELISMSSTQIQEWKLLHFRKFVVTKAQDVVGSWIQKAETFAKVIPFHDALLQKNLQILQAFNQFLSVLSKLISPTLKHKHWRNISKAIGLAY-DPEWKLTVADLLSKDLQRHQNKINKICLDSKAETDMEQMFRALQRQWETAEFH--------------HKRFIIAVQQQQTPQLGDVLPQNAPKHH----------------ISDGGT---FTITGIETLLAHSKESVLILSDMLRSPYVDEFQKDVEHWLLFLQELDEL---LDIFERYQQKWIFISRTFNEN--VHQKFELQERFHPADKLFREIIEITVNDPHVCSFVHLSTRTEFSDTLQGQSLRAAFLNGLTTMEEISNHFLNVLESARSQFPRLYCLSDGELIKLLSLQLPAP-SSLLQLIQKCFTGVKQLDVQVEGNVCSTHDLTALTNERMLVHGIYGEFDEYVPFICPLKSNLNPVAWLGLFEQKLNQAVKLRFVKCLAIQQK-----SKHGK------------LFRDPDLIE---HNKSNSSEVAHEELLKLI--------SQYPLQCLLVADEVLWFSTIQESNCATADMWKTIKCQKAAQLHYLCQLINENSTDSNKNPSRRILTALRALIMLTLKHSCQADGLVKVKGDLE---TSFEWQKLMKYYLIPNANAIASDLLPSPEDQ--SVCVDILRTQLPYGYEYIGPENWTMVNTPSTEQAYMGIILALSSFKCAFISGPYMSGKQHAAVQLGYALGRQVVILKCCSSTRSSVISQTLLGALQNGAWLVLDSVDLLEQGTLSDLGQHL 1416          

HSP 2 Score: 99.7525 bits (247), Expect = 8.859e-20
Identity = 92/397 (23.17%), Postives = 189/397 (47.61%), Query Frame = 2
Query: 9416 LAEAHIYLNKYLYRIL--QRFGVAFDCNGKYLDFSMAVF---NHLFEVFRVKTESKIQRVESAMKSVKNAXXXXXXXXXXXXXXXXXXASLNVD----ISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQ------LGELLA-VQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVL 10558
            +A  H+  +KY   +L  Q FG    C   Y++  +  F   +HLFE  RV+ +S++ +V + +K + +  ++  +      +  +E     +D    + N A  + + K       +Q + +EK +  L   L  ++++ +    +VSP Y AALE ++ L    ++EI+ Y  PP+ V  +++I+ +L      W+  +++MV+ + ++EL +FD   +  +  + L  ++       +S+ ++S+A  SL  W+ A+ +Y  + R I PQ      L  L+A  +E++S+ + ++   + R D + +  E+   + + L A+  +   Q R+          +L   E ++K+W  +  +     Q +P   L    +  YL  F   +R E+L
Sbjct: 2814 MARIHLLASKYAVTLLHLQPFG----CRS-YVELMVQFFFFCHHLFEKNRVQ-DSRLGKVLAHVKDMTDTAARHTQKVLTFRAKCEEKQKC-IDQLQKLVNPAQKIWEQKH------HQSVQEEKWLSNLEDNLLRVQQQVQDAFKQVSPLYQAALEALQALSQSDLDEIRHYRMPPDGVVMVMDIICMLFNRPCGWDSSRQLMVQSSFFQELEFFDCSKLTNQTIQKLGHIIQTPCFQPDSVRDMSRACESLCRWVRAVYQYACIQRHIAPQKAKKQDLDYLMAESRERLSVLRLQMESERERLDELERQQELNKQDMELLKAQLSTAEAQERE-------SCAILKLAEHHIKDWISEGKEATLANQSIPGDALILAAAVTYLGPFGPDVRQELL 3190          

HSP 3 Score: 69.707 bits (169), Expect = 9.848e-11
Identity = 53/209 (25.36%), Postives = 98/209 (46.89%), Query Frame = 3
Query: 1092 DGTGVAM-SLTDWYRESILYCALKCMPFVKQFLVRKYFQGWR----SLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLY-SKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNIT 1700
            DG  + + +L +WYRE++L  A++ +PF +  L+RK F+ W      +TV  R       L   L+     +  ++L +ARL++E+ Q+++LP +     T   F   +      A   L +F      ++N    + Y+A Q  Q++  +  LY S  S++++       Q+ L+     +  LG+   L + M    +V I+   IT
Sbjct:    3 DGCSIELWTLAEWYREAVLCEAVREIPFFRDCLLRKIFKRWHRNVHKVTVKRR----IDILPSQLLIAVPQFRNALLHLARLIEELKQVRWLPQDPLRTYTLLDFQTALLEKKRTAQASLDRFLHCRAAVLNTVKDKSYQACQDLQMEVENVKLYQSSQSLHLQVSYLRKLQKELSQAEQAIQWLGNLASLADHMTVQNLVTISKGEIT 207          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Zebrafish
Match: si:dkey-11m19.5 (si:dkey-11m19.5 [Source:ZFIN;Acc:ZDB-GENE-120709-97])

HSP 1 Score: 160.614 bits (405), Expect = 2.933e-38
Identity = 192/795 (24.15%), Postives = 331/795 (41.64%), Query Frame = 3
Query: 3282 WTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFE-SIAISKTP-VGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADS--IISIQLKKPQA----KGDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAIS---LISQTGERL---------DLYKP-VCPRNS---ASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLINKISKNENL-EQLRMLSAIQNLVVLNDRH---IEILAKLMEDPDCSSKSFVYQAIVKY---DTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYL 5573
            W L+  S+ QI+ WK   F  F ++ A + +  W  +   F         ++++    +  F  F+    +L S     +HW+     IG  + DP  KLTV DL+  D++ H   +  +  D+  +    + F    R W T EF               H+RF  ++   +TP +G+       ++H                I++      F I  +  L     +S  I+S  L+ P      K  + + L ++ L++L     I    Q+KW+F+ R F E   V    E    F   +K    +++     P V  +  +          +  +L++  L  +  M  I  +   ++++ R  FPRL+ L D +LI+LL+ +      S+ + +   F  VK+L      N  S   L + T ER+         D Y P +CP  S      WL  FE      +K     CL  Q +     +K  K            +F++ D I+   H  S S++   EEL+  I         +YPLQ LLVAD++ +  T++++         + K     + H    LIN+ S + N     R+L+A++ L++L  +H    + L K+  D +    SF +Q ++KY      +  A+ L+PS   +  +V +    +Q  Y YEYI      +  T  TEQ  + ++L L S +   I G + S K   A      LGR +  +    S  S    +  LGAL +G+ L +++ D +  G +S++ ++L
Sbjct:   23 WELISMSSTQIQEWKLLHFRKFVVTKAQDVVGSWIQKAETFAKVIPFHDALLQKNLQILQAFNQFLSVLSKLISPTLKHKHWRNISKAIGLAY-DPEWKLTVADLLSKDLQRHQNKINKICLDSKAETDMEQMFRALQRQWETAEFH--------------HKRFIIAVQQQQTPQLGDVLPQNAPKHH----------------ISDGGT---FTITGIETLLAHSKESVLILSDMLRSPYVDEFQKDVEHWLLFLQELDEL---LDIFERYQQKWIFISRTFNEN--VHQKFELQERFHPADKLFREIIEITVNDPHVCSFVHLSTRTEFSDTLQGQSLRAAFLNGLTTMEEISNHFLNVLESARSQFPRLYCLSDGELIKLLSLQLPAP-SSLLQLIQKCFTGVKQLDVQVEGNVCSTHDLTALTNERMLVHGIYGEFDEYVPFICPLKSNLNPVAWLGLFEQKLNQAVKLRFVKCLAIQQK-----SKHGK------------LFRDPDLIE---HNKSNSSEVAHEELLKLI--------SQYPLQCLLVADEVLWFSTIQESNCATADMWKTIKCQKAAQLHYLCQLINENSTDSNKNPSRRILTALRALIMLTLKHSCQADGLVKVKGDLE---TSFEWQKLMKYYLIPNANAIASDLLPSPEDQ--SVCVDILRTQLPYGYEYIGPENWTMVNTPSTEQAYMGIILALSSFKCAFISGPYMSGKQHAAVQLGYALGRQVVILKCCSSTRSSVISQTLLGALQNGAWLVLDSVDLLEQGTLSDLGQHL 744          

HSP 2 Score: 88.9669 bits (219), Expect = 1.366e-16
Identity = 91/399 (22.81%), Postives = 185/399 (46.37%), Query Frame = 2
Query: 9410 QMLAEAHIYLNKYLYRIL--QRFGVAFDCNGKYLDFSMAVF---NHLFEVFRVKTESKIQRVESAMKSVKNAXXXXXXXXXXXXXXXXXXASLNVD----ISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQ------LGELLA-VQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVL 10558
            + +A  H+  +KY   +L  Q FG    C   Y++  +  F   +HLFE  RV+ +S++ +V + +K + +  ++  +      +  +E     +D    + N A  + + K       +Q + +EK +  L   L  ++++ +    +VSP Y AALE ++ L    ++EI+ Y  PP+ V  +++I+ +L      W+  +++M       EL +FD   +  +  + L  ++       +S+ ++S+A  SL  W+ A+ +Y  + R I PQ      L  L+A  +E++S+ + ++   + R D + +  E+   + + L A+  +   Q R+          +L   E ++K+W  +  +     Q +P   L    +  YL  F   +R E+L
Sbjct: 2108 KAMARIHLLASKYAVTLLHLQPFG----CRS-YVELMVQFFFFCHHLFEKNRVQ-DSRLGKVLAHVKDMTDTAARHTQKVLTFRAKCEEKQKC-IDQLQKLVNPAQKIWEQKH------HQSVQEEKWLSNLEDNLLRVQQQVQDAFKQVSPLYQAALEALQALSQSDLDEIRHYRMPPDGVVMVMDIICMLFNRPCGWDSSRQLM-------ELEFFDCSKLTNQTIQKLGHIIQTPCFQPDSVRDMSRACESLCRWVRAVYQYACIQRHIAPQKAKKQDLDYLMAESRERLSVLRLQMESERERLDELERQQELNKQDMELLKAQLSTAEAQERE-------SCAILKLAEHHIKDWISEGKEATLANQSIPGDALILAAAVTYLGPFGPDVRQELL 2479          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 91.2781 bits (225), Expect = 3.154e-17
Identity = 61/257 (23.74%), Postives = 124/257 (48.25%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDI 10567
            + E ++ +L+E  P    A++ + +L+   + EIK+Y +PP  V  +++ V +L G + +W E K  + + N  ++L+ FDKD+I ++  K + +  T      E +  VS AA SL  W+ A+  Y  + R + P+   L     +++  Q+ L + + +   + + L+    ++ E LA+++ +  +  D + K+D    ++S +      W +      + M  L    L       Y+  F    R+E++ DI
Sbjct: 3157 MAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDI 3413          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 91.2781 bits (225), Expect = 3.199e-17
Identity = 61/257 (23.74%), Postives = 124/257 (48.25%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDI 10567
            + E ++ +L+E  P    A++ + +L+   + EIK+Y +PP  V  +++ V +L G + +W E K  + + N  ++L+ FDKD+I ++  K + +  T      E +  VS AA SL  W+ A+  Y  + R + P+   L     +++  Q+ L + + +   + + L+    ++ E LA+++ +  +  D + K+D    ++S +      W +      + M  L    L       Y+  F    R+E++ DI
Sbjct: 3037 MAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDI 3293          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 92.4337 bits (228), Expect = 2.298e-17
Identity = 110/524 (20.99%), Postives = 213/524 (40.65%), Query Frame = 3
Query: 4044 LRLSTTILGE---CQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLI-NKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLLLQER 5603
            LRL+  +L E   CQ  WL+LE IF  E   +        +  + +    ++   +++  V    P  ++L S ++       ++LLEL+++       + E ++  R  FPR +FL D +L+E+L+   +++  ++   +   F  V RLLF        + S  GE + L K + P  +   WL E E V K++++ YIE  +    E               T RT+                                      W++ +P QV +   + F+ K + +AL D G         L  +    V L+  K+S+     Q  +LSA   L+V+     ++ A+L+E+   S   F + + ++Y    +              ++ ++   ++FLY YEY+  +   L +T +T++  + +   L+        G   + K E  K   + L       +    +   +  K+F G   SG+    + F+ I +  +S +++ +  ++   Q+R
Sbjct: 1114 LRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLREC------NKLLELVQK------GLSEYLETKRAAFPRFYFLSDDELLEILSQ--TKDPTAVQPHLRKCFENVARLLFQHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVYPE---------------TPRTE--------------------------------------WVLNWPGQVTIAGCQTFWTKDVSEAL-DAGDLSNRLFPQLESQLSGLVALVRGKLSRM----QRSILSA---LIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYWARD--------------DLYVRAVNAEFLYGYEYLG-NTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQR 1547          

HSP 2 Score: 67.781 bits (164), Expect = 5.342e-10
Identity = 54/270 (20.00%), Postives = 121/270 (44.81%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG--------------YDNSWEEIKEIMVKINLY-EELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLD 10561
            + + ++ +L+E  P   AAL ++++L+   + E++   +PP  V+ ++E V ++ G               D+ WE  K ++     + E L  FDKD+I +   K +   + NE     ++  VS+A  S+  W+ A+ +Y  ++R + P+   L   QE +++ Q  L   K R   +   +     ++++ ++K++ +  +    + K+     +++ +    + W D       L+ ++   +L       YL  F    R  + +
Sbjct: 2780 IADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKLITGLSDERQRWQDTVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFN 3049          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 92.0485 bits (227), Expect = 2.337e-17
Identity = 110/524 (20.99%), Postives = 213/524 (40.65%), Query Frame = 3
Query: 4044 LRLSTTILGE---CQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLI-NKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLLLQER 5603
            LRL+  +L E   CQ  WL+LE IF  E   +        +  + +    ++   +++  V    P  ++L S ++       ++LLEL+++       + E ++  R  FPR +FL D +L+E+L+   +++  ++   +   F  V RLLF        + S  GE + L K + P  +   WL E E V K++++ YIE  +    E               T RT+                                      W++ +P QV +   + F+ K + +AL D G         L  +    V L+  K+S+     Q  +LSA   L+V+     ++ A+L+E+   S   F + + ++Y    +              ++ ++   ++FLY YEY+  +   L +T +T++  + +   L+        G   + K E  K   + L       +    +   +  K+F G   SG+    + F+ I +  +S +++ +  ++   Q+R
Sbjct: 1109 LRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLREC------NKLLELVQK------GLSEYLETKRAAFPRFYFLSDDELLEILSQ--TKDPTAVQPHLRKCFENVARLLFQHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVYPE---------------TPRTE--------------------------------------WVLNWPGQVTIAGCQTFWTKDVSEAL-DAGDLSNRLFPQLESQLSGLVALVRGKLSRM----QRSILSA---LIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYWARD--------------DLYVRAVNAEFLYGYEYLG-NTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQR 1542          

HSP 2 Score: 68.1662 bits (165), Expect = 4.555e-10
Identity = 54/270 (20.00%), Postives = 122/270 (45.19%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG--------------YDNSWEEIKEIMVKINLYEELLY-FDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLD 10561
            + + ++ +L+E  P   AAL ++++L+   + E++   +PP  V+ ++E V ++ G               D+ WE  K ++     + E L+ FDKD+I +   K +   + NE     ++  VS+A  S+  W+ A+ +Y  ++R + P+   L   QE +++ Q  L   K R   +   +     ++++ ++K++ +  +    + K+     +++ +    + W D       L+ ++   +L       YL  F    R  + +
Sbjct: 2775 IADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKLGRADKLITGLSDERQRWQDTVLNLENLLVNVAGDLLLCAGFLAYLGPFTGPYRTTLFN 3044          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Xenopus
Match: plekhg3 (pleckstrin homology and RhoGEF domain containing G3 [Source:Xenbase;Acc:XB-GENE-6468932])

HSP 1 Score: 92.0485 bits (227), Expect = 2.567e-17
Identity = 110/524 (20.99%), Postives = 213/524 (40.65%), Query Frame = 3
Query: 4044 LRLSTTILGE---CQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLI-NKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLLLQER 5603
            LRL+  +L E   CQ  WL+LE IF  E   +        +  + +    ++   +++  V    P  ++L S ++       ++LLEL+++       + E ++  R  FPR +FL D +L+E+L+   +++  ++   +   F  V RLLF        + S  GE + L K + P  +   WL E E V K++++ YIE  +    E               T RT+                                      W++ +P QV +   + F+ K + +AL D G         L  +    V L+  K+S+     Q  +LSA   L+V+     ++ A+L+E+   S   F + + ++Y    +              ++ ++   ++FLY YEY+  +   L +T +T++  + +   L+        G   + K E  K   + L       +    +   +  K+F G   SG+    + F+ I +  +S +++ +  ++   Q+R
Sbjct: 1162 LRLTQDVLEEWLICQRSWLYLEPIFSSEDINRQLPVEGKRYQTMERTWRKIMKNAEENKQVISLCPEPRLLESLREC------NKLLELVQK------GLSEYLETKRAAFPRFYFLSDDELLEILSQ--TKDPTAVQPHLRKCFENVARLLFQHDLQITHMYSAEGEEVKLSKAIYPTGNVEDWLFEVEKVMKASVREYIERSIKVYPE---------------TPRTE--------------------------------------WVLNWPGQVTIAGCQTFWTKDVSEAL-DAGDLSNRLFPQLESQLSGLVALVRGKLSRM----QRSILSA---LIVIEVHAKDVAARLIEENVSSVNDFEWISQLRYYWARD--------------DLYVRAVNAEFLYGYEYLG-NTGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQR 1595          

HSP 2 Score: 60.8474 bits (146), Expect = 6.940e-8
Identity = 46/212 (21.70%), Postives = 103/212 (48.58%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG--------------YDNSWEEIKEIMVKINLYEELLY-FDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKI 10387
            + + ++ +L+E  P   AAL ++++L+   + E++   +PP  V+ ++E V ++ G               D+ WE  K ++     + E L+ FDKD+I +   K +   + NE     ++  VS+A  S+  W+ A+ +Y  ++R + P+   L   QE +++ Q  L   K R   +   +     ++++ ++K++ +  +    + K+
Sbjct: 2826 IADDAQKDLDEALPALDAALASLKSLNKNDVTEVRAMQRPPVGVKLVIEAVCIMKGIKPKKVAGDKPGSKIDDYWEPGKGLLQDPGKFLEGLFKFDKDNIPDAVIKAIQPYIDNEEFQPAAIARVSKACTSICQWVRAMHKYHFVARGVEPKRQALREAQEDLAVTQKILDAAKARLRDVEDGIATLQAKYRDCVSKKEELEHKCEQCEQKL 3037          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Xenopus
Match: DNAH2 (dynein, axonemal, heavy chain 2 [Source:NCBI gene;Acc:100170584])

HSP 1 Score: 82.8037 bits (203), Expect = 1.562e-14
Identity = 56/243 (23.05%), Postives = 120/243 (49.38%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS 10525
            L E ++ +L E  P    A+  + +L+   + EIK+Y +PP  V  +++ V +L G + +W E K  + + N  ++L++FDKD+I ++  K + +         + +  VS AA SL  W+ A+  Y  L R + P+   + A   +++  Q+ L + + +   + + LE    ++ E LA+++++  +    + K+     +++ +      W +       L +DL   +   ++++ YLS
Sbjct: 2989 LAENAQKDLEEALPALEEAMRALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGNEPTWAEAKRQLGESNFIKQLIHFDKDNISDRVLKKIGQYCILPDFQPDIIGKVSLAARSLCMWVRAMEVYGRLFRVVEPKRARMNAAMNQLAEKQASLAEAQNKLREVAERLEQLKTQYDEKLAQKEALRAEAELMELKLQRAGTLVTGLAGEKSRWEE---TVKGLDEDLGFLVGDCLLASAYLS 3228          

HSP 2 Score: 71.2478 bits (173), Expect = 5.179e-11
Identity = 90/441 (20.41%), Postives = 173/441 (39.23%), Query Frame = 3
Query: 3432 IVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDN-KSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRY-KLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEE----IMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEAT-----NAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESC---LVQQSEESNEVTKEAKSAIFMT 4712
            IVE +R  +++F   MP    L +     +HW Q   ++   F +  +  T++ +++L + +H   +  +   A                  TKE   E+   ++       + +E+  +   P  ++    L    D  ++LE+    LS +  +            +   E+D+                 DR+ + L   LE + +  T+    Q +WL+LE IF  E   +   + +A F ++N    V++ +                L    ++        LLE +  MNG++  I++     ++  RH FPR +F+ +  L+E+L    S+N  ++   +   F  +K L   +A       A  + S  GE +D   PV        WL + E   + TLK  + +C   L + S + ++  KE    + +T
Sbjct: 1248 IVETSRQRIDQFKRTMPLIADLRNPALRERHWSQVKQEVQGPFDETAEDFTLEKIVELGLDQHVEKISEISTSA------------------TKELFIEQGLENI------SKTWEATLLDIMPYKDKGHHRLRGTDDVFQALEDNQVALSTMKASPF----------VKAFEQDV-----------------DRWERCLSHILEVIEMILTV----QRQWLYLENIFTGEDIRKQLPQESAEFDDINVSWKVIMGR----------------LTKDNNALRGTHHPGLLEKLGEMNGVLEGIQKSLDMYLETKRHIFPRFYFISNDDLLEILGQ--SRNPDAVQPHLKKCFDNIKSLKIQKAGIGSKYEAAGMFSAEGEYVDFTHPVLLEGPVEAWLCDIERTMRWTLKELLRNCRLALKKMSSKRDKWVKEWAGQMLIT 1615          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Xenopus
Match: ENSXETT00000008415.1 (dynein axonemal heavy chain 14 [Source:NCBI gene;Acc:100036695])

HSP 1 Score: 76.2554 bits (186), Expect = 5.543e-13
Identity = 52/188 (27.66%), Postives = 87/188 (46.28%), Query Frame = 2
Query: 9803 EKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVY-EHKELLAKRKSMSDQ 10363
            E++   LNEV P    A+  +  LD G I E+K Y  PP  V  ++  V +LL     W   K ++      + L+  DKD I EK +  L K       + + +  VS A  SL  W+ A+  Y ++ + + P+   +   Q  + +AQ  L   +    ++R  L    Y   ++LLA+RK ++ +
Sbjct:  131 EQAVQELNEVLPALQEAVSALDALDKGDISEVKVYTHPPFLVLTVMNAVCVLLQQKPDWPTAKLLLGDPGFLKRLVGLDKDSIPEKAFLKLKKYSKTPEFNPQKVGMVSSACRSLCQWVLALEHYHDVKKMVTPKQKHVAEAQGALGLAQERLRHKQRSLAMVRDFLHSCCYASERQLLAQRKQLTTE 318          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Mouse
Match: Dnhd1 (dynein heavy chain domain 1 [Source:MGI Symbol;Acc:MGI:1924755])

HSP 1 Score: 192.586 bits (488), Expect = 8.356e-48
Identity = 310/1591 (19.48%), Postives = 625/1591 (39.28%), Query Frame = 3
Query:  954 REMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWR-SLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYLIKFYKY---VQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNITILGELLCAMEINIGNEGPADNKPNKIAIFRTKAVIVPTDEKLMLKAFPGVEDIEAMFTNIINSIPKLILKHCYPLDGLIRSDHLNRFKEIIVGNLSENRTGHSTILTSKSEILTEIMSKSERRLDKITKPDLPYIKLPVKSEDNLRVATPPAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPIYCNLIDGFTELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYF-YEQKLVKVKRYIHNLENTEKQVILSNRIFTVSXXXXXXXXXXXXXXXXXTISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIKTLIRV*PKGCTWNETLGNVIEAWKYSIVVHYELEDSARNIENVICGSRYSTVSDDVKEVLMEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVSLVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADS------IISIQLKKPQAKGDDRYKL---LVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDS---EDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATN----------------AISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLM-LKKHNYVHLINKISK------NENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKS-FVYQAIVKYDTGDNEANLLIPSN-----VHRFGNVTIQCCM-----SQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYL 5573
            +++   YLN    R  + Y L  V   +V PEHYIFS FGI+H  P     AM+L  W+R+  L+  L+ +PF K  L+RK    W+ ++ +   H  +  +L  +L+S    +G  +L I RLL E   + +LP E           + I+  +  A   L  F      +  +++E   ++ + LQ  +VQ+ +     + SIY+++    H ++ L      + KLG F +L+++M+   +V I  + I+            I N   A   P +     ++ V    D+   L   P VE I       + SI    LK       +++S  L   ++++    ++++  ++  L  K         K+   +     P++ Y+  P KS     V               L++ G  +  +F   N + V E L  N      +     L  + +QE+     +  W+  +      W+   +  E +  SP   Y   ++++K++   + N   +++   ++  +S   + EEL +++    + I +   N       + + ++T+ L+  +  + ++    +    +  + + + + ++ V++++SL D++R        ++++++  +  LWE+F F+  + ++F+ S++      I  R++ L+                            ELE     +   + G  +   S + +    ++  +      I    ++L   Y +    + P +      R +V L    W L    ++ +  WK   FS F +S A E+   W TE          +  ++++    + EF +++P   +L +      + Q     +G   +   D LT+  +++  + E +  +  +      +  A +      +YW  ++         +  +    ER      SK P     + EL                        ++   FL+ + + L++ I +S      I++IQ      K    +K+    V  +  L     +    Q+KW+FL ++  E        E  A F  ++     L+      P+V     +  +L + K S   +  +L+  L      +  II  +E+++  V  +FPRLFFL D +L+ LL      + +    +    FP +K + F   +                  I++++  GE + L +P+       +WL   E   +  +   ++SC+  +  +   + K  K+   M ++ +  M                  +  V+  ++++ +        +P Q +LVA+++ +   + +AL      + S  +++  +  HN   L+  I         ++L  +R  S    L+V    H +I A+L+E    S  + F +   +KY  G +  NL  P            +V+   C        F+Y+YEY+      L       QV + +L+ L       I+G     K E   S +  LGR L  +     I  +  R Y  GAL SG+ L + N +++    +S + + L
Sbjct:  328 KKIHFLYLNVVSDRHFNPYKLVAVPPDKVNPEHYIFSPFGILHIHPVEGSEAMTLGTWHRDCALWRELQRIPFFKNCLLRKALTCWKKNVRLCGLH-RIQTFLKTHLLSAIPHFGAGMLHINRLLQEFRSVSWLPKEPDRSYELVDLQKAIAKENHKALRVLCHFLNLCTSILQLIHEDTYQMQQGLQ-ERVQNWNRIRKGQGSIYLQRTLCRHLEKKLKQAETWLLKLGKFARLIDYMICQNLVSILEDEISSF----------IANTLQA---PRQNPFLLSQLVF---DDNGQLSPMPRVESIIQGLIKSLQSIKTSALK-------VLQSTDLRTSRDLLYSEDNKDQDSNAEFLMPK------FHGKASDAVRLFCGPNVGYV-WPWKSHAITDV---------------LEVRGHKLRGQFLHPNYDHVQEDLDKNAGIQQALAVQQSLLEDMRQEVQEFCNKHKWVEGIYEFLKAWSSQKL--EDLRGSPINNYVNLVIQLKKWQERVSNMSVELLTKGKLLFLSGHDVQEELGSKLNNMRKNILEQAQNECWSRNQQLMTELTEFLRVFQTISSDIHAIAQCSQKLSEANEQYCQLEERVEYVRSLHDLIRNHCALFIAENETLDIALLDLWEAFQFERSQVSEFLLSKQH----AIVPRLQQLM-----------------------AAALAELEGL---LAKALSGP-FMDPSQEQRSTEQQLGALEHQFLNILNNFNALCNAYCTFTGYKKPMSPPASGNRPIV-LQQRIWRLYRIISENLGEWKCVAFSKFNLSMAREKTDAWLTEAVRLSTALGLQSPVLQRCMRMLEEFRAYLPLLIKLGNLQLQDLNTQSLLRALGLGSLRSLDLLTLGQMLNYPLLEFAERINQVWQYDKERIHAQEILQQMQQYWEGRQLRLLNFILHVPYKPPTSER------SKRPALRSPQWELV----------------------GKDSGTFLLSDYSSLQDAIQNSLQALFKILAIQ------KSGQLHKIALEWVAIMYGLGALLEVWVAFQQKWIFLNKVLHEMKIEFPAPELNARFKAMDDQYRTLMRISVADPMV-----LSLILPNTKRSPYFQGQHLQQMLKAGSGELEAIIMALEDVLYGVCANFPRLFFLSDSELVALLAAPL--DTREAQLWAQRCFPHIKAVNFRSKSTKKKINQDSSSSTESAETIAVLAAGGEEVKLQEPLPLHTDLPKWLASLEKCLRFIIVNLLQSCVATRLAQGPSLIKALKA---MPQQRQMPM------------------QVYVQHWLDAVQV--------FPWQCILVAEEVVWRAEMEEAL------LESRTMHMRSVHVHNLEVLVQFIRSQRSSQDGKSLPSVRQTSLFSTLLVKAVTHRDI-AQLLEKNQVSDLTDFHWVRQLKYHLGSSHLNLKSPVQCLTTIASTEPSVSPAACWIDVLGRSFMYNYEYMGPKLGPLPSLMHERQVFI-LLMALDEVAYGAILGRDGLGKAETVNSLAWTLGRQLVIMPCLPQIEFQCLRNYLNGALQSGAWLLLENVNQLPSSLLSALGQRL 1759          

HSP 2 Score: 85.8853 bits (211), Expect = 1.624e-15
Identity = 89/375 (23.73%), Postives = 156/375 (41.60%), Query Frame = 2
Query: 9698 SHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRT-DLMRQ------DLEVKVYEHKELLAKRKSMSDQIRDF-KYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVL----------------DDIQERFAQAIKEVAR------------LTVFEDGDLENMIEWHQWDSLIRLHLDNASAFALIL 10714
              ++Q K  Y   + +C  QE LI+ L    + LK + +  L ++   ++  L  +R  D    EEI++Y  PPE V  + + +  L   +  W   K+++   + Y+EL++F K+ + + +   L + L    +   +L +VS  AA+L+ WL+A+LRY    R   P    L  V   ++  Q+ LG+ + +  DL+ Q       LE     H  ++        Q  +F K+ ++S       + T +  WT Q  +  +  + +    L    + +YL  FP   R E+L                DD+     Q    V +            LT+   G      E HQWD  ++    +A    L+L
Sbjct: 3181 GQLEQSKIMYRQKMIECQHQESLIENLVRQHDALKAQQEVFLEQMGKAFVGPLSQLRVAD---FEEIRSYRAPPESVVKVTDALCDLFHQETGWSSAKQLLCTEDFYQELVFFPKEKLTDSELVKLNEALRAPGMSDAALRSVSIPAANLAVWLWAVLRYGLAQRRGLPTGLLLRQVDATLAREQARLGQFQFQAHDLLEQTRSLTKKLEDAQVSHNHVMETLNQA--QCGNFQKWPMESA------LLTPMHMWTTQLQKLQEQAKTVFGDALLCSAAIIYLGPFPPQRRQELLEKWLSLCQGSEEALDPDDVARALRQKSVGVPKNPLLPTRTPFSILTLLSYGS-----ELHQWDRDLKPQAKSARLLGLLL 3539          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 83.5741 bits (205), Expect = 8.133e-15
Identity = 63/263 (23.95%), Postives = 126/263 (47.91%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS---RFPLAMRNEVLDDIQER 10576
            L + ++ +L E  P    A+  + +L+   I EIK+Y +PP  V  +++ V +L G + +W E K  + + N  + L+ FDKD+I +K  K +           + +  VS AA SL  W+ A+  Y  L R + P+   + A   ++   Q+ L + + +   + + LE+   ++ E LA+++ +  +  + + K++    ++S +      W +       L +DL   +   +I+  +LS    F    R+E+++ I  R
Sbjct: 3109 LADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEE---TVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIR 3368          

HSP 2 Score: 60.8474 bits (146), Expect = 4.974e-8
Identity = 49/203 (24.14%), Postives = 88/203 (43.35%), Query Frame = 3
Query: 4074 CQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEE----IMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATN------AISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLV 4652
             Q +W++LE IF  E   +     +A F  VN +   ++D++ +                  ++  S     LLE +  MN I+ +I++     ++  RH FPR +FL +  L+E+L    S+N +++   +   F  +K L   +         A+ + S  GE +D   PV        WL + E   + TL+  + +C V
Sbjct: 1481 VQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKD----------------NNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQ--SRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRV 1665          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 83.5741 bits (205), Expect = 8.341e-15
Identity = 63/263 (23.95%), Postives = 126/263 (47.91%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS---RFPLAMRNEVLDDIQER 10576
            L + ++ +L E  P    A+  + +L+   I EIK+Y +PP  V  +++ V +L G + +W E K  + + N  + L+ FDKD+I +K  K +           + +  VS AA SL  W+ A+  Y  L R + P+   + A   ++   Q+ L + + +   + + LE+   ++ E LA+++ +  +  + + K++    ++S +      W +       L +DL   +   +I+  +LS    F    R+E+++ I  R
Sbjct: 3115 LADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEE---TVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIR 3374          

HSP 2 Score: 60.8474 bits (146), Expect = 4.974e-8
Identity = 49/203 (24.14%), Postives = 88/203 (43.35%), Query Frame = 3
Query: 4074 CQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEE----IMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATN------AISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLV 4652
             Q +W++LE IF  E   +     +A F  VN +   ++D++ +                  ++  S     LLE +  MN I+ +I++     ++  RH FPR +FL +  L+E+L    S+N +++   +   F  +K L   +         A+ + S  GE +D   PV        WL + E   + TL+  + +C V
Sbjct: 1481 VQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKD----------------NNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQ--SRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRV 1665          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Mouse
Match: Dnah5 (dynein, axonemal, heavy chain 5 [Source:MGI Symbol;Acc:MGI:107718])

HSP 1 Score: 72.7886 bits (177), Expect = 1.480e-11
Identity = 66/291 (22.68%), Postives = 128/291 (43.99%), Query Frame = 2
Query: 9734 ALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYD--------------NSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDD 10564
            A+   IS++K I E      E  E +K  L E      AAL+TI+   P  I  ++T  +PP  +  +++ V LL                   SW+E  ++M   N  + L  F KD I+E+  + L         + E+   V    A L  W  A+  + ++++E+ P    L+  + +  +A  +L K +   D  + +L+V   E+++ +A+++++ +     ++K+ +   ++S +    + WT+Q  +F    + L   +L       Y   F    R+ +L D
Sbjct: 3265 AIVDSISKDKAIAE------EKLEAAKPALEEAE----AALQTIK---PSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHD 3542          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Mouse
Match: Dnah9 (dynein, axonemal, heavy chain 9 [Source:MGI Symbol;Acc:MGI:1289279])

HSP 1 Score: 71.2478 bits (173), Expect = 3.915e-11
Identity = 59/277 (21.30%), Postives = 118/277 (42.60%), Query Frame = 2
Query: 9794 ELKEKSK---SNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG------YDNSWEEIKEIMVKINLY-EELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQAIK 10594
            E+++K K    +L +  P   AA   +  L+   + E+K++  PP  V ++   V +L+        D SW+  K  M K++ + + L++FDK++I E   K +   L +   + E +   S AAA L  W+  I+R+  +  ++ P+   L      ++ AQ +L  +K +   + ++L     + ++  A++     +       I     ++  + +    W +    F Q  + L   IL       YL  F    R  ++D     +   +K
Sbjct:  686 EVQQKQKDCEEDLAKAEPALTAAQAALNTLNKTNLTELKSFGSPPLAVSNVSAAVMVLMAPGGKVPKDRSWKAAKITMAKVDSFLDSLIHFDKENIHENCLKAIRPYLQDPAFNPEFVATKSYAAAGLCSWVINIVRFYEVFCDVEPKRQALNKATSDLTTAQEKLAAIKAKITHLNENLAKLTTKFEKATAEKLKCQQEAELTAGTISLANRLVGGLASENIRWAEAVQNFRQQERTLCGDILLTTAFISYLGFFTKKYRKSLMDGTWRPYLSQLK 962          
BLAST of dynein heavy chain domain-containing protein 1-like vs. UniProt
Match: sp|Q96M86|DNHD1_HUMAN (Dynein heavy chain domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DNHD1 PE=2 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 3.279e-23
Identity = 72/255 (28.24%), Postives = 124/255 (48.63%), Query Frame = 3
Query:  948 HLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGW-RSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYL---IKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNIT 1700
            +L+++   YLN    R    YSL VV   +V PEHYIFS FGI+H  P      M+L  W+   +L+  L+ +PF K  L+RK F  W +++ +   H  + K+L  +L+     +G  +L I+RLL E+  + +LP EL            ++     A   L   +     +  +V+E    + + LQ  +VQ+       + SIY+++++    +Q L        +LG F +LV++M+   ++ +    IT
Sbjct:  289 YLKKIHFLYLNVAPSRYFRPYSLMVVPPDKVNPEHYIFSPFGILHVHPVEGSETMTLGTWHHHCVLWQQLQFIPFFKYCLLRKSFTCWKKNVRLQGLH-RLQKFLENHLLLAVPHFGAGLLHISRLLQELHSVSWLPQELDRCYELLDLQTALAEEKHKALRLLHRCLNLCTSILRLVHEDTYHMQQCLQ-ERVQNCDRIRTGQGSIYLQRVQHKQLEQKLKQAEAWWLQLGKFARLVDYMICQSLISVLEEQIT 541          

HSP 2 Score: 88.5817 bits (218), Expect = 1.614e-15
Identity = 149/803 (18.56%), Postives = 298/803 (37.11%), Query Frame = 3
Query: 3321 WKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRYKLL---VRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVF-------HYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLF-------------------DEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWL---MKYPLQVLLVADKIFFAKTLRKALTDPGH-EIASFKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSS-KSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVT------------IQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLL 5591
            WK   F+ F  + A E+   W TE A           +++     + EF S++P   +L S      + Q     +G   +   + LT+  L+   + E +  +  +  +   +  A +      RYW  ++               LH  +E       P   R++ ++ R    + ++              ++   F++ + + L++ I +S+  +       K  D  K+    V  +  L     +    Q+KW+FL ++  E      + +  + F  ++     L+      P+V          SP  +    Q+  +  +++         + GII ++E ++  V  HFPRLFFL D +L+ LL  +       +  ++   FP V  + F                        A++++   GE + L  P+       +WL   E   +  L   ++ C+  +      + +  K                         ++ + NK  ++       L  + W+     +P Q +LVA+++ +   + +AL + G   + S  +  +    N++         ++L  +R  S +  L+V+   H +I A+L+E    S    F +   +KY  G    +++  S +     +             I      FLY+YEY+   R     + + E+  + +LL L      T++G     K  I  S ++ LGR L  +     I ++    Y  GAL  G+ L +    ++  G +S + + L +L  L
Sbjct: 1035 WKCMAFAKFSPAMAQEKTEGWLTEAARMSTTLELHSPVLQHCMRILGEFRSYLPLLTKLGSLHPQSLNCQCLLRALGLGSLQTIELLTLGQLLTYPLLEFADRINQVWQNENERIHAQETIRRLQRYWEARQLRL--------LNFILHVPYEP------PASERSKRQVLRSPQWEVVD--------------KDSGTFILSDYSNLQDSIQESLQVLSKILAIEKSGDLNKIALEWVAIMHGLGALLEVWLTFQQKWIFLNKVLHEMKIQFPNADLNSRFKVMDDQYRTLMRISVADPMVLSLVVPSAERSPYFQGQQLQQLLQAGSVE---------LEGIIMSLESVLYGVCAHFPRLFFLSDSELVALLAARLESCEAQL--WVRRCFPHVHAVSFRSCPTGEKNTDDWESSPNTQTQVEALAVLGAGGEEVKLQGPLPLHPDLPKWLASLEKCLRLALVHMLQGCVAARLARGPSLGEALK-------------------------QLPKQNKLYLQ-------LYVQHWIDLVQAFPWQCVLVAEEVVWRAEMEEALLEWGTLAMVSMHMRKLEVLVNFMRAQRASQGGQSLPSVRQTSLLSALLVMAVTHRDI-AQLLEQHQVSDLTDFHWVRQLKYHLG--SPHIIPKSPLQSLKTIASSEPSLSPAACWIDVLGRSFLYNYEYLG-PRLGPLPSLLPERPALVLLLALEEVACGTVLGPNGVGKRAIVNSLAQALGRQLVMLPCSPQIEAQCLSNYLNGALQGGAWLLLEKVHQLPPGLLSALGQRLGELHHL 1762          

HSP 3 Score: 73.559 bits (179), Expect = 4.800e-11
Identity = 88/363 (24.24%), Postives = 166/363 (45.73%), Query Frame = 2
Query: 9500 YLDFSMAVFNHLFEVFRVKTESKIQRVESAMKSVKNAXXXXXXXXXXXXXXXXXXASLNVDISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKN--------MLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDD 10564
            +LDF +  F  L +   +K ++K QRV++A+++++    +    ++ +  L+++L      +S     ++Q K  Y   L +C  QE LI+ L    + L+ + ++ L ++S  +L  L  ++  D    EEI++Y  PPE V  + + +  L  ++  W   K+++   + Y+EL++F K+ I + +   L  +L    +   +L  VS+ AASL+ WL+A+L Y        P    L  V+  ++  Q+ LG  + +          +  EH   LAK    +    +   K  S           M + + T ++ WT Q  +       +    L    + +YL  FP   R E+LD+
Sbjct: 3115 FLDF-LDTFLMLQQQTILKIKNKAQRVQNALENLRMLIKEHGTHANLIFDLEQQLKDSGKSLSMFQQQLEQSKLLYKQQLEECRHQENLIENLARQRDALQAQREAFLEQMSKAFLEPLSQLQVAD---FEEIRSYRAPPESVVRVTDAMCDLFHHETGWASAKQLLCTEDFYQELVFFPKEKITDSELIKLHLILKAPGMDDAALRAVSRPAASLAAWLWAVLHYGLAHCRGLPTDLLLQQVEATLTREQARLGYYQFQAQ--------ETLEHNLALAKMVEDAQASHNCVAKTLSQAQCGQYHKWPMKAALLTPMRAWTTQLQKLKGRCMTVFGDTLLCSAAIIYLGPFPPLRRQELLDE 3465          
BLAST of dynein heavy chain domain-containing protein 1-like vs. UniProt
Match: sp|Q9MBF8|DYH1B_CHLRE (Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.138e-14
Identity = 51/237 (21.52%), Postives = 118/237 (49.79%), Query Frame = 2
Query: 9848 AALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVL 10558
            AAL+ +   D   + E+K Y KPPE V   +  V  +L    +W+E K+ +   N  + L  FDKD +D+   K + K   N     E +  VS AA+ +  W++A+  Y  +++++ P+  +L + Q+ ++  Q+ L   + +  ++   ++    ++   +A+++++ +++ D + K++  + +++ +      W    ++++  +  LP  ++       Y   FP   R+E++
Sbjct: 3185 AALDVLTKKD---MSELKAYAKPPEKVEMTLNAVLTVLRRPPNWDEAKKRLSDANFMQSLKEFDKDKLDDSLLKKIGKFTANPDFTYEKINTVSAAASGMCKWVHAMETYGYVAKDVAPKRAKLKSAQDTLARKQAALALAQEQLAVVLAKVQALKDKYDTSIARKQALEEELADLEGKLERAEKLVTGLAGERVRWEASISEYNIALGCLPGDVVVAAAFMSYAGPFPSEYRDELV 3418          

HSP 2 Score: 63.5438 bits (153), Expect = 6.152e-8
Identity = 102/507 (20.12%), Postives = 202/507 (39.84%), Query Frame = 3
Query: 4062 ILGECQEKWLFLERIFEEESFVQAHLETAAN-FVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLN-CKFSQNIQSINRFMPSIFPAVKRLLFD------EATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLINKI-----SKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISV 5543
            I+ + Q  W++LE IF     ++  L   +  F  V+ + + L+ Q+  +           +L S +D  +       LE I++      +++  ++N R  FPR +FL    L+E+L   K   N+Q     +   F  +K+L         + T ++ + S  GE L    PV       +WL   E                               A+F+T  TK  +++ ++          ES  +K E+           W+ +   Q+++ A +I +     KAL D      S + NL L K  ++  +NK+     SK   +E+ ++++    L+ +     +++ KL +    S+  F + + +++   D E N           +  ++  +S F Y YEY   +   L +T +T++  + +   +++      +G   + K E  K F + L R +   +    +  +   K F G   +G+   ++ F+ I V
Sbjct: 1487 IILQVQRNWMYLENIFIGSEDIRKQLPQESQMFDAVHNNFMRLMKQLYSTANCLKACTAQGLLESFQDMNNK------LERIQK------SLDNYLENKRQQFPRFYFLSSDDLLEILGQAKDPLNVQP---HLKKCFEGIKKLDMHLPGEDRKQTISVGITSPDGEYLPFANPVITEGRPEEWLNRVE------------------------------DAMFLT--TKKHLYKVLE----------ESKAQKKEK-----------WVKENQGQMIITAGQIVWTHECEKALADAD----SARKNLKLLKKKWISYLNKLTAVTRSKLNKIERNKVVA----LITIEVHARDVIEKLGKSNCSSTNDFEWVSQLRF-YWDREKN-----------DCIVKQVLSVFYYGYEYQG-NNGRLVITPLTDRCYMTLGAAMFTRRGGNPLGPAGTGKTETVKDFGKALARYVIVFNCSDGVDYKMTGKMFSGLAQTGAWACLDEFNRIEV 1904          
BLAST of dynein heavy chain domain-containing protein 1-like vs. UniProt
Match: sp|P0C6F1|DYH2_MOUSE (Dynein heavy chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 5.689e-14
Identity = 63/263 (23.95%), Postives = 126/263 (47.91%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS---RFPLAMRNEVLDDIQER 10576
            L + ++ +L E  P    A+  + +L+   I EIK+Y +PP  V  +++ V +L G + +W E K  + + N  + L+ FDKD+I +K  K +           + +  VS AA SL  W+ A+  Y  L R + P+   + A   ++   Q+ L + + +   + + LE+   ++ E LA+++ +  +  + + K++    ++S +      W +       L +DL   +   +I+  +LS    F    R+E+++ I  R
Sbjct: 3109 LADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEE---TVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIR 3368          

HSP 2 Score: 60.8474 bits (146), Expect = 3.479e-7
Identity = 49/203 (24.14%), Postives = 88/203 (43.35%), Query Frame = 3
Query: 4074 CQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEE----IMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATN------AISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLV 4652
             Q +W++LE IF  E   +     +A F  VN +   ++D++ +                  ++  S     LLE +  MN I+ +I++     ++  RH FPR +FL +  L+E+L    S+N +++   +   F  +K L   +         A+ + S  GE +D   PV        WL + E   + TL+  + +C V
Sbjct: 1481 VQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKD----------------NNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQ--SRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRV 1665          
BLAST of dynein heavy chain domain-containing protein 1-like vs. UniProt
Match: sp|Q9P225|DYH2_HUMAN (Dynein heavy chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 2.839e-13
Identity = 61/260 (23.46%), Postives = 125/260 (48.08%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLS---RFPLAMRNEVLDDI 10567
            L + ++ +L E  P    A+  + +L+   I EIK+Y +PP  V  +++ V +L G + +W E K  + + N  + L+ FDKD+I +K  K +           + +  VS AA SL  W+ A+  Y  L R + P+   + A   ++   Q+ L + + +   + + LE+   ++ E LA+++ +  +  + + K++    ++S +      W +       L +DL   +   +++  +LS    F    R+E+++ I
Sbjct: 3080 LADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEE---TVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQI 3336          
BLAST of dynein heavy chain domain-containing protein 1-like vs. UniProt
Match: sp|Q9SMH3|DYH1A_CHLRE (Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.709e-13
Identity = 73/272 (26.84%), Postives = 133/272 (48.90%), Query Frame = 2
Query: 9863 IRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGY-DNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNE--TLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKV-------RTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQD--LPRSILSFIISNMYLSRFPLAMRNEVL-DDIQERFAQAIKEVARLTVFEDGDLEN 10639
            +++L    I EI++Y KPPE V+ + E V +L    D SW   K +M   N    L+ FDKD + +K+ K + +   +    L  +SL  +S A A L  W+ A++ Y N++R + P+  ++   ++ + IAQ +L   K+       +   +R   E K  E ++L AK   M  ++     K+ +G  + S+ E + ++  D  ++  +L+ D  L  S LS+  +  + + +  AM  E+  DD++ R    + +  RL      D+E 
Sbjct: 3283 LQDLSKDHITEIRSYAKPPEQVQKVCECVVILRNIKDVSWLGAKSMMADGNFLRSLVEFDKDSLTDKQVKKVKEYFKDPKAPLTYDSLRAISTAGAGLLKWVLAMVNYNNVARTVEPKRKKVAESEKNLRIAQKDLASTKLELQSLNDQLGKLRTQFEEKTAEQQDLKAKADLMERRLIA-ASKLIAG--LGSERERWTRDIADLESRRDRLIGDCLLTSSFLSY--TGAFTATYRHAMVYEMWQDDVKAR-GVPVTQPFRLEALLTSDVET 3548          
BLAST of dynein heavy chain domain-containing protein 1-like vs. TrEMBL
Match: gnl|BL_ORD_ID|23854130 (tr|V4CEK6|V4CEK6_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_173233 PE=4 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 4.014e-117
Identity = 478/2142 (22.32%), Postives = 932/2142 (43.51%), Query Frame = 3
Query:  132 WACNDRKNMLERF-ENFGDIDIDELKSVQSQLLALTVEVNKRPKLSIWQELNEHLNHISALSDIILIDKKLESELNTVYKYLLANPEFSYLLPGMEMKLRQFLGIRNKTLSKQVDRNKEEEGEYYPLPIRKCNKMLSSKIMPENVVEWFVDREKG-----DLFNPATIDRNITVKPKK------------------------------IKMKDFLAAIGSVAKEIIFTQYAFEKPLENLIRAFDVDLSEFKSINTGEVDDRFSEIEECSLKIPESEDLSEDSKNVDLAKGFPKPKSGRDTIIYMIKCFHLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWRSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNI-TILGELLCAMEINIGNEGPADNKPNKIAIFRTKAVIVPTDEKLMLKAFPGVEDIEAMFTNIINSIPKLILKHCYPLDGLIRSD------------------------HLNRFKEIIV---GNLSEN--RTGHSTILTSKSEILTEIMSKSERRLDKITKPDLPYIKLPVKSEDNLRVATPPAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPIYCNLIDGFTELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYFYEQKLVKVKRYIHNLENTEKQVILSNRIFTVSXXXXXXXXXXXXXXXXXTISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIKTLIRV*PKGCTWNETLGNVIEAWKYSIVVHYELEDSARNIENV---ICGSRYSTVSDDVKE----VLMEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDL---DQIRSLVSLVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTD-LRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQ-LKKPQAKGD--DRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVN---KDIL-VLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFD--EATNA----------------ISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHE-IASFKLNLMLKKHNYVHLINKISKNENL---EQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSF--------------VYQAIVKYDTGDNEANLL----------IP---------SNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLLLQE-------------RSNLENKSG----MIRRLSL----------PSR-VGNERIVKDSFRDKDLHSLSERIIRSASQSGRCRTDY-YEMQTNKLNKGNNWP--FFTPEYEKSTEDDYD--TYVPNY----VTGMEIYDEIIDVRYGFGVCCGIMNDRFKLGS-IPMSLKSQMRIHCLIETD 6026
            WA   RK + +   E   ++D +++K ++++L+A+ +   ++   S W  L E L              +L      ++ Y L   EF++ L     ++     I  + L              + LPI  C     +K+ PE   E    R KG     +  NP  I +   V P+K                              + ++D   +IG+VA E+   +  ++  L     A + D+   +     ++  R S I+   +++   +  +  +K++  ++      +GR+ +IY  KC H+ ++   Y N    R    Y L    + + E EHY+F +FG++H +P+    +M+L +W +E++L+ A+  +PF K +LV K F+ WRS  +    L   + LS+ L+     +G ++LQ++RLL E+  + FLP EL +  +   +   +++ +  A++ L +F+K+ + +   TA E +K L++ + Q    +L++KDS++++++K+  R+  L +   +  +LGDFV+L++ M+   + +I  N++   +  +L   E N   +G           F+T  V    D    L   P  E  + + +  +  IP ++      +DG  + D                        H+   K  +    G++  +  RT  S   + K E    + +K+         PDLP    P K +D L VATP  V  +   +  L + G     ++ PI    + E L+L+  Y   I   T+L      E++   Q   W+ ++ +    W   ++  E+   + +  EQKL +++ +   + N +      N +F +   AI + LL  +    + +  FI    R +   F  ++  VL+ ++++   V  F          + N  ++Q+ V++IKSLF+V+R+S + +  +++  E+ V + WE+F+ Q+Q+A++FVN++         T + T +                             LED+ + +E     +C    + +  D  +    +LME+  + E    +  +L    K  ++I    C +  DL   +++ + + +    W  +  S + I+ WK++LF    I  A  +++EW    +  K + +   +++      + EF   +P   +LS+     +HW+  FL +   + DP   LTV DLI  ++ EH+ ++ +++  +  +Y    + N     W  K F+  +H  D L  + + ++R +S          + +S++E++   K+  +     S L   +  N ++++I E+ KL+  + D+ I+++ + +    GD  +  ++    L+ +   T +    Q+KW++L +IFE+        E A  F  V+   KD + V++   K   +V H        L Q D     L++  L +I     I+ + E I +  R  F RLFFL +  ++ELL    S+N Q++  F+   FP ++ L FD  + T+A                +SL    GE + L   +    SA++WLK  E + K+TL   +++C+  + +E +                     Q I  +++L    S+  K + E L   I  T+  WL+++P+Q ++ A+ I + K++ + L  P  E + S + N+  K   Y+ ++ + + N N+    + R+ + +  L+     + ++   L+E+   S+ SF              V +A      G     L+          IP         S+  +F    IQ   + FLYDYEY+  S C L LT +TE+  +++   L + +  T+IG   + K +  +  +++LGR LF ++   ++      ++  G + SG  +  ++ D+++ G +S  +++L  LR  L+              +++ + K G    +IRR SL          PS  +  +R V   F +K L +  E    +  +  R   +   E++ ++L + N  P  F+    ++ ++ DY   T  P+Y    +  +     +I     +G C   M  R    S IP + +  MR   L+  D
Sbjct:   36 WASEVRKRIEDNIKEGIENVDEEDVKKLKTELIAIFITALQQDSRSTWLYLQEIL--------------ELLEPYQNLFHYYLTKAEFNHYLE----RIHSHFEIHRERL--------------FDLPIVDC----LAKVFPE---EMQALRIKGPHPVKNYCNPPMI-KQTPVSPRKSQTPRNCLPDGTNPYSTHIASDEEMLSRQSLTIRDLGKSIGNVAFEMAARESIWKHSLGTTALALNTDIPIPEEPGDKKLSRRTSSIQ---VRLTPEKLKAVIAKSIKTSQEEIPVMTGREAVIYFAKCHHIGKIESIYFNLAPSRYYRPYELISCPQNKAESEHYVFCTFGVLHVYPNQDSESMTLGEWQKEAVLWTAVSTIPFFKNYLVLKSFKRWRSNKLFLNFLRKKEILSKCLLKAVPAFGAALLQVSRLLKELLLVNFLPFELDKTYSLGEYENAVNYKNIQADKILERFFKFCKTVAEFTAEESFKKLRYCEDQVQKKSLFTKDSMHLQRVKKELREDNLKNARRETGQLGDFVRLMDMMIIEHMFDITKNHVLKFVHHVLSLTESNSSRDG----------FFKTNLVFNKHD---CLTISPSKERFQRVLSRTLKGIPVVLCAKAQSMDGSGQQDQDVPDDGKSADISQSESKLLFSMLHIESKKTSVTSFGGSVKPDTSRTSTSEKASQKGETARPVSNKTS---SSYVGPDLPKQVTPNKLDDELGVATPDLVLKD--GEEILIVEGEGFMGQYEPIIRASLQEKLQLDGEYLEAIKVQTDLLKAAYDEIDHYCQSNEWLNEISHFCRKWNDKSVK-EFKGAAAFTIEQKLTELRMWSEKIRNFDVGFTTENGLFLIDCSAIHDGLLPRLNDIYQELITFIAEEARSMSKVFCEEMKIVLKNMKDKRPIVSAFAIFAKNYSQYKKNTPQYQQRVEYIKSLFEVIRMSYRQLTPEEEKYEENVWASWEAFLMQMQDASEFVNTQ---------TPLMTQL-----------------------------LEDNYQRLEKEAYELCEKATTGIFLDPHQNPCFILMEMKAIREKFFSVQIQLQDASKWREAI----CGEPYDLKFLNEMTAKMDIRGELWKYVEVSTNSIKDWKQTLFKKINIKKALAKVTEWIGAASQLKDHLDDGDLVLTHWYKTLTEFKKSLPLLYKLSNVALKERHWKVIFLGMNEPY-DPSHSLTVDDLIVCNLTEHAELINSVYLSSLAEYDLELKLNKITANWEEKAFKLAKHIPDSLYAKDASNKRVQS--------STKRQSKIEKFRQEKANASS----SSLISLDVANDDLYIIIEVEKLKYQLEDTRITVESMAQSSYLGDVKNTVEIWQDNLQQIEEITDLWYTAQKKWMYLLKIFEKPHLYMKWPEQAEKFEKVHNKLKDWMRVVVQDNKVMSVVNHKRGSKGYRLLQGDY----LRTLFLNIIAEEEDILKDFEMIFEETRQQFTRLFFLSNQDMVELLG--ISRNPQNLLPFVRKCFPGIQELKFDLPQGTSAMNTVLDFALNTEKLCVVSLCGMLGEEVPLLARLEANPSATKWLKTLESIMKNTLTVMMQACVQARMDEGSR--------------------QPIHILEEL----SQYKKPEAEALKIGIKQTYRHWLLQFPVQCVITAEAIMWNKSMSRILESPETEDLKSLRSNMESKLEQYIDILKEATTNGNIVADMRERLQALLYCLINQTISYRDVTNNLIENSSVSTSSFDWIKLMHHKMDIRNVLRAKTTEADGSQSQRLVHKASLRSVEEIPKLARARTTVSSDFQFSPCYIQNLGNVFLYDYEYLGPSNC-LTLTPLTERAFLSLCQSLKNFQCGTLIGPAGTGKSQTIQELAKMLGRCLFTVTCNENLTLPMMIQFLSGLVQSGCWVLFDDTDKLTSGLMSVTAQHLDYLRTALKTLDMSNNNQYKIRGQAHFDKKVGSEEQVIRRNSLTTLHPLPHTTPSPGLDRQRTVPHGFNEKGLMTYFEDTWIAEREQRRHSIEREIEIKESELYRANRPPPLFYEHVKKRKSQVDYSKLTQEPSYFHPKLGNIMFNGRLIPASSNYG-CFMTMTTRNNTASHIPENFRLLMRPCALVVPD 2028          

HSP 2 Score: 150.599 bits (379), Expect = 9.483e-32
Identity = 96/368 (26.09%), Postives = 188/368 (51.09%), Query Frame = 2
Query: 9500 YLDFSMAVFNHLFEV---FRVKTES-KIQRVESAMKSVKNAXXXXXXXXXXXXXXXXXXASLNVDISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQAI 10591
            Y   +   F H+F+V   F V+ E  K ++ E+A+  +  A   I     ++  L  +  S    I +    ++  K+ Y  AL +C +QE  I E+  PL +L+  ++   ++V+P+Y AA E +++++   I+E+KT+  PPE V+ +++ + LL      W E K +++K N  +E+++++KD+I    YK L K + +   + + L   S A ASL  W++AI +Y  + R++ P L  L   Q + + AQ +LG++++  + ++  LE ++  HKE + + K++  +I+  + KI    N++ ++      W  +  +  + ++  P   L       Y        R+E+L D  +R  Q +
Sbjct: 3584 YTPLTFMEFVHIFKVVAAFTVRVEKIKAKKYEAALCKIDEAFGSIATYKKEVSCLAPKHKSSMDTIQDLVEKVESQKQQYIQALEKCKTQEDKIAEIQSPLEQLRRTTQLEFDKVNPSYEAAQEVLKSINKADIDEVKTFNDPPEGVKFVIKAICLLFNRPEEWSEGKLLLLKENFIQEMIFYNKDNIPPHIYKALQKYIFDPIFNPDILKKHSSAIASLCLWVHAIYKYIEIHRQMRPHLKNLSLAQTEFNKAQGKLGQLRITANKLKSSLEREITAHKEAMKEAKAIEKKIQGVERKIARASNLMGNMSMQHFLWRSELKKARRHIRAAPGDALITAACVCYHGPLEDKFRSELLADWLDRCRQGL 3951          
BLAST of dynein heavy chain domain-containing protein 1-like vs. TrEMBL
Match: gnl|BL_ORD_ID|23914591 (tr|K1QK39|K1QK39_CRAGI Dynein heavy chain 2, axonemal OS=Crassostrea gigas OX=29159 GN=CGI_10002806 PE=4 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 1.722e-108
Identity = 388/1656 (23.43%), Postives = 703/1656 (42.45%), Query Frame = 3
Query:  909 SGRDTIIYMIKCFHLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWR----SLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNITILGELLCAMEINIGNEGPADNKPNKIAIFRTKAVIVPTDEKLMLKAFPGVEDIEAMFTNIINSIPKLILKHCYPLDGLIRSDHLNRFKEII---------VGNLSENRTGH--STILT----SKSEILTEI--------------------------MSKSERRLDKITKPDLPYIKLPVKSEDNLRVATPPAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPIYCNLIDGFTELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYFY--------EQKLVKVKRYIHNLENTEKQVILSNRIFTVSXXXXXXXXXXXXXXXXXTISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIKTLIRV*PKGCTWNETLGNVIEAWKYSIVVHYELEDSARNIENVICGSRYSTVSDDVKEVLMEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLD---QIRSLVSLVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISK----TPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQ--LKKPQAKGDDRYKL--LVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLF-------------DEATNA-----ISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPG----------HEIASFKLNLMLKKHNYVH--LINKISKNENLEQLRMLS---AIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVT------IQCCMSQ----FLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDIS 5555
            +GR+ + Y  KC H+ +++  Y N  + R    Y L  V K +  PEHY+FS+FG++H FPD    + SL++W RE++L+ A+  +PF K FLVRK F  WR     L  S RH  +G     NL+     +G ++LQ++RLL E+  +KFLP E                             ++ +M+V  TA E +K L+  + Q     ++SKDS++++K+K+  R+  L     +  +LG+FVKLV+ ++   +  ++   +    E + +           + K ++  +FR   V    +   +L  FP  E    +  + +  IP ++     P+DG   SDH +   E              LS N TG   ST  T    SK + LT +                          +S+S    + I  PD+       K ED L +ATP  V   I     L ++G     +++P++  ++ E L+++ +Y N ++   ++ +    E++      NW+VD+              +W + SP  Y        EQ+L++V+++   + N +K  I  N IF V    I + L+  +   +  +  F+ +  RKL  EF  ++ +VL+ LR++   +  F          + N  ++Q+ V +IKSL++           +++  +++V + WE+++ QLQ+A++FVN+  +  L T K   K                             + +LE  A  +  +    ++   + +  ++L+E+ ++ +   ++   L    K   +I    C +  DL+   +I + + +    W  +  S   I+  K  LF    I    E++ EW+      K        ++      + EF   +P   +L++     +HW+  F+ +   F DP  + TV DL+  D+ +HS ++  ++  A  +Y      N   ++W  +EF+  +H  D            S+  SK     P   R R++LE+Y   ++   +   L  L +T +   + F++ E+++L+  + D+ I I+  L+ P   GD R ++     AL+ +   T +  +CQ+KWL+L +IFE     +     A  F NV+                                  +  K  +L+ +  +          ++N R  FPRL+FL D  L+ELL    S+N +++  F    FP ++ L F             D A NA      +L    GE +DL   V     AS+WL+  E V K+TL   +++C+  + EE +              R    + +E+  +DQ        ++    EL   I  +F  WL+++P+Q  L +    +   LRK+ +  G          H +    +N    + + +   L N    +   E LR+L     IQN++      +E+  +        S++   +  +  +    E  +  P  + R             C ++Q    F YDYEY   S C L LT +TE+  +++   + +    T++G     K E  K  +++ GRNLF ++    +      +Y +G + SGS    +N D ++ G +S
Sbjct:  340 TGREAVEYFAKCHHIGKIQSIYFNIAETRHFRPYDLISVHKNKANPEHYVFSTFGVLHVFPDRPAESQSLSEWQREAVLWKAVSSIPFFKNFLVRKLFYRWRYNKLHLDFSRRHEELGC----NLLQAVPIFGAALLQVSRLLKELITVKFLPFET----------------------------EFCKMVVEVTAEESFKKLRHCEEQVKKKTVFSKDSLHLQKLKKETREYNLRKAKSETGRLGNFVKLVDQLIVEHMFHVSKTQVITFVESVLS-----------NQKDSREGLFRANLVFTKQE---VLGIFPSKERFTNVLMSTLKGIPTVLCSKAIPMDG-SGSDHDSEDTETSPPKSEAAKSTAELSSNLTGRRKSTAATNPSSSKQDQLTPLGEVDKPFSSVEVTETEQGEEESQAGGVSRSLAGEEMIPVPDIFRQATATKDEDELGIATPDLV---IQGDDPLVVYGEGFMGQYSPLSRANLEEKLKMDSVYKNALNEVEKILNTALDEIDTYCDMNNWLVDI---------FKFCLKWTSDSPKEYRGAPAFTIEQRLIEVRQWQEKVRNFDKNFITDNGIFFVDCSNIHDYLIPRLSQVIHEVLKFVSDEARKLATEFCDEMKEVLENLRKKDSSMAGFAIFAKNYTTYKKNGPQYQQRVSYIKSLYET---------SEEEKFDEDVQAAWEAYLLQLQDASEFVNT--QTPLMTQKLEDK-----------------------------YQKLEKEALELAEMATTKQFLDPTQNPTKILIEMRRIRDRFYEVEHGLQDASKWRDAI----CGEPYDLEFLSEISTKMDVRQELWKYVEVSMHAIKDCKGMLFKKMNIRKVLEKVIEWQAAAGQLKPYLPPGDQVLSYWFTCLGEFKKDLPILHKLANDALKERHWKAIFVGMNEPF-DPNREFTVSDLLAYDLEQHSELIHQVYLGAIAEYDLELRINQISKFWEEQEFKLAKHIPD------------SVITSKDPPRKPTSPRRRTKLEKYRQERAAA-QTGSLQGLDVTQD---DFFILIEVDELKYQLEDARIGIRSMLQSPYL-GDMRQEVEFWDSALQQVEEITELWFQCQKKWLYLLKIFERPELYKRFNGPAFKFENVH----------------------------------TKFKEEILKYLRVL----------LENSRMEFPRLYFLSDEDLVELLG--ISRNPKALLPFAKMCFPGIETLNFALPDGISSMNTALDFALNADKLQVTALKGVLGEEIDLVVRVQAFPKASKWLRTLENVMKNTLAMILQACVQTRVEEGS--------------RQPIHILEELSKLDQ--------DQSSQPELTRKIQHSFRHWLLRFPVQCNLESRLGQYTDVLRKSYSFNGKVPPSTKKRLHTLLCGLINQCCHQRDVLGAMLENSAVSDGGFEWLRVLRYHMDIQNVLRAKTEAVEVKGQSQSVQSIRSRTQQKRLSLIGNKLRIEPTIEEPPKLTRTKTTVSTDYQFSACYLTQLGTSFSYDYEYNGPS-CRLVLTPLTERAFLSLTQAIKNFHCGTLVGPAGVGKSETIKELAKMFGRNLFTVNCNEDVTVGVMMQYMMGMVQSGSWTLFDNTDRLTKGLMS 1805          
BLAST of dynein heavy chain domain-containing protein 1-like vs. TrEMBL
Match: gnl|BL_ORD_ID|24977440 (tr|C3YSF5|C3YSF5_BRAFL Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_102423 PE=4 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 6.102e-103
Identity = 450/2103 (21.40%), Postives = 861/2103 (40.94%), Query Frame = 3
Query:   69 KLNNIKYGNLQSHSSDKDNY-------IWACNDRKNMLERFENFGDIDIDELKSVQS----QLLALTVEVNKRPKLSIWQELNEHLNHISALSDIILIDKKLESELNTVYKYLLANPEFSYLLPGMEMKLRQFLGIRNKTLSKQVDRNKEEEGE----YYPLPIRKCNKMLSSKIMPENVVEWFVDREKGDLFNPATIDR----NITVKPKKIKMKDFLAAIGSVAKEIIFTQYAFEKPLENLIRAFDVDL-SEFKSINTGEVDDRFSEIEECSLKIPESEDLSEDSKNVDLAKGFPKPKSGRDTIIYMIKCFHLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWRSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQ-SHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNITILGELLCAMEINIGNEGPADNKPNKIAIFRTKAVIVPTDEKLMLKAFPGVEDIEAMFTNIINSIPKLILKHCYPLD------GLIRSDHLNRFKEIIVG----NLSE------------NRTGHSTILTSKSEILTEIMSKSERRLDKITKPDLPYIKLPVKSEDNLRVATP----PAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPIYCNLIDGFTELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYFYEQKLVKVKRYIHNLENTEKQVILSNRIFTVSXXXXXXXXXXXXXXXXXTISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIKTLIRV*PKGCTWNETLGNVIEAWKYSIVVHYELEDSARNIENVICGSRYSTVSDDVKEVLMEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVS---LVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQ--LKKPQAKGDDR-----YKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRL------------------LFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKAL-TDPGHEIASFKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKY----------------------DTGDNEANL--LIPSNVHRFGNVTIQCCMSQFLYDYEYIA-ISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLLLQERSNLENKSGMIRRLSLPSRVGNERIVKD--SFRDKD-LHSLSERIIRSASQSGRCRTDYYEMQTNKLNKGNNWPFFTPEYEKSTEDDYDTYVPNYVTGMEIYDEIIDVRYGFGVCCGIMNDRFKLGSIPMSLKSQMRIHCLIETDKRFHIKSYIIMAG 6065
            KL  I  G L S S              WA   R+ + E+  N GD   +EL              T++ ++RP    W  L + L  +   ++++   +++   L  VY +L  + E  +     ++ + Q L   NK   K ++R +   G       P P R       +     N +   V  +  D +NP  ++R        +PK + M D  AAI +V  E    +  +   +     A  +DL  E K     ++ +  + I E   K+ E   +SE+++++  A     P +GR+     +K  HL  +   YLN T  R    Y L VV K ++  EHY+FS FG +H  PD     M++ DW +E++ + +L C+PF K FLVRK F  W+S         + + +  NL      +G ++L I+RLL E++ I  LP   +   T   F  +I      A + L KF+ Y Q +VN+  +E+++ LQ  + Q   +  +Y+K+S+Y+++ K+  R Q          +LG+FVKLV+ +L + +V +A  NI           +  G E   D      A+F+ K V    DE ++   +P  E  +    + +  IP +I +  +P +      G   +    R +  +      N+S+            ++   S++ TS+S  +T   S        +  P L    +  K ED L VATP     A  P       L + G+    +++P++   +   L  + +    +    ++ +    E+++   E  W+  +      W++  +   +  Q  +  E+KL ++K +I  +++ EK +  S+ +F V    + +EL+  +    + +   + +  + L   F+ +I  + + L+++   V+ F      +   R    + Q+ V +IKS+++V+R+S + +   ++ +E+ V + WESF+ QLQEA+DFV+++   +L  +    +T                               L + A  I       ++   S     +L ++  + E    I  +++ + K  + I         DL  +  +V    +    W  +  +   I+ WK  LF    +  A  ++++W+T       +      ++    + + +F   +P   +L S     +HW+Q ++ +G +  +    ++V DLID+D+ +HS+++  ++  A  ++   +      R W  KEF+  ++  +L  +R                  RT S + R    KS        SR  I   E     LIG  ++L   + D+ +++Q  L  P    D R     +++ ++ ++D+     +  ECQ KWLFL + F + + V    + AA F  V+K     +  + + P +       +     ++ +   L+  L   IE    II  ++  +   R+ FPRL FL + +++ELL+   S++ +++  F+   F  ++ L                  L  E   A ++  + GE +DL   V      +QWL+  E   ++T+   +++C+            EA+         K++M                                 ++W+  +P Q  ++A+ + +A+ + +AL T     +   K  +       +  + ++ + +++ +  +   + NLV       +I++ L+E    +   F +Q ++KY                      DTGD E     L       FG   +        YDYEY+  ++R  L LT +T++  +++   + S     ++G     K E     +  LGRN    +        +  ++ +G + SG+ + +++ + +  G +S +S +L  LR   +  +   N    IR  S P+     R V    SF  +D L ++     R  S  G   TD  E+ T       +   F      S+   Y+ +    VT       ++     F     +        +IP +L+S  R   LI  D++  ++S ++  G
Sbjct:   15 KLPAINTGRLVSGSGKGSTAHLESVTDTWAVQVRRQLQEQVNN-GDEPGEELVQQLVQQVVSAFISTLQNDRRPS---WLYLCDVLCLLEPHTELLQGRQQIAHYLERVYNHLQTHQERLF-----DINIVQAL---NKVFPKDMERIQHTGGNPRNYRTPTPPRL-LSTTPTTSTKRNSLSSSVGLQLPDGYNPYVLERPDDETRYFRPKPLSMGDIRAAIPAVVLEASSRESVWGTSMGITATAMSLDLHDELKPAPPEKMFESLTSIIES--KLDEDVSISEEAESMSEAP----PMTGREAAEMFVKGKHLGRVEFVYLNLTPNRHYRPYDLVVVPKQKINKEHYVFSRFGALHVRPDEPNDTMTIADWNQEAVRWSSLMCIPFFKHFLVRKAFLRWKSYKRYEDFCRIREDVEENLPLAVPRFGAALLHISRLLLELTAINILPASTNTCFTLPEFETIIKKKRKEAEKILAKFFGYSQAVVNQIVSEVFEHLQHCEQQVKQTKTVYTKESLYLQRQKKEQRIQNFKKAKAVASRLGNFVKLVDQILLAHMVSLARKNIGA----FVHTTMQAGEEAERD------ALFKAKLVFNRNDELIL---YPSKEKFQNATYSALLGIPAVIFRSAHPSEDGTSTQGSPGTGSRGRVESSLSSPVKLNVSQESARVQPQPSTGSKQDRSSMQTSRSGAVTGTTSNY-----TLGDPTLERPAMKTKDEDRLGVATPDLIVGAQTPR-----GLTVGGQGFMGQYSPLSKGSLETKLATDEVVSADVQLHEDMMNSAMGEIDSFCIEHVWIKPMHKYAREWSRTVLKA-FHGQEAFDIEEKLNEIKNWIERIKDVEKTLTTSDGLFEVDCSILQQELVPALSNIFKQLIQLVADDAKNLSTSFVEEIKKLSKTLKDQNTTVDQFAVFAGQVKEYRSRTQQLQEKVSYIKSMYEVIRMSYRSLNPDEEKLEERVRTTWESFLVQLQEAHDFVHTQTPVMLEELDMTYQT-------------------------------LHEEALTISRQATSGKFLDPSQHSPTILTDMRHLAEKFGAIQHKMEEISKWREMI----TGTGYDLSALGFMVGQMDMRRELWKYVEVATYHIKDWKVQLFRKMNVKKAMGKLTDWQTAAMMMAEDIPEGDKVLAHWVNIMQDFKQNLPLLAKLGSDALKHRHWKQLYVGMGKDPNEIGWSMSVGDLIDMDLPKHSQLINQIYTAATSEFSLEQSLGKLRRMWEEKEFKLAKYIRELPVRRE---------------KKRTGSPVARLQAAKS-------KSRTRIVTEET--YILIG-TDELRYQLEDTEVTLQAMLASPHI-ADLRSQAEVWRVTLQQVDDI---IHLWTECQTKWLFLSKSFADINLVLQLPDEAAMFSEVDKKYKGFMQDVVEDPKMLSVLSKRRGQKGWRELQGEALRQLLKWCIEEQEKIIKKLDSKLMATRNEFPRLHFLSNSEIVELLS--LSRDPRTMTSFVKKCFHGIRALNFALPADVNHTTTALDLDLHAEVLQATAIKGEAGEVVDLVCRVEANTQTTQWLQAVEQTMRNTVGTALQACM------------EARLG-------KNSM-------------------------------PIQTWVRLFPSQCAVLAEAVLWARDVGEALQTSDRQRLMDLKGKMSASLEERLGTLRELYREQSIRKTHI--TLSNLVNQAVHQRDIVSMLLEAKTLTDNCFDWQKVMKYSMDIKPVTKFNVAKLKESHKVEDTGDPETTCSSLDVEQGFEFGPCVVNQLNWSLPYDYEYLGPVNR--LILTPLTDRCLLSLSGSVQSFACGAVMGPEGVGKSETVAELARALGRNFITYNCTHMTGISALTQHLVGGIQSGAWVCLDDANHLPTGVMSVLSHHLGHLRNAYRILAASSNSQYTIR--SAPTIRRRRRTVASLASFPPEDGLQTVGTGQHRRHSIFG---TDQKELSTALSALSLDLQDFANSQHLSSTFSYEPWTLGLVT---FNGSLMQANTNFSPFLTLNTRDQSFQTIPETLRSAYRPVTLIVPDRKLLVQSILLCGG 1946          
BLAST of dynein heavy chain domain-containing protein 1-like vs. TrEMBL
Match: gnl|BL_ORD_ID|18207774 (tr|A0A267H0N4|A0A267H0N4_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022241g7 PE=4 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 6.274e-102
Identity = 384/1722 (22.30%), Postives = 755/1722 (43.84%), Query Frame = 3
Query:  606 PATIDRNITVKPKKIKMKDFLAAIGSVAKEIIFTQYAFEKPLENLIRAFDVDLSEFKSINTGEVDDRFSEIEECSLKIPESEDL-SEDSKNVDLAKGFP----------KPKSGRDTIIYMIKCFHLREMRVAYLNY---TKQRIRDLYSLTVVRKTQVEPE-HYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWRSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTE--LSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNITILGE---LLCAMEINIGNEGP--ADNKPNKIAIFRTKAVIVPTDEKLMLKAFPGVEDIEAMFTNIINSIPKLILKHCYPLDGLIRSDHLNRFKEIIVGNLSENRTGHSTILTSKSEILTEIMSKSERRLDKITKPDLPYIKLPVKSEDNLR---VATPPAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPI--YCNLIDGFTELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYFYEQKLVKVKRYIHNLENTEKQVILSNRIFTVSXXXXXXXXXXXXXXXXXTISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIKTLIRV*PKGCTWNETLGNVIEAWKYSIVVHYELEDSARNIENVICGSRYSTVSDDVKEVLMEI-SKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVS---LVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRYKLLVRALEDLRLSTTI---LGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRL-LFDEATNAIS-----------------LISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKAL--TDPGHEIASFKLNLMLKKHNYVHLINKISKN--ENLEQLRMLSAIQNLVVLNDRHIEILAKLME-DPDCSSKSFVYQAIVKYDT---------------GDNEANLLI---PSNVHR---FGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEI 5537
            P   D      P+ + ++   A+I  V  E    +    KP     RA   D + F+   TGE      +I+E   ++  +E+  + D+ + D +   P           P+  RD I + ++C+HL E  VAY N    T     D Y L +V K +     H++F  FG++   P     AMSL +W+RE++L+ A++ +PF + F   + F+ WR+ T+  R  S  + L+ NL++    YG+S+LQ+A LL +++++  LP    ++   T      L+      A+  L KFYK+++ ++ ET+A L+K ++F Q Q H   L SK+S+Y ++I+   + + L     Q+ +LG F++ ++  + S  + +A++N+    +   L+ A      +  P  A++  N  A F+   + V  D+   L + P +++        +   PKL+  H +P+DG I   HL+R   +     S      S  +T+  +            + K+  P      L  +  D      +  PP  NP       L + GR+I     PI    ++  L+L  I  Y + ++     F    +++N  F+E NW+V +      W + +   ++  Q  +  EQ LV+++++  ++   +   + SN +  ++ + +I+ L+  +E     + DF    + +L  EF+ ++ D+ + L  R +    F      +   +DN   +Q+  D+IKSLF+++R++ + +  +++ +E+E  S W   +  +Q+++DF N +           + T+IR           + +  EA          L   AR I   + G  Y  VS    +V+ EI  K    CD I   +  L +  Q+I  E  P    LD+++ LV+   +    W     + + I  WK+ LF  F    A ++I+EW+      +   N    ++ +    + +F   +P   +L S     +HW+  ++  G +F DP  +  + +L+  D+  H +++ ++   A  +Y+  K      + W+ KE +   H T+            + A    P   R  S+LE+   +K++ N+   ++   + +N +RE+F++ +  ++   + DS++++Q  +  AK  + Y  L++  E L  +      L + Q +W FLE+ F+  +           F  +N+  + L   +  +P V   +             D+  +++L +L  ++  +  ++  ++   R   PRL F  D +++ELL    S+   ++   +   FP V++L L   A  AI+                 L+ + GER+  + P+       +WL   E   K +               S  +    ++ + M E     + + ++ +  L    +ES+     E   SIL     WL+++P   +L AD+I F + +   L       ++   +  L  ++  Y  L+ +  K    N  + R+ + + +L++     + IL  L+   P C+ ++F +  + K++                G+   +L +    +++ +    G  T+     Q  YDYE++   R  L ++ VTE+   ++ L L + +I  + G+  + K E  +    +LGR   +++ G  +   S R++  GAL  G++L +     +
Sbjct:  157 PELSDSTYAPVPEPLTVRRLQASIADVIAETCLRESTLAKPSGATWRAAAADFTIFEP--TGE--KLLEKIQEVIDEVDAAEEADTSDAASTDSSVKTPVPAQPRPPHRPPRFARDAIGHFVRCYHLGEPVVAYYNPALPTSAPEPDAYHLELVPKRRANASLHFVFCPFGVLRVCPGDASEAMSLVEWHREAVLHSAMRQIPFCRLFRRMRVFRAWRAWTLRRRFESRRRTLADNLLAAVPAYGRSMLQVATLLQQVNELSVLPGRPSVASCLTLRQLQDLVDKRKLQADRILEKFYKFLKQIIVETSAVLFKRMEFYQKQVHQKQLLSKESLYNQRIRAEEQARDLATARRQLGQLGSFIRYLDLFVGSAFLRLAVDNVAKFVDEVLLVGATASKTKSVKPNDAEDPVNVTATFKAD-LSVNNDQ---LCSNPSLDEFCQFILATVADTPKLLQLHAFPMDGCITDAHLHRLPALGPATTS------SATVTAAGD------------MPKLQPPQRLNSGLSAEQRDQRSTEVIRQPPPQNPR-----DLTVEGRAIVGTDQPIEFGHIW--LQLGGIVRYQHYLNLCQNAFDSANEDVNRFFEESNWLVAIHTFCRDW-RSDSVQKYKDQPAFSIEQTLVQLRQWTESVRTFDSNFVSSNGVALINCQLLIDSLVPMLERAYAELGDFATVEMSRLANEFVAELVDLQRHLSNREVTSANFAVYSSKLQQVKDNTQRYQQRADYIKSLFEMVRMAYRPLTAEEEKLEEEAQSQWHYMLQLMQDSSDFQNKQ-----------LPTIIR----------KMNDEYEA----------LMAEARLIAKDL-GENYCQVSPTPDKVVKEIVQKRTRICD-IETLVKQLSETKQAIVGENYP----LDELKLLVASSDMRLELWKYFSVAVNFIADWKKQLFKKFDARQALDKITEWQNAAVHIRKFLNPDDPVLARLLQLLQDFKQSLPLLAKLQSPALKERHWRSLYVGFGSDF-DPNREPRLVELLAFDLPAHGKLINSVCAAALAEYQLEKTLARLNKLWLDKELKMVRHVTESVIADGERAELRNAAKRLQPAAARKTSQLEKMRSSKAVANE-SAVNGSTVVSNAHREVFVVADWQEILHLLQDSLLTLQSMRAPAKATEFYAELLQLDERLTAAEAAFEQLLKAQRRWQFLEKFFQRAAVASRLPRQTDAFRPLNERFVELTRLLASTPKVGQLA-------------DAARRAKLTDLALKLKKLAASLRPLVDQARRQLPRLNFFSDEEVMELL--ALSREPGAMLSHVRRAFPGVRQLQLALPAGGAITGTRLDYQLNADKLLLSGLVGECGERV-AFSPIAASPHPVRWLALAEARLKDS--------------NSRLLRDAVRTRLRMAEPDAPAVAEALEELTALEK--AESDVGDSSE-AGSIL---HHWLLRHPASCVLAADRILFTRLVAVILRAGRAAEDLPGRQRVLQRRQQRYCDLLRENFKRVFANDRRRRLHALLHSLILACQEQVNILQTLIACGPSCNDRNFDWVRLAKHEMPVEALPKLRRSEQPDGEQVDDLRLRRCRTSLQQELLLGRYTVSQLGHQLSYDYEFVPCHR-RLVISGVTERALCHLSLALANYQIGCLAGDATAGKSETVRELGCLLGRLSISLNCGADLCPSSIRRHLTGALACGAILVMEELGRL 1768          

HSP 2 Score: 152.525 bits (384), Expect = 2.320e-32
Identity = 81/261 (31.03%), Postives = 150/261 (57.47%), Query Frame = 2
Query: 9680 DISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSK-SNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDN-SWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQ 10456
            D+   A   +Q +E Y   L+ C  QE  +K+L  PL ++K++S+ S   ++ P Y AA+    +L P  +EE+++Y +PPEPV+ ++ ++ +L   +  SWE  KE+M+K +L E LLY+DK  + + K+K LT  L+   + + ++ + S+AAA +  WL A+ ++T +SR++NP +G L A +E+VS  Q+ LG+M+V      + L   +  H+E     + +  +I   + +++ G  ++  ++     W  QR +
Sbjct: 3391 DVEMQAQAFQQQREKYKAQLDACREQEAKVKQLLEPLEKMKKESQDSGQAKLDPVYEAAIRAAESLQPQHLEEVRSYREPPEPVKAVMSVICMLFDTETESWEAAKELMMKEDLQELLLYYDKASMPDSKFKRLTAALSRPEMSEMAVSSASKAAAKVRDWLEAVQQFTAVSRDLNPAIGALRAAEERVSREQTRLGRMRVEAQKQLESLNAAIGLHREASLAARQLRQRIARMQAEVERGAQLMQRLDRRWHQWRQQRER 3651          
BLAST of dynein heavy chain domain-containing protein 1-like vs. TrEMBL
Match: gnl|BL_ORD_ID|18295409 (tr|A0A267E1K7|A0A267E1K7_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022241g4 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 1.596e-101
Identity = 382/1742 (21.93%), Postives = 761/1742 (43.69%), Query Frame = 3
Query:  606 PATIDRNITVKPKKIKMKDFLAAIGSVAKEIIFTQYAFEKPLENLIRAFDVDLSEFKSINTGEVDDRFSEIEECSLKIPESEDL-SEDSKNVDLAKGFP----------KPKSGRDTIIYMIKCFHLREMRVAYLNYT---KQRIRDLYSLTVVRKTQVEPE-HYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWRSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTE--LSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNITILGE---LLCAMEINIGNEGP--ADNKPNKIAIFRTKAVIVPTDEKLMLKAFPGVEDIEAMFTNIINSIPKLILKHCYPLDGLIRSDHLNRFKEIIVGNLSENRTGHSTILTSKSEILTEIMSKSERRLDKITKPDLPYIKLPVKSEDNLR---VATPPAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPI--YCNLIDGFTELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYFYEQKLVKVKRYIHNLENTEKQVILSNRIFTVSXXXXXXXXXXXXXXXXXTISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIKTLIRV*PKGCTWNETLGNVIEAWKYSIVVHYELEDSARNIENVICGSRYSTVSDDVKEVLMEI-SKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVS---LVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRYKLLVRALEDLRLSTTI---LGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRL-LFDEATNAIS-----------------LISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKAL--TDPGHEIASFKLNLMLKKHNYVHLINKISKN--ENLEQLRMLSAIQNLVVLNDRHIEILAKLME-DPDCSSKSFVYQAIVKYDT---------------GDNEANLLI---PSNVHR---FGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLLLQ 5597
            P   D      P+ + ++   A+I  V  E    +    KP     RA   D + F+   TGE      +I+E   ++  +E+  + D+ + D +   P           P+  RD I + ++C+HL E  VAY N          D Y L +V K +     H++F  FG++   P     AMSL +W+RE++L+ A++ +PF + F   + F+ WR+ T+  R  S  + L+ NL++    YG+S+LQ+A LL +++++  LP    ++   T      L+      A+    KFYK+++ ++ ET+A L+K ++F Q Q+H   L SK+S+Y ++I+   + + L     Q+ +LG F++ ++  + S  + + ++N+    +   L+ A      +  P  A++  N  A F+   + V  D+   L + P +++        +   PKL+  H +P+DG I   HL+R   +     S      S  +T+  +            + K+  P      L  +  D      +  PP  NP       L + GR+I     PI    ++  L+L  I  Y + ++     F    +++N  F+E NW+V +      W + +   ++  Q  +  EQ LV+++++  ++   +   + SN +  +  + +I+ L+  +E     + DF    + +L  EF+ ++ D+ + L  R +    F      +   +DN   +Q+  D+IKSLF+++R++ + +  +++ +E+E  S W   +  +Q+++DF N +           + T+IR           + +  EA          L   AR I   + G  Y  VS    +V+ EI  K    CD I   +  L +  ++I  E       LD+++ LV+   +    W     + + I  WK+ LF  F    A ++I+EW+      +   N    ++ +    + +F   +P   +L S     +HW+  ++  G +F DP  +  +++L+  D+  H +++ ++   A  +Y+  K      + W+ KE +   H T+            + A    P   R  S+LE+   +K++ N+   ++   + +N +RE+F++ +  ++   + DS++++Q  +  AK  + Y  L++  E L  +      L + Q +W FLE+ F+  +           F  +N+  + L   +  +P V   +   +             +++L +L  ++  +  ++  ++   R   PRL F  D +++ELL    S+   ++   +   FP V++L L   A  AI+                 L+ + GER+  + P+       +WL   E   K +               S  +    ++ + M E     + + ++ +  L    +ES+     E   SIL     WL+++P   +L AD+I F + +   L       ++   +  L  ++  Y  L+ +  K    N  + R+ + + +L++     + IL  L+   P C+ +SF +  + K++                G+   +L +    +++ +    G  T+     Q  YDYE++   R  L ++ VTE+   ++ L L + +I  + G+  + K E  +    +LGR   +++ G  +   S R++  GAL  G++L +     +    ++  ++   ++R LL+
Sbjct:  157 PELSDSTYAPVPEPLTVRRLQASIADVIAETCLRESTLAKPSGATWRAAAADFTIFEP--TGE--KLLEKIQEVIDEVDAAEEADTSDAASTDSSVKSPVPAQPRPPHRPPRFARDAIGHFVRCYHLGEPVVAYYNPALPASAPEPDAYHLELVPKRRANASLHFVFCPFGVLRVCPGDASEAMSLVEWHREAVLHLAMRQIPFCRLFRRMRVFRAWRAWTLRRRFESRRRTLADNLLAAVPAYGRSMLQVATLLQQVNELSVLPGRPSVASCLTLRQLQDLVDKRKLQADRISEKFYKFIKQIIVETSAVLFKRMEFYQKQAHQKQLLSKESLYNQRIRAEEQARDLATAHRQLGQLGSFIRYLDLFVGSAFLRLTVDNVAKFVDEVLLVGATASKTKSVKPNDAEDPVNVTATFKAD-LSVDNDQ---LCSNPSLDEFCQFILATVADTPKLLQLHAFPMDGCITDAHLHRLPALGPATTS------SATVTAAGD------------MPKLQPPQRLNSGLSAEQRDQRSTEVIRQPPPQNPR-----DLTVEGRAIVGTDQPIEFGHIW--LQLGGIVRYQHYLNLCQNAFDSANEDVNRFFEESNWLVAIHTFCRDW-RSDSVQKYKDQPAFSIEQTLVQLRQWTESVRTFDSNFVSSNGVALIDCQLLIDSLVPRLERAYAELGDFATVEMSRLANEFVAELVDLQRHLSNREVTSANFAVYSSKLQQVKDNTQRYQQRADYIKSLFEMVRMAYRPLTAEEEKLEEEAQSQWHYMLQLMQDSSDFQNKQ-----------LPTIIR----------KMNDEYEA----------LMAEARLIAKDL-GENYCQVSPTPDKVVKEIVQKRTRICD-IETLVKQLSETKKAIVGE----NYALDELKLLVASSDMRLELWKYFSVAVNFIADWKKQLFKKFDARQALDKITEWQNAAVHIRKFLNPDDPVLARLLQLLQDFKQSLPLLAKLQSPALKERHWRSLYVGFGSDF-DPNREPRLEELLAFDLPAHGKLINSVCAAALAEYQLEKTLARLNKLWLDKELKMVRHVTESVIADGERAELRNAAKRLQPAAARKTSQLEKMRSSKAVANE-SAVNGSTVVSNAHREVFVVADWQEILHLLQDSLLTLQSMRAPAKATEFYAELLQLDERLTAAEAAFEQLLKAQRRWQFLEKFFQRVAVASRLPRQTDAFRPLNERFVELTRLLASTPKVGQLAGAAR-------------QAKLTDLALKLKELAASLRPLVDQARRQLPRLNFFSDEEVMELL--ALSREPGAMLSHVRRAFPGVRQLQLALPAGGAITGTRLDYQLNADKLLLSGLVGECGERV-AFSPIAASPHPVRWLALAEARLKDS--------------NSRLLRDAVRTRLRMAEPDVPAVAEALEELTALEK--AESDVGDSSE-AGSIL---HHWLLRHPASCVLAADRILFTRLVAVILRAGRAAEDLPGRQRVLQRRQQRYCDLLRENFKRVFANDRRRRLHALLHSLILACQEQVNILQTLIAGGPSCNDRSFDWVRLAKHEMPVEALPKLRRSEQPDGEQVDDLRLRRCRTSLQQELLLGRYTVSQLGHQLSYDYEFVPCHR-RLVISGVTERALCHLSLALANYQIGCLAGDATAGKSETVRELGCLLGRLSISLNCGADLCPSSIRRHLTGALACGAILVMEELGRLPAPLVAAFAQDAAQIRRLLK 1788          

HSP 2 Score: 153.68 bits (387), Expect = 9.671e-33
Identity = 81/261 (31.03%), Postives = 151/261 (57.85%), Query Frame = 2
Query: 9680 DISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSK-SNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDN-SWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQ 10456
            D+   A  ++Q +E Y   L+ C  QE  +K+L  PL ++K++S+ S   ++ P Y AA+    +L P  +EE+++Y +PPEPV+ ++ ++ +L   +  SWE  KE+M+K +L E LLY+DK  + + K+K LT  L+   + + ++ + S+AAA +  WL A+ ++T +SR++NP +G L A +E+VS  Q+ LG+M+V      + L   +  H+E     + +  +I   + +++ G  ++  ++     W  QR +
Sbjct: 3390 DVEMQAQAIQQQREKYKAQLDACREQEAKVKQLLEPLEKMKKESQDSGQAKLDPVYEAAIRAAESLQPQHLEEVRSYREPPEPVKAVMSVICMLFDTETESWEAAKELMMKEDLQELLLYYDKASMPDSKFKRLTAALSRPEMSEMAVSSASKAAAKVRDWLEAVQQFTAVSRDLNPAIGALRAAEERVSREQTRLGRMRVEAQKQLESLNAAIGLHREASLAARQLRQRIARMQAEVERGAQLMQRLDRRWHQWRQQRER 3650          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 88.1965 bits (217), Expect = 2.538e-16
Identity = 57/259 (22.01%), Postives = 130/259 (50.19%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQE 10573
            + E ++ +L+E  P    A++ + +L+   + EIK+Y +PP  V  +++ V +L G + +W E K  + + N  ++L++FDKD+I ++  K + +  T      E +  VS AA SL  W+ A+  Y  + R + P+   L     +++  Q+ L + + +   + + L+    ++ E L +++ +  +  D + K+D    ++S +         +R ++ Q ++ L +  + +++ +  L+   L+     L + +E
Sbjct: 3058 MAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGL-------AGERVRWEQTVESLEKD-MGYLVGDCLLAAAFLSYMGPFLSNYRE 3308          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.344e-11
Identity = 55/266 (20.68%), Postives = 117/266 (43.98%), Query Frame = 2
Query: 9818 NLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG------YDNSWEEIKEIMVKINLY-EELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQAIK 10594
            +L +  P  +AA E +  L+   + E+K++  P   V ++   V +L+        D SW+  K +M K++ + + L+ F+K++I E   K +   L +     E +   S AAA L  W+  I+++  +  E+ P+   L     +++ AQ +L  +K + + + ++L     + ++  A +     +       I     ++  + +    W +    F Q  + L   +L       YL  F    R+E++D+  + +   +K
Sbjct: 2988 DLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMAPGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLK 3253          

HSP 2 Score: 54.6842 bits (130), Expect = 3.164e-6
Identity = 51/242 (21.07%), Postives = 103/242 (42.56%), Query Frame = 3
Query: 4833 ESWLMKYPLQVLLVADKIFFAKTLRKALT--DPGHEIAS---FKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISV 5543
            E WL  YP QV L   +I++   +  A +  + G+E A    +K  +         LI ++S  +          +  +  ++    +++AK++     +S++FV+ + +++   + E         H F N+    C +QFLY YEY+  +   L +T +T++  + +   L+        G   + K E  K     LG  ++  +    +  +S    + G   +G+    + F+ ISV
Sbjct: 1547 EQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDR-------QKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREK--------HCFANI----CDAQFLYSYEYLG-NTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISV 1768          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Cavefish
Match: ENSAMXT00000016401.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1184712:1219988:1 gene:ENSAMXG00000015872.2 transcript:ENSAMXT00000016401.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 1.832e-9
Identity = 62/291 (21.31%), Postives = 126/291 (43.30%), Query Frame = 2
Query: 9866 RNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLL--------------GYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQAIKEVARLTVFEDGDLENMIEWHQWDSLIRLHLDNAS 10696
            + + P  I  ++   KPP  +  +++ V LL                   SW E  ++M        LL F+KD I+E+  ++L   L+ E  + E+   +    A L  W  A+  +  +++E+ P    L   + ++++AQ EL K + + D  +++L+     +   +++++S+ +     + K+ +   ++  +      WT+  T+F + ++ LP  +L       Y   F    RN +L        Q  KE++           N I + Q  +LI + +DNA+
Sbjct: 1310 QTIKPADIATVRKLGKPPHLIMRIMDAVLLLFQRRVDSVTMDPERPCLRPSWAEALKLMNNSGFLSMLLNFNKDTINEEMVELLLPYLSMEDYNLEAAKRICGNVAGLCSWTEAMADFFGINKEVLPLKANLKLQEARLAVAQDELAKAQEQLDAKQKELDEAQELYDGAVSEKQSLLEDAEACRRKMSNAMALIDGLGGEKIRWTESSTEFQRQIKHLPGDVLLATGFLSYAGPFNQEYRNLLLQ-------QWKKEMS----------GNHIPYSQSFNLITMLVDNAT 1583          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Cavefish
Match: DYNC2H1 (dynein cytoplasmic 2 heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2962])

HSP 1 Score: 64.6994 bits (156), Expect = 3.131e-9
Identity = 60/256 (23.44%), Postives = 121/256 (47.27%), Query Frame = 2
Query: 9788 LNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG-YDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVL--TNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKS----MSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFP 10534
            + E KEK +  L EV P    A + + N+   ++ EI++   PP+ +RD++E V  L+G +D SW  +K  + K  + E++  FD  +I  +  + + ++L     +   ++    S AAA L+ W+ A ++Y+++  +I P   E   + E +   +S   K++ + + + +    KV E KE    R +    +   +   +  I + + ++  ++     WT Q  +  + +  LP+ +        YLS  P
Sbjct: 2907 IEERKEKIEDELKEVQPLVDEAKQAVGNIKSESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNITHEIRQSVEELLHRNKASFDPKNAKRASAAAAPLAAWVKANVQYSHVLEKIQPLESEQAGLMENLRKTESRKNKLEGQLNSVGE----KVLELKEKFQCRTTEAAKLEADVSRAQETISAAEKLIHQLDGEHTRWTTQVDEISEELATLPKRVQLAAAFITYLSAAP 3158          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Cavefish
Match: DYNC1H1 (dynein cytoplasmic 1 heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2961])

HSP 1 Score: 64.6994 bits (156), Expect = 3.155e-9
Identity = 86/430 (20.00%), Postives = 186/430 (43.26%), Query Frame = 2
Query: 9341 VQSYKDSLDNMVPILSTSHSTELQMLAEAHIYLNKYLYRILQRFGVAFDCNGK-YLDFSMAVFNHLFEVFRVKTESKIQRVESAMKSVKNAXXXXXXXXXXXXXXXXXXASLNVDISNSASH---MKQMKESYGLALNQCISQEKLIKELTGPLNE-LKEKS---KSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNS-WEEIKEIMVKINLYEELLYFDKDHI-DEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKE----LLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQA 10588
            V  Y  ++ + +P + T     +      H  L++   R+ +R G       + YLDF +  + +LF   R + E +   +   ++ +K    ++E+L   L        S  +++ N+A++    K +K+       + +SQE  I+E      E +K+K    K +L++V P  + A   ++++    + E+++   PP  V+  +E + LLLG   + W++I+ I+++ N    ++ F  + I D  + K+    ++N + + E +   S A   +  W  A L Y ++ + + P   EL  +++     +++  ++    + M +DLE  +  +KE    L+++ +++   +   + K++    +L  +    + W      F   M  +    L       Y   F   MR  +         QA
Sbjct: 2225 VPDYMPTVYDKLPQIPTHREAIVNGCVFVHQTLHQANNRLAKRGGRTMAITPRHYLDF-INHYANLFNEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIK-----SQELEVKNAAANDKLKKMVKDQQEAEKKKVMSQE--IQEAVYKQQEVIKDKQLRVKQDLDQVEPAVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKMKKNYMSNPSYNYEQVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDAKDNKTKAEEV----EQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRSTALLKSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHLQQA 2642          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005139.1 (pep scaffold:Pmarinus_7.0:GL476545:294684:336608:-1 gene:ENSPMAG00000004656.1 transcript:ENSPMAT00000005139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 9.291e-17
Identity = 56/217 (25.81%), Postives = 106/217 (48.85%), Query Frame = 3
Query:  915 RDTIIYMIKCFHLREMRVAYLNYTKQRIRDLYSL------TVVRKTQVEP--------EHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGW-RSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQ 1520
            R T ++     H+  + +  L Y    ++   SL      T +R  +++P        EH++ S  G +H   DG   +  L +W   + L  A++ +P+ + FL+RK F  W R++     H    ++L   L+     +  ++LQI+RLL+E+ Q+ FLP +L    T   F Q ++ + + A E +I+F+   +++     AE Y+ L+  +V+
Sbjct:   80 RATTVFTPDDVHVSYLAINGLAYEHHFLKQSLSLCCAVSVTTLRPYELQPMHAGQSHQEHWVLSPLGALHVQADGIAESQPLAEWCEHADLCRAVQSIPYFRHFLLRKAFHRWYRNVRWVQFHRR-KEHLECTLLHGVGHFSTALLQISRLLEELDQVPFLPWDLHRSYTLTQFQQTLADTMAEARERVIQFFHCREVIFRMVHAETYRQLEVCEVR 295          

HSP 2 Score: 86.2705 bits (212), Expect = 1.728e-16
Identity = 77/291 (26.46%), Postives = 140/291 (48.11%), Query Frame = 2
Query: 9686 SNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVL 10558
            S S    ++++E    AL +C   E+ I  L   L  L++K ++ LN+VSP Y AAL  +R L P  +EE+++Y  PP PV  + + V LL G    WE+ + +M++ N  ++L + DKD I ++ ++ L   + +  L    +   S+AA SL  WL A+  Y    R + P   E  A++  ++ A+  LG+ ++  + +  + +  V E +     R  +  +I D + ++  G ++ + +      W     +   L+       L    S +Y + F  A R  +L
Sbjct: 2986 STSDCKHRELEE----ALERCRQTEEHISALLEQLEALRKKMRAQLNQVSPVYEAALRALRALRPRDVEELRSYRAPPPPVVAVADAVGLLFGCHAGWEDARILMLRPNFPKDLEFLDKDGITDETFERLEAAVLDPGLSPALVRESSRAADSLCSWLRAVYAYGRTRRLLRPAELEAAALEAALATARRSLGRRRLHAEQLSGERQHAVEELEGAALARDGLLARIHDARLRLQEGAHLRAALLRQKGGWESLNREARALLSAAAGDALLASASAVYAAPFDGASRRRLL 3272          

HSP 3 Score: 81.2629 bits (199), Expect = 6.032e-15
Identity = 122/651 (18.74%), Postives = 236/651 (36.25%), Query Frame = 3
Query: 3321 WKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDD---RYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANF-VNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEA-------------------TNAISLIS---QTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFK---------LNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDN 5168
            W    FS F + +A + +  W+      + +  S   ++   +  + E A  +    +L S  F  +HW+          +   +  T+  L+ L++  H   +  +   A  ++  + E       W  ++     H   L                  P GN    +  +               RL   +      F+  ++++L   I D  ++++   P    ++   R +  +  L  L     +    Q KWLFL ++F E    + H + A  F   V+K    ++      P V       +   +Q+D     L++ L   I     +   +  +  + R  F RLFFLPD  ++ LL+C F  N   +  F+   FP V  L FD +                    + +S+++   + GE + L + V PR     WL++FE    ST    +  C+               + I +  R    ++                     EE +   L+ + + L  + +Q ++VA ++ + K +   L + G++I   K         L   L+ H     +++ S +++  +L +L +       N R  + LA +      S  SF +Q ++KY  G +
Sbjct:  841 WTAQPFSQFSVGSAKDEVERWKAALLHVEGSLVSDDAVLIACQSLLGELAHNLQLLEKLGSTFFKDRHWEAVLASTLLSSMQWLEDFTIAQLLSLNLVHHHNSIVQVWRMACAEHALDMELRRQHAAWAQRDLVLAAHMWFLP--------------PTEPHGNSPGGQQHQ---------------RLATPSG----TFIFADIDELRALIEDDTMALRTLTPPVHEEELQGRAETWIDVLHHLDDMLDLWVTLQAKWLFLSKVFNEMGLQRDHPQLAQKFHSEVDKVYRDVVQAALDDPSVLSVLGHRREYATQRDQWGLALRTMLASSISTAEQVFGELTRLTDSSRERFARLFFLPDEDIMGLLSCAF--NAHRLLPFVTRCFPGVVGLGFDASPPPSAGDGSEAADPALRACADPLSIVAAHGEVGEVVRLREDVRPRYCPIAWLQDFERSLASTGCHQLAECV---------------AFICIVRRCNFGIWN------------------GPEEDITEFLIKWNALLATFSVQYIVVASEVLWTKFIILTLRENGNQIQKAKDVCNTQLGRLVFALRWH-----MSQGSTSKDATRLHLLLSCLITRTCNQR--DSLASVR-----SEGSFEWQKLMKYYLGSD 1411          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 56.9954 bits (136), Expect = 1.229e-7
Identity = 66/271 (24.35%), Postives = 127/271 (46.86%), Query Frame = 3
Query: 3849 KSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRYKLLVRALED-----LRLSTTILGE---CQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEA----------TNAI-SLISQTGERLDLYKPVCPRNSASQWLKEFE 4604
            K +E+  +    + + + +++++F++   ++++  + DSII+I           RY   +++  D     L L    L E   CQ  WL+LE IF      +     A  F+ V+K    ++ +I + P     +    +L + K++      + LLE I++     C +E  +++ R  FPR +FL + +L+E+L    ++N Q++   +   F A+ RL F  A          TN I +++S  GE++ L K +  R +   WL + E
Sbjct:  982 KKVEDGWKTAEFVVLPHRDSKDVFILAGTDEIQILLDDSIINIS-----TITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNN------NALLEQIQK-----C-LEAYLESKRVVFPRFYFLSNDELLEIL--AQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGLKARGNVEDWLGKVE 1233          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.617e-7
Identity = 67/334 (20.06%), Postives = 151/334 (45.21%), Query Frame = 2
Query: 9500 YLDFSMAVFNHLFEVFRVKTESKIQRVESAMKSVKNAXXXXXXXXXXXXXXXXXXASLNVDISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG---------------YDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVL-TKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMR--QDLEVKVYEHKELLAKRKS-MSDQIRDFKYKIDSGKNMLSDIETYVKNWTD 10444
            YL+  ++ F  L E  R++     +R E  ++ +++A S++  + ++L +LQ +L    + + N+ + +++  E          + E +  E       +K++  ++L E  P   +AL  +  L    I  +KT   PP  V+ ++E + +L G                ++ W   K ++  +   + L  FDKD+I     K +  K +TN     + + N S AA  L  W+ A+  Y  +++ + P+  +L   + ++++A   +G ++ + + +R  QD    + +  E   ++K+ + +Q+     K+D  + ++  +      W +
Sbjct: 2440 YLEL-ISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEVSRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVA---MGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWME 2769          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000600.1 (pep scaffold:Pmarinus_7.0:GL477903:500:65413:-1 gene:ENSPMAG00000000525.1 transcript:ENSPMAT00000000600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.182e-7
Identity = 61/283 (21.55%), Postives = 119/283 (42.05%), Query Frame = 3
Query: 3894 TNNENREIFLIGELNKLEEDIAD--SIISIQLKKPQAKG-DDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAI-SLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKST 4730
            T  E   + ++ E   L   +AD  S++      P  +G +D+ ++    L DL  S   L   Q KWL+LE IF   +  + H    A F+ V+ D   ++ ++ +   +         L+++       +K  L  +++++      + + ++  R  FPR +F+ D  L+E+L    + N   I   +  +F  +  + FD+  + I ++ S  GE + L + V        WL       + TLK  +  CL        + ++     + + ER + T
Sbjct:  699 TEVEGGSVPIVCEWRDLLGQLADQRSLLQSLRDSPYYRGFEDKVQVWESRLSDLDESLHNLNLIQRKWLYLEPIFGRGALPREH----ARFLRVHNDFCDIMREVSRDMRLL-------TLVAR-----PGIKRTLSAMLDQLQRCQKALNDFLEEKRSTFPRFYFIGDDDLLEILGQ--ATNPTVIQAHLKKLFAGIHSVEFDDGCHHIMAMRSLDGELVPLRQQVEVTADVEVWLGMLAEEMRQTLKQLLVQCLKNGKSGDIDPSQYPSQVLCLAERVRFT 963          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 66.2402 bits (160), Expect = 1.395e-10
Identity = 52/261 (19.92%), Postives = 129/261 (49.43%), Query Frame = 2
Query: 9758 EKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNS-WEEIKEIMVKINLYEELLYFDKD-HIDEKKYKVL-TKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRF 10531
            +K++K     + + KE    ++ ++ PT L A   ++N+    + EI++ + PP  V+ ++E V  +LGY  S W +I++ + K +    ++++D   H+  +  K +  + L++     E++   S+A   L  W+ A + ++ +   ++P   E+  ++ +    ++ L   +  T  +   +EV   ++  L+   +++  ++ + +  +D   +++  +    + W +   QF +  Q+L   I + IIS++Y + F
Sbjct: 3077 KKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSNWRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQEL---IGNCIISSIYETYF 3334          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO49393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB8])

HSP 1 Score: 138.272 bits (347), Expect = 1.477e-35
Identity = 89/272 (32.72%), Postives = 150/272 (55.15%), Query Frame = 3
Query: 1023 VRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWRSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQF--SQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNITILGELLCAMEINIGNEGPADNKPNKIAIFRTKAVIVPTDEKLML 1832
            V K +V PEH+I SS  I+H  P G     SL++WY ES ++ A+  +PF K FLV K F  W+ +      L +   + ++L+    ++G ++L+I+ LL+++S+IKFLP E     T   F  L   +S+    YL KF+ Y Q++V+++    ++ L++  +QV++H +N   K+S+   K K+  RQQ L     +V KLG FV+LV++++   ++ +A +NI       C   ++    GP   +P + A+FR  A+      KL L
Sbjct:    1 VPKDKVNPEHFIISSHSILHVMPKGPTETQSLSEWYTESCIFQAITNIPFFKNFLVIKSFLKWKEIKNFTYFLKIEAQIEKSLIHNVPSFGSALLRISYLLNDLSKIKFLPFESQYCYTLDEFEDLTFKTSNTGCMYLTKFFNYCQLIVDKSQESCFEYLRYCEAQVKNHRHNY--KESLAKAKEKRNVRQQNLNLARQEVSKLGTFVRLVDYIILQNLLSLAQSNI-------CQF-VDSTLPGP---RPEREALFRA-AITFDEAHKLAL 258          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 83.9593 bits (206), Expect = 1.416e-15
Identity = 69/315 (21.90%), Postives = 146/315 (46.35%), Query Frame = 2
Query: 9752 SQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKV------YEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQAIKEVARLTVFEDGDLENMI----EWHQWDS 10666
            ++E + KE     + +  +++ +L+E  P   AA + + +LD   I E++ + KPPE V  ++E + +LLG    W   K ++      ++L+ +DKD I +   + L K + N     E +  VS+A  S+  W+ A+  Y  + R + P+  +L A Q ++ +  S L + +        ++E K+      Y+H   +A++++++  I     ++     + + +      WT+    F   + ++  ++        Y   F    R+E+++     + +  KE+  + V +D  L N++    E  QW+S
Sbjct: 2506 AEEAVAKEKADETSAIAAEAQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLGVKPDWPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLKKYIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASL----AEVESKIAELQAAYDHS--IAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINS----WIEQCKELG-VPVSDDFSLINVLADPYEIRQWNS 2809          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 75.0998 bits (183), Expect = 7.948e-13
Identity = 61/246 (24.80%), Postives = 116/246 (47.15%), Query Frame = 2
Query: 9803 EKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLL--------------GYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQE-KVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSIL 10495
            EK+K  L E      AAL+TI+   P  I  ++   KPP  +  +++ V LL+                  SW E  ++M K +    LL FDKD I+++  ++L   L  +  + E+   V    A L  W  A+  +  +++E+ P L   LAVQE ++ +AQ +L K + + D  + +L+     ++  + +++ + D     + K+ +   ++S +    + WT+Q  +F + +  L   +L
Sbjct: 3274 EKAKPALEEAE----AALQTIK---PAHISTVRKLAKPPHLIMRIMDCVLLLMVKKVDPVVHDPERNMLKPSWSESLKLMSKSDFLNNLLNFDKDSINDETVELLAAYLEADDYNMETAKRVCGDVAGLCSWTRAMSTFFGINKEVLP-LKANLAVQEARLGVAQGDLNKAQAQLDEKQAELDEAQAMYENAVKEKQDLLDDAEACRRKMLAASALISGLGGEKERWTEQSKEFAEQIGRLVGDVL 3511          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 72.4034 bits (176), Expect = 4.947e-12
Identity = 105/510 (20.59%), Postives = 199/510 (39.02%), Query Frame = 3
Query: 4074 CQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGI-IC--NIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATN----AISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYV-HLINKISKNENLEQLRMLSAIQNLVVLNDRHI-EILAKLMEDPDCSSKSFVYQAIVK--YDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQV--TVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMS 5564
             Q KW++LE IF          E A  F +++K    ++    ++P V                E  +  +RL +L   +NG+  C  ++ + + + R+ FPR FF+ D +L+ +L    S +   +   M  +F  +  L F E +N    A ++IS  GE +D  + V        W+                S L +    +  +TKE   AI+             +  +Q+T         ++E            W+M+Y   V L  +++++   +                N   K H  +  L+ K+  N +    +      N V++ + H  +I+   + D    S+ F +++ ++  +D   +E              + I+ C  +F Y YEY+ ++   L +T +T+++  T+   L +Y    P   G   + K E  K  ++ LG      + G  +  +S  K F G    G+    + F+ I V  +S +S
Sbjct: 1337 VQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVL---------------EACHAPNRLDQLQFIVNGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG---SHDPTCVQEHMIKMFDNIASLRFQEGSNKETLATAMISSEGESMDFRQAVPAEGRVEDWMT---------------SVLKEMRRTNRLITKE---AIY-------------NYCNQIT---------RIE------------WMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDRKKF----NTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDE--------------LMIRQCTGEFGYGYEYMGLN-GRLVITPLTDRIYLTITQALSMYLGGAPA--GPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVS 1755          

HSP 2 Score: 67.0106 bits (162), Expect = 1.875e-10
Identity = 56/240 (23.33%), Postives = 117/240 (48.75%), Query Frame = 2
Query: 9860 TIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDN-SWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWT----DQRTQFHQLMQD--LPRSILSFIISNMYLSRFPLAMRNEVL 10558
             +++LD   + EI+++ KPP  V+ + E +  L GY   SW+  K +M + N  + L   D D I   + K    +L       E +  VS+A A L  ++ A++ Y +++REI P+  ++  ++    +++ EL K++     + ++LE    ++ + + ++ S+ ++    + ++ +   ++S + +    WT    D + Q  +L+ D  L  + LS      YL  F    R ++L
Sbjct: 2974 ALQDLDKSDVTEIRSFAKPPRAVQMVSECIVALRGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLS------YLGAFTWDFRRDML 3207          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 71.2478 bits (173), Expect = 1.126e-11
Identity = 54/218 (24.77%), Postives = 105/218 (48.17%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGEL----LAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNW 10438
            + E ++ +L+E  P    A++ + +L+   + EIK+Y +PP  V  ++E V +L   + +W E K  +   N  ++L+ +DKD++ ++  K +           E +  VS AA SL  W+ A+  Y  + R + P+   L      ++EK +I      K+K  TD M    E+K  ++ E  A+++ +  +    + K+D    ++S +      W
Sbjct: 2900 MAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSEPTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRME---ELK-RQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRW 3113          

HSP 2 Score: 55.8398 bits (133), Expect = 4.499e-7
Identity = 50/207 (24.15%), Postives = 88/207 (42.51%), Query Frame = 3
Query: 4077 QEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVF---HYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNV-------RHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVK-------RLLFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESC 4646
            Q +W++LE IF  E   +     +A F +VN +  +++ ++ + P      HY                        L+E +N +   +EEI K++       R  FPR +FL +  L+E+L    S+N +++   +   F  +K        L FD+ T A+ + S  GE ++    V        WL + E   + TLK  ++ C
Sbjct: 1267 QRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYP----------------------GLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQ--SKNPEAVQPHLKKCFDNIKTLKMARVGLTFDK-TEAVGMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHC 1448          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Medaka
Match: si:dkey-11m19.5 (si:dkey-11m19.5 [Source:ZFIN;Acc:ZDB-GENE-120709-97])

HSP 1 Score: 90.1225 bits (222), Expect = 5.981e-17
Identity = 113/475 (23.79%), Postives = 198/475 (41.68%), Query Frame = 3
Query: 4242 VLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNA-------------------ISLISQTGERLDLYKP---VCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLIN-------KISKNENLEQLRMLSA--IQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYL 5573
            V L   ++ DS +   L++ +  M  I C + +I+  +   FPRL+FL D ++IELL+  + Q   ++  F+  +F  V  L FD   ++                   +S +  T +   ++ P   V P   A  WL  FE   K T+K  ++ C VQQ    N++        F+ +        EI    Q  +   + N   V  L           L ++PLQ LLVA+++ + + + +A      +  S      LK HN   L N         + +E   Q+   S+  ++ LV L   H + L++LME P     SF + +++KY     + N L   ++  + +V       +F Y +EY       +  T  T+Q  + +L+ L S     +  N  S +        + LG+ +       S      ++  LGAL +G+ L +++ D +  G +S + K L
Sbjct:    2 VKLVSSETTDSKICQSLMDGLSTMEAIFCQMVDILPTLCDQFPRLWFLSDSEVIELLS--YQQTPFTLQPFVCKLFQGVCWLAFDSKLSSNTNDGKSCAASTQGQKEMNVSGVLGTFQEQVVFCPSLEVDPNTLA--WLFSFEKQLKLTIKRLMKKCAVQQ----NQIQP------FVLDSPCDKAETEI----QAHYSHHKENALPVLGL-----------LSEFPLQCLLVAEEVNWCRIVLQAF-----QKTSLGGLRNLKAHNLAKLENLGETIRSTFNGSEMTPQVSKHSSMCLRALVHLTMNHAQQLSRLMEVPHDPELSFEWISLMKYHFNSEDQNALDSDDLTCYVDVLDH----RFQYGFEYFGPEDWVMVHTPSTDQAILGILMALKSYRSGFVSRNSMSGQNHTIVQLGKALGQQIVVKQCYPSTTPGFVQQMLLGALHTGAWLLLDSVDLLPKGVMSLLGKLL 438          

HSP 2 Score: 72.7886 bits (177), Expect = 1.097e-11
Identity = 53/200 (26.50%), Postives = 99/200 (49.50%), Query Frame = 2
Query: 9731 LALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSE----LGKMKVRTDL-MRQDLEVKV 10315
            LA+ +C ++E  ++ L   LN+  +++KS        +L  L  + +LDP  +EE+  Y  PPE V  ++  + LL      WE  K ++ + N  EEL +FD   +  ++ + L +++ +     ES+  VS+A  SL  W+  +  Y     ++      LL  Q +V + ++E    L K + + D    +DL++K+
Sbjct: 1835 LAVQKCETEENQLERLKEQLNQAVQQAKS-------LFLLRLRILESLDPHDLEEVHHYRDPPEGVVRVINSICLLFNLPPGWESAKHLLGQPNFMEELEFFDCCTVTTEQLQQLEEIIQSPHFEPESVREVSKACESLCRWVLLVYEYCCKRHQL------LLQQQMEVLVREAESQVCLAKQQKKEDYQCLEDLQLKI 2021          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Medaka
Match: ENSORLT00000033932.1 (pep primary_assembly:ASM223467v1:18:6909494:6915764:1 gene:ENSORLG00000028147.1 transcript:ENSORLT00000033932.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 3.034e-14
Identity = 52/182 (28.57%), Postives = 97/182 (53.30%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAV-------QEKVSIAQSELGK--MKVRTDLMRQDLEVKV 10315
            + E ++ +L++  P   AAL+ + +L+   + E+K+Y +PP  V  +++ V  LLG   SW E K+ +   N  + L+ FDK+ I ++  K +      +    E++  VS AA SL  W+ A+  Y ++ RE+ P+  +L A        Q  +S +Q +LG+  +  R +   +++EVK+
Sbjct:   34 MAETAQKDLDKALPALEAALKALESLNKKDLTEMKSYDRPPALVETVMQAVMTLLGKSPSWAEAKKELGDTNFIKTLVNFDKNRITDQVLKKIGTFCRQKDFQPETVGRVSLAAKSLCMWVRAMEVYGHVYREVEPKRAQLNAAKAQLADKQAALSESQDKLGEVILTTRWEEKSEEMEVKL 215          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Medaka
Match: DYNC2H1 (dynein cytoplasmic 2 heavy chain 1 [Source:NCBI gene;Acc:101163989])

HSP 1 Score: 77.7962 bits (190), Expect = 2.783e-13
Identity = 117/581 (20.14%), Postives = 234/581 (40.28%), Query Frame = 3
Query: 3894 TNNENREIFLIGELNKLEEDIADSIISIQLKK--PQAKG-DDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDE-ATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQ----VTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLLLQERSNL 5612
            T++  R I LI +   +   + D+   +Q  K  P  +   D+  L    L DL      L   Q +W++LE IF   +  +      A F  V++D   ++  I++   V        V LS +    + +KS L+ +++++     ++ E ++  R  FPR +F+ D  L+E+L    + N   I   +  +F  +  ++FDE   + +++ S  GE + L   V   +    WL E                                 ++ M E  K  +++ +  +           K  V+ L             +YP Q+L +A++I F + + KAL      +   +L L  K  +Y  +      + N E + +   ++ L++    +I ++ +L +    S+  + ++  +++  G +           +F +  IQ   +QF Y YEY   +   L  T +T++    +T  M +GL  N      G   + K E  K+   + GR +   +    I  +S  + F+G +  G+    + F+ +    +S +S  +  ++  L+   N+
Sbjct: 1266 TDSSGRTISLIKDWRDVVSQVGDNRCLLQSLKDSPYYRSFQDKVSLWEVRLSDLDEYLLNLNAIQRRWVYLEPIFGRGALPREE----ARFKRVDEDFRSIMSDIQRDTRV--------VSLSSR----AGIKSSLVAILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQ--ATNPSVIQSHLKKLFAGIHSVVFDEQCQHIVAMCSLEGEVVPLRTAVRISSLVEVWLGEL--------------------------------SVQMKETLKHLLYECLMAV----------KKGNVDPL-------------RYPSQILCLAEQIQFTEDVEKALKQ--QHLHQLELELNSKLEHYTRVDTNSDDSPNTESVILQLKLKALILDIIHNISMVKQLNQAGVTSTDDWAWKKQLRFYMGPD-----------KFCH--IQMVDAQFSYTYEYQG-NAAKLVHTPLTDKCYLTLTQAMKMGLGGNP----YGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQAIQDSLKHHKNI 1753          

HSP 2 Score: 57.3806 bits (137), Expect = 4.317e-7
Identity = 43/153 (28.10%), Postives = 81/153 (52.94%), Query Frame = 2
Query: 9755 QEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG-YDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNE--TLHQESLMNVSQAAASLSGWLYAILRYTNLSREINP 10204
            +EK+  E++  + E K K +  L EV P    A   + N+ P A+ EI++   PP+ +RD++E V  L+G +D +W  +K  + K  + E++  FD  +I  +  + + ++L     +   ++    S AAA L+ W+ A ++Y+ +   I P
Sbjct: 2925 KEKMAVEVSK-IEERKAKIEDELKEVQPLVDEAKRAVGNIKPEALSEIRSLRMPPDVIRDILEGVLRLMGIFDTTWVSMKSFLAKRGVREDIATFDARNITPEIRQSVEELLNRNKASFDPKNAKRASAAAAPLAAWVKANVQYSFVLERIGP 3076          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 70.4774 bits (171), Expect = 5.861e-11
Identity = 63/261 (24.14%), Postives = 117/261 (44.83%), Query Frame = 2
Query: 9848 AALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG--------------YDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQE-KVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQ 10585
            AAL+TI+   P  I  ++T  +PP  +   ++ V LLL                 +SW+E   +M   +   EL  F KD I+E+  ++L         + E     S   A L  W  A+  +  +++E+ P L   LAVQE ++++A  +L K +   D  + +L V   E++E + ++ ++ +  +  + K+    N++S +    + WT+Q  +F    + L   +L       Y   F    R+ +L++ Q    Q
Sbjct: 2788 AALQTIK---PSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLP-LKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQ 3044          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 70.0922 bits (170), Expect = 6.010e-11
Identity = 63/261 (24.14%), Postives = 117/261 (44.83%), Query Frame = 2
Query: 9848 AALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLG--------------YDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQE-KVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQ 10585
            AAL+TI+   P  I  ++T  +PP  +   ++ V LLL                 +SW+E   +M   +   EL  F KD I+E+  ++L         + E     S   A L  W  A+  +  +++E+ P L   LAVQE ++++A  +L K +   D  + +L V   E++E + ++ ++ +  +  + K+    N++S +    + WT+Q  +F    + L   +L       Y   F    R+ +L++ Q    Q
Sbjct: 1353 AALQTIK---PSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLP-LKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQ 1609          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000076398.1 (SMESG000076398.1)

HSP 1 Score: 6039.92 bits (15668), Expect = 0.000e+0
Identity = 2984/3051 (97.80%), Postives = 3004/3051 (98.46%), Query Frame = 3
Query:   48 MKNTRSLKLNNIKYGNLQSHSSDKDNYIWACNDRKNMLERFENFGDIDIDELKSVQSQLLALTVEVNKRPKLSIWQELNEHLNHISALSDIILIDKKLESELNTVYKYLLANPEFSYLLPGMEMKLRQFLGIRNKTLSKQVDRNKEEEGEYYPLPIRKCNKMLSSKIMPENVVEWFVDREKGDLFNPATIDRNITVKPKKIKMKDFLAAIGSVAKEIIFTQYAFEKPLENLIRAFDVDLSEFKSINTGEVDDRFSEIEECSLKIPESEDLSEDSKNVDLAKGFPKPKSGRDTIIYMIKCFHLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWRSLTVSNRHLSVGKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNITILGELLCAMEINIGNEGPADNKPNKIAIFRTKAVIVPTDEKLMLKAFPGVEDIEAMFTNIINSIPKLILKHCYPLDGLIRSDHLNRFKEIIVGNLSENRTGHSTILTSKSEILTEIMSKSERRLDKITKPDLPYIKLPVKSEDNLRVATPPAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPIYCNLIDGFTELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYFYEQKLVKVKRYIHNLENTEKQVILSNRIFTVSXXXXXXXXXXXXXXXXXTISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIKTLIRV*PKGCTWNETLGNVIEAWKYSIVVHYELEDSARNIENVICGSRYSTVSDDVKEVLMEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVSLVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNSNKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNFDEISVGDISEMSKYLWKLRLLLQERSNLENKSGMIRRLSLPSRVGNERIVKDSFRDKDLHSLSERIIRSASQSGRCRTDYYEMQTNKLNKGNNWPFFTPEYEKSTEDDYDTYVPNYVTGMEIYDEIIDVRYGFGVCCGIMNDRFKLGSIPMSLKSQMRIHCLIETDKRFHIKSYIIMAGQEKNSEVLESCISSLFNEVNRFQNHLSGVLSTLTPLVISKCDWSFGSSPIKALKQSFITEIGKRISNEFKDQDLFMSCLEKCFQRDACEEDEGERSKSVNEGSGLLHQIKCQIRLRNREIFSSDIDKIMELKSCILSHQIVVVTGPSCSGKTSAIDILVQALNTVVNPGHTPRFDMKSRGNIDVLKSLSNERKSLSQSDYLYGRETNRKIILKRITLSNFTREELKGQRWINGIEKPSVLSSIFDPLLKIQKLEKFRLWLCVETDWRNINDDISIVRSCLGEDVKVIIEVTESVDHGAKISPVHGIVQFPRIGNINVLIIEQYINSLLSEKVISYYGCKYLKEITLNMFSKLFDVLRFHIEISQEYELEINWISQSLDILEVLLLENKDLSQEFESISFLEKRLNTYLSFSIVQGARGVPYSVLVHKRLVSHEDYERMIREILVLICPDVDPKKDELVSSLFGLMIDFDEMCLKQFNAIKGKQLPLFGSCADGVARFLIQLLVKHNRPLHLHGPRDRIDSFTDSIRYNKRIKLDSCLEFSMMRKSLYNRTEKYWDILSNKDPLSNVCDNKXXXXXXXXXXXXXXXEQCISMLRFSIEYKSLYDSTLEDSCYEELSLGDFLVVLTRSHESNEPNYTPGKWTRWFTCINFINPHLIEVPQILYKALYPWICQLPKLDKELYKILAKKLAAFIPDVCLAVENENRTYLILKICDSNLATTYPLQQNWSRIIQISKSLISLPLDMFVSTFRKFEKLLPFEFESHSANQPKDMNERFKAYKIRASKVRVMRYLIFTVSRFLLDPLEHDIQRNRVISVINNQLDNHFFTDLPFEVDQILFKSFPILVENLNDIVMLSSRICEEAPEDESPYYQPIFEPHSWKIFDLAKTNISKIDVVKVHLQRSTHLKSFVGTGEFVKDLMKIYKHFCQYSLSNSALFVKSYSSLVNGYDWGVFISGLIQAVHIPLNASGSHSLPRFYQSLQSAMHKAGKEHQKVVFHIDSNIINITRDILSVLTKLIQQDSLVAIQQFLYDNKRSLSSIKTDREIRLTRV 9200
            MKNTRSLKLNNIKYGNLQSHSSDKDNYIWACNDR+NMLERFENFGDIDIDELKSVQSQLLALTVEVNKRPKLSIWQELNEHLNHISALSDIILIDKKLESELN VYKYLLANPEFSYLLPGMEMKLRQFLGIRNKTLSKQVDRNKEEEGEYYPLPIRKCNKM+SSKIMPENVVEWFVDREKGDLFNPATIDRNITVKPKKIKMKDFLAAIGSVAKEIIFTQYAFEKPLENLIRAFDVDLSEF+SINTGEVDDRFSEIEECSLKIPESEDLSEDSKNVDLAKGFPKPKSGRDTIIYMIKCFHLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWRSLTVSNRHLSVGKYLSRNLM+VNVTYGKSILQIARLLDEISQIKFLPT+LSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQ HRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNITILGELLCAMEINIGNEGPADNKPNK+AIFRTKA IVPTDEKLMLKAFPGVEDIEAMFTNIINSIPKLILKHCYPLDGLIRSDHLNRFKEII+GNLSENRTGHSTILTSKSEILTEIMSKSERRLDKITKPDLPYIKLPVKSEDNLRVATPPAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPIYCNLIDGFTELFHECQQEMNALFQEVNW+VDVRNEYNLWAKVNMSTEWI QSPYFYEQKLVKVKRYIHNLENTEKQVILSNRIFTVSFEAIIEELLAEMEFELETISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIK                               ELEDSARNIENVICGSRYSTVSDDVKEVLMEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVSLVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMK KANKEFNHHLRYWITKEFEFE+HRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLE KLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQA GDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPD+QLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMS+FLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGN NSNKLEIAKSFSEVLGRNLFAISSG+SIYSESFRKYFLGALMSGSLLFVNN DEISVGDISEMSKYLWKLR LLQERSNLENKSGMIRRLSLPSRVGNERIVKDSFRDKDLHSLSERIIRSASQSGRCRTDYYEMQTNKLNKGNNWPFFTPEYEKSTEDDYDTYVPNYVT MEIYDEIIDVRYGFGVCCGIMNDRFKLGSIPMSLKSQMRIHCLIETDKRFHIKSYIIMAGQEKNSEVLESCISSLFNEVNRFQNHLSGVLSTLTPLVISKCDWSFGSSPIKALKQSFITEIGKRISNEFKDQDLFMSCLEKCFQRDACEEDEGERSKSV+EGSGLLHQIKCQIRLRNREIFSSDIDKIMELKSCILSHQIVVVTGPSCSGKTSAIDILVQALNTVVNPGHTPRFDMKSRGNIDVLKSLSNERKSLSQSDYLYGRETNRKIILKRITLSNFTREELKGQRWING+EKPSVLSSIFDPLLKIQKL+KFRLWLCVETDWRNINDDISIVRSCLGEDVKVIIEVTESVDHGAKISPVHGIVQFPRIGNINVLIIEQYINSLLSEKVISYYGCKYLKEITLNMFSKLFDVLRFHIEISQEYELEINWISQSLDILEVLLLENKDLSQEFESISFLEKRLNTYLSFSIVQGARGVPYSVLVHKRLVSHEDYERMIREILVLICPDVDPKKDELVSSLFGLMIDFDEMCLKQFNAIKGKQLP+FGSCADGVARFLIQLLVKHNRPLHLHGPRDRIDSFTDSIRYNKRIKLDSCLEFSMMRKSLYNRTEKYWDILSNKDPLSNVCDNKDIILLDDFSTDLDTSEQCIS+LRFSIEYKSLYDSTLEDSCYEELSLGDFLVVLTRSHESNEPNYTPGKWTRWFTCINFINPHLIEVPQILYKALYPWICQLPKLDKELYKILAKKLAAFIPDVCLAVENENRTYLILKICDSNLATTYPLQQNWSRIIQISKSLISLPLDMFVSTFRKFEKLLPFEFESHSANQPKDMNERFKAYKIRASKVRVMRYLIFTVSRFLLDPLEHDIQRNRVISVIN+QLDNHFFTDLPFEVDQILFKSFPILVENLNDIVMLSSRICEEAPEDES YYQPI EPHSWKIFDLAKTNI+KIDVVKVHLQRSTHLKSFVGTGEFVKDLMKIYKHFCQYSLSNSALFVKSYSSLVNG DWGVFISGLIQAVHIPLNAS SHSLPRFYQ LQSAMHKAGKEHQKVVFHIDSN+INITRDILSVLTKLIQQDSLVAIQQFLYDNKRSLSSIKTDREIRLTRV
Sbjct:    1 MKNTRSLKLNNIKYGNLQSHSSDKDNYIWACNDRENMLERFENFGDIDIDELKSVQSQLLALTVEVNKRPKLSIWQELNEHLNHISALSDIILIDKKLESELNAVYKYLLANPEFSYLLPGMEMKLRQFLGIRNKTLSKQVDRNKEEEGEYYPLPIRKCNKMISSKIMPENVVEWFVDREKGDLFNPATIDRNITVKPKKIKMKDFLAAIGSVAKEIIFTQYAFEKPLENLIRAFDVDLSEFRSINTGEVDDRFSEIEECSLKIPESEDLSEDSKNVDLAKGFPKPKSGRDTIIYMIKCFHLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDGTGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWRSLTVSNRHLSVGKYLSRNLMTVNVTYGKSILQIARLLDEISQIKFLPTKLSEVQTEASFAQLISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSKDSIYMKKIKQKHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNITILGELLCAMEINIGNEGPADNKPNKVAIFRTKADIVPTDEKLMLKAFPGVEDIEAMFTNIINSIPKLILKHCYPLDGLIRSDHLNRFKEIIIGNLSENRTGHSTILTSKSEILTEIMSKSERRLDKITKPDLPYIKLPVKSEDNLRVATPPAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPIYCNLIDGFTELFHECQQEMNALFQEVNWLVDVRNEYNLWAKVNMSTEWIAQSPYFYEQKLVKVKRYIHNLENTEKQVILSNRIFTVSFEAIIEELLAEMEFELETISDFILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAEFQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDFVNSEKENVLFTIKTRIK-------------------------------ELEDSARNIENVICGSRYSTVSDDVKEVLMEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVSLVYSNWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKNKANKEFNHHLRYWITKEFEFEKHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLEFKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQATGDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDFQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMSESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPGHEIASFKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHIEILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQCCMSRFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNLNSNKLEIAKSFSEVLGRNLFAISSGKSIYSESFRKYFLGALMSGSLLFVNNVDEISVGDISEMSKYLWKLRFLLQERSNLENKSGMIRRLSLPSRVGNERIVKDSFRDKDLHSLSERIIRSASQSGRCRTDYYEMQTNKLNKGNNWPFFTPEYEKSTEDDYDTYVPNYVTRMEIYDEIIDVRYGFGVCCGIMNDRFKLGSIPMSLKSQMRIHCLIETDKRFHIKSYIIMAGQEKNSEVLESCISSLFNEVNRFQNHLSGVLSTLTPLVISKCDWSFGSSPIKALKQSFITEIGKRISNEFKDQDLFMSCLEKCFQRDACEEDEGERSKSVDEGSGLLHQIKCQIRLRNREIFSSDIDKIMELKSCILSHQIVVVTGPSCSGKTSAIDILVQALNTVVNPGHTPRFDMKSRGNIDVLKSLSNERKSLSQSDYLYGRETNRKIILKRITLSNFTREELKGQRWINGMEKPSVLSSIFDPLLKIQKLDKFRLWLCVETDWRNINDDISIVRSCLGEDVKVIIEVTESVDHGAKISPVHGIVQFPRIGNINVLIIEQYINSLLSEKVISYYGCKYLKEITLNMFSKLFDVLRFHIEISQEYELEINWISQSLDILEVLLLENKDLSQEFESISFLEKRLNTYLSFSIVQGARGVPYSVLVHKRLVSHEDYERMIREILVLICPDVDPKKDELVSSLFGLMIDFDEMCLKQFNAIKGKQLPIFGSCADGVARFLIQLLVKHNRPLHLHGPRDRIDSFTDSIRYNKRIKLDSCLEFSMMRKSLYNRTEKYWDILSNKDPLSNVCDNKDIILLDDFSTDLDTSEQCISLLRFSIEYKSLYDSTLEDSCYEELSLGDFLVVLTRSHESNEPNYTPGKWTRWFTCINFINPHLIEVPQILYKALYPWICQLPKLDKELYKILAKKLAAFIPDVCLAVENENRTYLILKICDSNLATTYPLQQNWSRIIQISKSLISLPLDMFVSTFRKFEKLLPFEFESHSANQPKDMNERFKAYKIRASKVRVMRYLIFTVSRFLLDPLEHDIQRNRVISVINHQLDNHFFTDLPFEVDQILFKSFPILVENLNDIVMLSSRICEEAPEDESHYYQPILEPHSWKIFDLAKTNINKIDVVKVHLQRSTHLKSFVGTGEFVKDLMKIYKHFCQYSLSNSALFVKSYSSLVNGCDWGVFISGLIQAVHIPLNASASHSLPRFYQLLQSAMHKAGKEHQKVVFHIDSNLINITRDILSVLTKLIQQDSLVAIQQFLYDNKRSLSSIKTDREIRLTRV 3020          

HSP 2 Score: 1318.91 bits (3412), Expect = 0.000e+0
Identity = 685/727 (94.22%), Postives = 700/727 (96.29%), Query Frame = 2
Query: 9239 TVDSKDLEYNKDIKKVSEWFLTSSRNYLVLGDQNVQSYKDSLDNMVPILSTSHSTELQMLAEAHIYLNKYLYRILQRFGVAFDCNGKYLDFSMAVFNHLFEVFRVKTESKIQRVESAMKSVKNAXXXXXXXXXXXXXXXXXXASLNVDISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQAIKEVARLTVFEDGDLENMIEWHQWDSLIRLHLDNASAFALILSCPSISFPDFGSLFLIHYQADESGNLAEILKLVFESKSISEIRVKEHEDHCEESKEFVHYIDCSRTDEEDLEEKLSHLMRTNAILLVDNIEMXXXXXXXXXXXXYSSGNGSFDDTNPQFRLVLLTRIMNSPSDLHCSLFTSSKLFHYEFGLTRHNVQHILSDFTVKICQPALFENLLQLDKQIFEIRQMCKLEKVIMRIIYSKCSAN*KS------CEILVYPVLLDKPFLSTLV 11401
            TVDSKDLEYNKDIKKVSEWFLTSSRNYLVLGDQNVQSYKDSLD+MVPILSTSHSTELQMLAEAHIYLNKYLYRILQRFGVAFDCNGKYLDFSMA+FNHLFEVFRVKTESKIQRVESAMKSVKNAESKIEKLSSKLESLQKELASLNVDISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQ+KVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDI TYVK+WTDQRTQFHQL+QDLPRSILSFIIS MYLSRFPLAMRNEVL DIQERFAQAIKEVARLTVFEDGDLENMIEWHQWDSLIRLHLDNASAFALILSCPSISFPDFGSLFLIHYQADESGNLAEILKLVFESKSISEIRVKEHEDHCEESKEFVHYIDCSRTDEEDLEEKLSHLMRTNAILLVDNIEMLRHLCPTLHLLLYSSGNGSFDDTNPQFRLVLL+RIMNSPSDLHCSLFTSSKLFHYEFGLTRHNVQHILSDFTVKICQPALFENLLQLDKQIFEIRQMCKLEK  +    +KC +   S       ++ + P +LD P   T++
Sbjct: 3034 TVDSKDLEYNKDIKKVSEWFLTSSRNYLVLGDQNVQSYKDSLDSMVPILSTSHSTELQMLAEAHIYLNKYLYRILQRFGVAFDCNGKYLDFSMAIFNHLFEVFRVKTESKIQRVESAMKSVKNAESKIEKLSSKLESLQKELASLNVDISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQDKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIGTYVKDWTDQRTQFHQLIQDLPRSILSFIISTMYLSRFPLAMRNEVLGDIQERFAQAIKEVARLTVFEDGDLENMIEWHQWDSLIRLHLDNASAFALILSCPSISFPDFGSLFLIHYQADESGNLAEILKLVFESKSISEIRVKEHEDHCEESKEFVHYIDCSRTDEEDLEEKLSHLMRTNAILLVDNIEMLRHLCPTLHLLLYSSGNGSFDDTNPQFRLVLLSRIMNSPSDLHCSLFTSSKLFHYEFGLTRHNVQHILSDFTVKICQPALFENLLQLDKQIFEIRQMCKLEKNSILEASAKCISKEFSDFSSVNTDLGLNPSILDVPNFHTMI 3760          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000033128.1 (SMESG000033128.1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.050e-13
Identity = 62/272 (22.79%), Postives = 134/272 (49.26%), Query Frame = 2
Query: 9794 ELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQE----RFAQAIKE 10597
            +++E + ++L +  P   AA++ + +L+   I EIK+Y KPP  V+ ++E V +L G + +W E K+ + + +  ++L+ FDKD+I ++  K +   +  +    + +  VS AA SL  W+ A+  Y  + R + P+       ++++  A+S L + + +    +  L+  + E K L  +     +Q  + + K +  + ML      V     ++ ++ + + DL   I   +  +  ++   L+     L D +E    ++ +AIK+
Sbjct: 3169 KMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPK-------RQRLQAAESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQI-GLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKK 3432          

HSP 2 Score: 66.6254 bits (161), Expect = 5.027e-10
Identity = 105/503 (20.87%), Postives = 198/503 (39.36%), Query Frame = 3
Query: 3183 SLFKCYQSIAIEECPKTVDLDQIRSLVSLVY---SNWTLLFNSADQIEIWKRSLFSLFQISTAAERI--SEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEE----IMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRL----LFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLKFYIESCLV 4652
            +LFK  Q  + E      DLD I ++  L     +NWT           WK   F   + +T  E +  S +   T   +   +    I+E TR+ V++F   MP    L ++    +HW Q   +I  +F +     T++ +IDL+  +H+ ++  +   A                  TKE   E         + + + +ES+ +   P  ++ ++              L  +  L  T ++NR                 ++ + +  KP     D+++   R L  ++ +  +L   Q +WL+LE IF  E   +   + +A+F  +NK   V++ ++ Q   + +    GK             K  LLE    MN  + +I++     ++  R+ FPR +F+ +  L+E+L    S+N   +   +   F  +  L    L  +   A S+ S  GE +   + +        WL + E   + TL+  +  C +
Sbjct: 1293 NLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQ----------WKSGRFIELK-TTEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAA------------------TKELAIE------NALKGMEKLWESVELEIIPHKDKEKNHF-----------LLSGIDDLYQTLDDNRNTL-------------SNMKTSRFVKPFEHEVDKWE---RDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQ---IRNARACGK-------------KEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQ--SKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRDLLRDCRI 1715          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000033128.1 (SMESG000033128.1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.087e-13
Identity = 62/272 (22.79%), Postives = 134/272 (49.26%), Query Frame = 2
Query: 9794 ELKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKMKVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQE----RFAQAIKE 10597
            +++E + ++L +  P   AA++ + +L+   I EIK+Y KPP  V+ ++E V +L G + +W E K+ + + +  ++L+ FDKD+I ++  K +   +  +    + +  VS AA SL  W+ A+  Y  + R + P+       ++++  A+S L + + +    +  L+  + E K L  +     +Q  + + K +  + ML      V     ++ ++ + + DL   I   +  +  ++   L+     L D +E    ++ +AIK+
Sbjct: 3218 KMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGAEPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYVAQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPK-------RQRLQAAESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQI-GLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKK 3481          

HSP 2 Score: 56.6102 bits (135), Expect = 6.205e-7
Identity = 89/420 (21.19%), Postives = 168/420 (40.00%), Query Frame = 3
Query: 3183 SLFKCYQSIAIEECPKTVDLDQIRSLVSLVY---SNWTLLFNSADQIEIWKRSLFSLFQISTAAERI--SEWETETAAFKLNYNSRIMIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEE----IMKNVRHHFPRLFFLPDYQLIELLN 4415
            +LFK  Q  + E      DLD I ++  L     +NWT           WK   F   + +T  E +  S +   T   +   +    I+E TR+ V++F   MP    L ++    +HW Q   +I  +F +     T++ +IDL+  +H+ ++  +   A                  TKE   E         + + + +ES+ +   P  ++ ++              L  +  L  T ++NR                 ++ + +  KP     D+++   R L  ++ +  +L   Q +WL+LE IF  E   +   + +A+F  +NK   V++ ++ Q   + +    GK             K  LLE    MN  + +I++     ++  R+ FPR +F+ +  L+E+L 
Sbjct: 1293 NLFKIEQPPSKEIAALEKDLDNIENIWKLALEWETNWTQ----------WKSGRFIELK-TTEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFDQHAEMINEVSGAA------------------TKELAIE------NALKGMEKLWESVELEIIPHKDKEKNHF-----------LLSGIDDLYQTLDDNRNTL-------------SNMKTSRFVKPFEHEVDKWE---RDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQ---IRNARACGK-------------KEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILG 1634          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000007049.1 (SMESG000007049.1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.219e-12
Identity = 64/300 (21.33%), Postives = 141/300 (47.00%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSEL----GKMKVR-TDLMRQDLEV----KVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQ-AIKEVARLTVFEDGDLENMIEWHQWDS 10666
            + + ++ +L+E  P    A++ +  LD   I EI+ +  PP+ V+ ++E V LLLG    W   K ++      ++L  + KD+I E   K L + + +     E++  VS+A  SL  W+ A+  Y+   + + P+       ++++ IA  EL    GK++ +  +L+  + ++    K+Y++   + ++K++   +     ++     + + +    + WT+  ++F++ + ++   +        Y   F  + R+E+L     R  +  I     +T+   G L +  E  QW+S
Sbjct: 2843 IADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPK-------KKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNS--VTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLM--GVLGDAFELRQWNS 3131          

HSP 2 Score: 59.6918 bits (143), Expect = 6.946e-8
Identity = 83/417 (19.90%), Postives = 170/417 (40.77%), Query Frame = 3
Query: 3432 IVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIG---ELNKLEEDIADSIISIQLKKPQAKGDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEA----------------------TNAI-SLISQTGERLDLYKPVCPRNSASQWLKEFE 4604
            +V   +D V +    M     L +     +HWQQ    I ++F +  +KLT+  LI+L+V                                   F+++E   ++  Q S     E++                     K +E   +    + + + +++++F++G   E+ +L +D   ++ +I   +       R    V+ L+    +      CQ  WL+LE IF      +     A +F++V+K    ++ ++++ PL    +    +L + K++      ++LL+ I++     C +E  +++ R  FPR +FL + +L+E+L    ++N  ++   +   F A+ +L F  A                      TN I ++IS  GE++ L K +  R +  +WL + E
Sbjct: 1015 VVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNV-----------------------------------FDYKEELEEISGQASSEASLEALL--------------------KKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNN------NQLLDQIQK-----C-LEAYLESKRVIFPRFYFLSNDELLEIL--AQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVE 1362          
BLAST of dynein heavy chain domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000007049.1 (SMESG000007049.1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.376e-12
Identity = 64/300 (21.33%), Postives = 141/300 (47.00%), Query Frame = 2
Query: 9797 LKEKSKSNLNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYDNSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLMNVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSEL----GKMKVR-TDLMRQDLEV----KVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIETYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQERFAQ-AIKEVARLTVFEDGDLENMIEWHQWDS 10666
            + + ++ +L+E  P    A++ +  LD   I EI+ +  PP+ V+ ++E V LLLG    W   K ++      ++L  + KD+I E   K L + + +     E++  VS+A  SL  W+ A+  Y+   + + P+       ++++ IA  EL    GK++ +  +L+  + ++    K+Y++   + ++K++   +     ++     + + +    + WT+  ++F++ + ++   +        Y   F  + R+E+L     R  +  I     +T+   G L +  E  QW+S
Sbjct: 2836 IADDAQRDLDEAMPALENAIKALDALDKNDIAEIRVFTNPPQMVQTVMESVCLLLGQKTDWASAKSVLGDPYFLKKLADYPKDNIPEALLKKLKRYIDDPNFTAENVEKVSKACRSLVLWVRAMDIYSKTVKTVEPK-------KKRLEIANKELDEVMGKLRQKQAELLAVENKIAELQKIYDNS--VTEKKALEHNLALTSARLKRAGKLTTALADEKERWTESVSKFNEELGNVVGDVFMGAACVAYYGAFTSSYRHELLSGWIGRCRELEIPVSEHITLM--GVLGDAFELRQWNS 3124          

HSP 2 Score: 59.6918 bits (143), Expect = 7.004e-8
Identity = 83/417 (19.90%), Postives = 170/417 (40.77%), Query Frame = 3
Query: 3432 IVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDKLTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFEEHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKLSRLPITNNENREIFLIG---ELNKLEEDIADSIISIQLKKPQAKGDDRYKLLVRALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDILVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIICNIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAVKRLLFDEA----------------------TNAI-SLISQTGERLDLYKPVCPRNSASQWLKEFE 4604
            +V   +D V +    M     L +     +HWQQ    I ++F +  +KLT+  LI+L+V                                   F+++E   ++  Q S     E++                     K +E   +    + + + +++++F++G   E+ +L +D   ++ +I   +       R    V+ L+    +      CQ  WL+LE IF      +     A +F++V+K    ++ ++++ PL    +    +L + K++      ++LL+ I++     C +E  +++ R  FPR +FL + +L+E+L    ++N  ++   +   F A+ +L F  A                      TN I ++IS  GE++ L K +  R +  +WL + E
Sbjct: 1008 VVPVLKDKVEQMREKMSVITNLLNPCLQERHWQQIEDIINYKFSESEEKLTLGKLIELNV-----------------------------------FDYKEELEEISGQASSEASLEALL--------------------KKVEEAWQITEYVVLPHKDSKDVFILGGTDEIQQLWDDSNINVATIASSRHVGPIKPRVDEWVKNLDLFGKTIEEWLNCQRNWLYLESIFSAPDIQRQLPSEAKSFMSVDKSYKEIMRKVQKVPLAMRATTTPGLLDTFKNN------NQLLDQIQK-----C-LEAYLESKRVIFPRFYFLSNDELLEIL--AQTRNPLAVQPHLRKCFDAISKLDFAIAETPKVESSDGMPQTPQPQEVKYTNDILAMISPEGEKVSLGKGLKARGNVEEWLGKVE 1355          
The following BLAST results are available for this feature:
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNHD12.260e-2428.24dynein heavy chain domain 1 [Source:HGNC Symbol;Ac... [more]
DNHD16.827e-2428.24dynein heavy chain domain 1 [Source:HGNC Symbol;Ac... [more]
DNAH25.911e-1423.46dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH25.911e-1423.46dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH24.593e-1224.38dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
che-34.638e-1418.91Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-13.570e-1221.54Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-13.859e-1221.54Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-13.859e-1221.54Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-33.943e-720.59Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kl-53.355e-1522.63gene:FBgn0267433 transcript:FBtr0346772[more]
kl-25.135e-1426.30gene:FBgn0001313 transcript:FBtr0346722[more]
Dhc16F1.048e-1225.24gene:FBgn0283476 transcript:FBtr0074509[more]
Dhc64C2.468e-1021.75gene:FBgn0261797 transcript:FBtr0073359[more]
Dhc64C2.574e-1021.75gene:FBgn0261797 transcript:FBtr0332748[more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-11m19.57.908e-4322.02si:dkey-11m19.5 [Source:ZFIN;Acc:ZDB-GENE-120709-9... [more]
si:dkey-11m19.57.908e-4322.02si:dkey-11m19.5 [Source:ZFIN;Acc:ZDB-GENE-120709-9... [more]
si:dkey-11m19.52.933e-3824.15si:dkey-11m19.5 [Source:ZFIN;Acc:ZDB-GENE-120709-9... [more]
dnah23.154e-1723.74dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah23.199e-1723.74dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg32.298e-1720.99pleckstrin homology and RhoGEF domain containing G... [more]
plekhg32.337e-1720.99pleckstrin homology and RhoGEF domain containing G... [more]
plekhg32.567e-1720.99pleckstrin homology and RhoGEF domain containing G... [more]
DNAH21.562e-1423.05dynein, axonemal, heavy chain 2 [Source:NCBI gene;... [more]
ENSXETT00000008415.15.543e-1327.66dynein axonemal heavy chain 14 [Source:NCBI gene;A... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnhd18.356e-4819.48dynein heavy chain domain 1 [Source:MGI Symbol;Acc... [more]
Dnah28.133e-1523.95dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah28.341e-1523.95dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah51.480e-1122.68dynein, axonemal, heavy chain 5 [Source:MGI Symbol... [more]
Dnah93.915e-1121.30dynein, axonemal, heavy chain 9 [Source:MGI Symbol... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96M86|DNHD1_HUMAN3.279e-2328.24Dynein heavy chain domain-containing protein 1 OS=... [more]
sp|Q9MBF8|DYH1B_CHLRE2.138e-1421.52Dynein-1-beta heavy chain, flagellar inner arm I1 ... [more]
sp|P0C6F1|DYH2_MOUSE5.689e-1423.95Dynein heavy chain 2, axonemal OS=Mus musculus OX=... [more]
sp|Q9P225|DYH2_HUMAN2.839e-1323.46Dynein heavy chain 2, axonemal OS=Homo sapiens OX=... [more]
sp|Q9SMH3|DYH1A_CHLRE5.709e-1326.84Dynein-1-alpha heavy chain, flagellar inner arm I1... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|238541304.014e-11722.32tr|V4CEK6|V4CEK6_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|239145911.722e-10823.43tr|K1QK39|K1QK39_CRAGI Dynein heavy chain 2, axone... [more]
gnl|BL_ORD_ID|249774406.102e-10321.40tr|C3YSF5|C3YSF5_BRAFL Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|182077746.274e-10222.30tr|A0A267H0N4|A0A267H0N4_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182954091.596e-10121.93tr|A0A267E1K7|A0A267E1K7_9PLAT Uncharacterized pro... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah22.538e-1622.01dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000016172.21.344e-1120.68pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
ENSAMXT00000016401.21.832e-921.31pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
DYNC2H13.131e-923.44dynein cytoplasmic 2 heavy chain 1 [Source:HGNC Sy... [more]
DYNC1H13.155e-920.00dynein cytoplasmic 1 heavy chain 1 [Source:HGNC Sy... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000005139.19.291e-1725.81pep scaffold:Pmarinus_7.0:GL476545:294684:336608:-... [more]
DNAH61.229e-724.35dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000001140.11.617e-720.06pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000000600.12.182e-721.55pep scaffold:Pmarinus_7.0:GL477903:500:65413:-1 ge... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN11.395e-1019.92Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493931.477e-3532.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318001.416e-1521.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356037.948e-1324.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358524.947e-1220.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340771.126e-1124.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-11m19.55.981e-1723.79si:dkey-11m19.5 [Source:ZFIN;Acc:ZDB-GENE-120709-9... [more]
ENSORLT00000033932.13.034e-1428.57pep primary_assembly:ASM223467v1:18:6909494:691576... [more]
DYNC2H12.783e-1320.14dynein cytoplasmic 2 heavy chain 1 [Source:NCBI ge... [more]
dnah55.861e-1124.14dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah56.010e-1124.14dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
back to top
BLAST of dynein heavy chain domain-containing protein 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076398.10.000e+097.80SMESG000076398.1[more]
SMESG000033128.12.050e-1322.79SMESG000033128.1[more]
SMESG000033128.12.087e-1322.79SMESG000033128.1[more]
SMESG000007049.16.219e-1221.33SMESG000007049.1[more]
SMESG000007049.16.376e-1221.33SMESG000007049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000376 ID=SMED30000376|Name=dynein heavy chain domain-containing protein 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=11755bp
ATCTCTCAAAAACTAAGACAACAAATGTTATAAATTTAAAAAAATAAATG
AAAAATACAAGATCATTAAAATTAAATAACATTAAATATGGCAATTTGCA
AAGTCATTCATCGGATAAGGATAATTACATCTGGGCTTGCAATGACAGGA
AAAACATGCTTGAAAGGTTTGAGAATTTCGGTGATATTGACATCGACGAG
TTGAAATCTGTGCAAAGCCAATTATTGGCACTGACTGTTGAAGTGAATAA
AAGGCCAAAGTTAAGTATTTGGCAAGAATTGAATGAGCATTTGAATCATA
TTTCAGCGCTTTCCGATATCATTTTGATAGACAAAAAACTGGAATCTGAA
TTGAATACGGTGTACAAATATCTGCTCGCCAATCCGGAATTCTCGTACTT
ACTTCCGGGCATGGAAATGAAACTGAGACAGTTTCTGGGAATACGAAACA
AAACTCTATCCAAACAAGTTGACAGAAACAAGGAGGAAGAAGGAGAGTAT
TATCCGTTACCAATTAGGAAATGCAACAAAATGCTAAGTTCAAAAATCAT
GCCAGAAAATGTCGTAGAATGGTTTGTCGACAGAGAGAAAGGAGATTTGT
TTAATCCGGCAACAATTGACAGAAACATCACGGTCAAGCCGAAAAAAATC
AAAATGAAAGATTTCCTTGCGGCAATCGGTAGTGTGGCCAAAGAGATTAT
ATTCACACAATATGCGTTCGAAAAGCCTTTAGAAAATCTTATCAGAGCAT
TTGATGTGGATTTATCAGAATTCAAATCTATCAACACAGGAGAGGTTGAC
GACAGATTTTCAGAAATTGAGGAATGTTCATTGAAAATACCTGAGAGTGA
AGATTTGTCTGAAGACTCGAAAAATGTTGACTTGGCTAAAGGGTTTCCAA
AACCAAAATCCGGACGGGATACTATCATATATATGATCAAATGCTTCCAT
TTGCGAGAGATGCGAGTTGCTTATCTCAATTATACAAAACAGAGGATTCG
AGATTTATATTCTTTGACAGTGGTTCGGAAAACTCAAGTCGAACCTGAGC
ATTATATTTTCAGTAGTTTCGGTATAATACATAGATTCCCTGACGGAACC
GGAGTTGCCATGTCCTTGACTGATTGGTATAGGGAGTCAATCCTCTATTG
CGCCTTGAAATGTATGCCTTTCGTAAAGCAGTTCTTGGTGAGGAAATATT
TCCAAGGGTGGAGATCTCTGACCGTCAGTAACCGACATTTATCTGTGGGG
AAATATTTGTCACGGAATCTCATGTCGGTCAATGTGACTTATGGGAAATC
GATTTTGCAGATTGCCAGACTGCTGGACGAGATTTCCCAGATTAAATTTC
TCCCAACCGAACTGAGTGAAGTCCAGACCGAGGCATCCTTTGCACAACTG
ATATCCCATTCCAGCTCAGTTGCCAATGAATACCTCATCAAGTTCTACAA
ATATGTTCAAATGATGGTCAATGAAACGGCTGCAGAACTGTACAAGGCAT
TACAGTTTTCCCAGGTCCAAAGTCATAGCAACAACTTATATTCCAAAGAC
TCCATTTATATGAAAAAGATAAAACAAATGCACCGACAACAGGCTCTTAC
TGATTGCTTGGATCAAGTTTATAAGTTAGGGGACTTTGTGAAGCTAGTCA
ACTTCATGCTAAACAGCAAAATCGTCGAGATCGCATTGAACAATATCACA
ATTCTCGGTGAATTATTGTGCGCCATGGAAATCAACATTGGCAATGAAGG
TCCGGCCGATAATAAACCGAATAAAATCGCAATTTTCAGAACGAAGGCCG
TTATTGTACCAACTGATGAGAAGCTCATGCTAAAGGCTTTCCCAGGAGTT
GAGGACATTGAAGCCATGTTTACGAATATCATAAATAGCATTCCTAAATT
GATTTTGAAGCACTGTTACCCTTTGGACGGCCTGATCAGAAGTGACCACC
TTAACAGATTCAAGGAAATTATCGTTGGTAATCTCAGTGAGAACAGAACC
GGACACTCAACCATTCTCACTAGTAAATCAGAAATTCTAACGGAGATTAT
GAGCAAGTCAGAGAGAAGGTTGGACAAGATCACAAAACCAGATTTGCCTT
ACATAAAACTTCCCGTGAAATCCGAAGATAATCTCAGAGTCGCGACGCCA
CCAGCGGTCAATCCGAATATTTTCGACAAACCCTCACTCAAGTTATTTGG
TCGTTCTATACCGGCAAAGTTTACTCCAATAAACACTGAAGATGTATTCG
AAATGCTTAGGCTGAATCCCATTTACTGCAATTTGATCGACGGCTTTACC
GAACTCTTCCACGAATGTCAACAAGAAATGAATGCTTTATTTCAGGAGGT
CAACTGGATGGTTGACGTGAGAAATGAATACAACTTATGGGCAAAAGTGA
ACATGAGCACCGAATGGATCACCCAATCCCCTTATTTTTATGAACAAAAG
CTAGTGAAGGTTAAACGCTACATTCACAATTTGGAGAACACAGAAAAACA
AGTGATCTTATCTAACAGGATATTTACAGTGTCGTTTGAAGCCATTATTG
AAGAGCTGTTGGCGGAAATGGAATTCGAGCTCGAGACAATTTCTGATTTC
ATTTTGAATTCAGTTAGAAAGTTGGGGTTGGAATTTATAGGGAAAATTAC
TGACGTGCTTCAGTTTCTGCGCGAAAGAACATTGGAAGTCGAGATATTCA
CCAAAGTGGTTCACTATATCGGATATAGTAGAGATAATCACGCGGAATTT
CAGAAATCTGTGGATTTTATTAAATCACTATTTGATGTGCTGCGTATCTC
AGCGAAACATATCAAAGAAAAGGATAAGTCCATTGAGGACGAAGTGACAT
CCCTCTGGGAATCATTCATATTTCAGTTACAAGAAGCAAATGATTTTGTG
AATAGTGAAAAAGAAAATGTTTTATTCACAATTAAAACAAGGATCAAGAC
GTTGATCCGGGTGTGACCGAAAGGGTGCACATGGAATGAGACTCTTGGTA
ATGTTATTGAGGCATGGAAATATTCAATTGTGGTGCACTATGAACTAGAA
GACAGTGCTAGAAATATCGAGAATGTGATCTGCGGATCGAGATATTCAAC
GGTTTCCGATGATGTCAAAGAGGTGTTGATGGAGATCAGTAAAGTCCTTG
AGGGTTGTGATCAAATACACGGAGAATTGGACAGCCTATTCAAGTGCTAT
CAATCTATTGCTATTGAAGAGTGTCCCAAAACAGTTGATTTAGATCAGAT
CCGATCACTAGTGAGCCTAGTCTATTCAAATTGGACCTTGCTGTTCAATT
CGGCAGATCAAATAGAAATATGGAAAAGATCATTGTTCTCTCTTTTCCAA
ATCTCGACGGCTGCGGAAAGGATATCCGAATGGGAAACGGAAACGGCAGC
ATTTAAATTGAATTATAATTCAAGAATCATGATTGTTGAACAGACCCGGG
ACGGTGTCAATGAATTTGCCAGTTTTATGCCGTTTTTCCGCCAGTTGTCC
TCCCAGATGTTTACATTGCAACATTGGCAGCAATTCTTCCTTCAAATTGG
TCACGAATTCATTGACCCTTATGACAAGTTGACTGTGCAAGATTTAATAG
ATCTAGATGTGAGGGAACATTCAAGGATCCTAGAAGCGTTGCACAATGAT
GCGGCAATGAAATATAAAGCAAACAAAGAATTTAATCACCATTTGAGATA
TTGGATAACGAAAGAATTCGAATTCGAGGAGCACAGAACAGATTTGCGTT
GTCAGAGATCTCTTCATGAACGATTCGAATCCATCGCCATTTCCAAAACT
CCAGTTGGCAACCGCACTCGATCTGAACTGGAAAGATATCACGACAACAA
AAGTCTCGAAAACAAGCTGGAGAAGTTGAGTCGATTGCCTATTACCAATA
ATGAGAATAGGGAGATATTTTTGATCGGGGAACTGAATAAATTGGAAGAA
GACATTGCCGACTCTATAATTTCAATCCAATTGAAGAAGCCTCAGGCAAA
AGGTGATGATCGTTATAAACTTCTCGTCCGAGCTCTAGAGGATTTAAGAT
TATCAACTACTATCTTGGGAGAATGCCAGGAAAAGTGGCTTTTTCTTGAA
AGGATATTCGAGGAAGAATCTTTCGTCCAAGCTCATTTGGAGACTGCGGC
TAATTTTGTCAATGTAAATAAAGACATTCTGGTTTTACTCGATCAAATCA
AGCAGTCCCCCCTTGTATTTCATTATTCGCCAATTGGGAAAGTCCTTTTA
TCGCAGAAGGATAGTGAGGATTCTAACTTGAAATCTCGTTTGCTAGAACT
AATAGAAAGGATGAATGGAATTATATGCAATATCGAAGAAATTATGAAAA
ATGTCAGACATCATTTCCCTCGACTTTTCTTCCTTCCAGACTATCAACTG
ATTGAGCTACTGAATTGCAAGTTTTCACAAAATATACAAAGCATTAACCG
CTTTATGCCATCTATTTTCCCGGCAGTCAAGCGTTTGCTATTCGATGAAG
CCACAAATGCGATTTCCTTAATCAGCCAAACCGGAGAACGACTGGATCTC
TACAAACCGGTCTGTCCAAGAAATTCCGCCTCCCAATGGCTGAAAGAATT
TGAATTAGTATTCAAATCAACTTTGAAATTCTATATCGAATCTTGCCTTG
TTCAACAATCCGAGGAAAGCAATGAGGTTACCAAAGAAGCGAAAAGTGCA
ATATTCATGACAGAAAGAACTAAGTCGACGATGTTTCAGGAAATTGATAC
CATTGACCAGCTTACCCACCGGATGTCCGAAAGCAATAAAGAGAAAGTAG
AAGAGCTAGTTAACAGCATTCTCTTAACATTCGAATCGTGGTTAATGAAA
TACCCTTTGCAAGTCTTATTGGTGGCGGATAAAATATTTTTTGCTAAAAC
ATTGAGGAAAGCCTTAACTGACCCAGGGCACGAAATCGCATCATTCAAGT
TAAATCTGATGCTGAAGAAACACAATTATGTCCATCTTATCAATAAAATC
TCTAAAAATGAAAATCTGGAACAGCTGAGGATGTTATCCGCAATACAAAA
CCTAGTCGTCCTGAATGACCGGCACATTGAAATTTTGGCCAAGCTTATGG
AAGATCCTGACTGTTCTTCAAAGTCCTTTGTCTATCAAGCTATTGTGAAA
TACGATACTGGGGATAATGAAGCAAATCTCTTGATTCCTTCGAATGTCCA
TCGTTTTGGAAATGTCACTATACAATGCTGTATGAGCCAATTCCTATATG
ATTATGAATATATTGCAATCTCCCGGTGCGACTTGTTCCTCACGTCCGTC
ACTGAGCAGGTAACCGTGAATATGTTGCTGGGATTGTATAGCAATGAGAT
TCCAACTATCATCGGCAATTTCAATAGCAATAAACTCGAAATTGCTAAAT
CCTTTTCGGAAGTTCTTGGCCGCAACTTATTTGCCATCTCGTCAGGAAGA
TCTATTTATTCTGAAAGCTTTCGAAAATATTTCCTAGGAGCTCTGATGTC
TGGAAGTTTGCTCTTTGTGAACAATTTCGATGAAATCTCTGTTGGTGACA
TTTCCGAAATGAGCAAGTACCTCTGGAAATTGAGACTTCTGTTGCAGGAA
CGTTCGAACTTAGAAAATAAAAGCGGAATGATTCGTCGCCTGTCTTTACC
GTCCAGAGTTGGCAATGAAAGAATAGTTAAAGATAGCTTCAGGGATAAAG
ATCTTCATTCTTTATCCGAACGAATCATTCGATCTGCCTCCCAATCTGGA
AGATGCCGAACAGATTATTATGAAATGCAGACGAACAAATTGAATAAAGG
AAATAATTGGCCGTTCTTTACGCCGGAATACGAAAAATCCACCGAGGATG
ATTATGATACTTACGTTCCTAATTATGTAACCGGAATGGAGATATACGAT
GAAATTATTGATGTTAGATATGGCTTCGGGGTCTGTTGTGGGATAATGAA
TGATAGGTTCAAGCTAGGGTCCATTCCGATGTCATTGAAGAGCCAAATGA
GAATCCATTGTCTGATAGAAACAGATAAAAGGTTCCACATCAAGTCATAT
ATTATAATGGCTGGCCAAGAGAAGAATTCGGAAGTTTTAGAATCTTGCAT
CAGCTCTTTATTTAATGAAGTGAATCGTTTCCAAAATCATCTTTCTGGTG
TCCTATCTACACTTACTCCGCTTGTTATATCAAAATGTGATTGGTCATTT
GGATCATCGCCAATCAAGGCATTGAAACAATCCTTTATTACAGAAATTGG
GAAAAGAATTTCCAATGAATTTAAAGATCAGGATCTCTTTATGAGTTGCC
TTGAAAAATGTTTCCAACGGGATGCATGTGAGGAGGATGAAGGAGAACGA
AGTAAATCTGTCAATGAAGGCTCTGGATTACTCCATCAAATCAAATGCCA
AATACGATTGAGAAATCGGGAAATATTCTCGTCGGACATTGATAAAATCA
TGGAACTAAAATCCTGTATCCTTTCACATCAAATCGTCGTGGTCACAGGT
CCGTCTTGTTCCGGGAAAACATCAGCTATTGATATTCTTGTGCAAGCTCT
AAATACGGTGGTAAATCCTGGCCATACTCCGAGATTTGATATGAAGAGTC
GAGGCAATATTGATGTTTTAAAATCATTGTCAAACGAAAGGAAATCTCTA
TCTCAGTCAGATTATCTATACGGTAGAGAGACAAACAGAAAGATTATTTT
GAAACGAATAACTTTATCGAATTTTACAAGAGAAGAGCTGAAAGGTCAAA
GATGGATCAATGGAATTGAAAAGCCAAGTGTGCTTTCGTCGATTTTTGAT
CCTTTATTGAAAATACAGAAGTTGGAGAAATTCCGTTTATGGCTTTGCGT
CGAGACGGACTGGCGGAATATAAATGATGATATATCCATCGTTAGATCTT
GCTTAGGTGAGGATGTGAAAGTGATAATCGAAGTGACAGAAAGTGTAGAT
CACGGTGCTAAAATCTCGCCTGTTCATGGAATAGTCCAATTTCCTAGAAT
AGGAAATATTAATGTTTTGATTATAGAACAATATATAAATTCATTATTAT
CAGAAAAAGTGATTTCTTATTACGGGTGCAAATATTTGAAGGAGATTACA
TTGAACATGTTCAGCAAGTTGTTCGATGTCCTTAGGTTCCATATTGAGAT
CAGCCAAGAATATGAGTTGGAAATTAATTGGATCAGTCAATCTTTGGACA
TTTTGGAAGTGTTACTTCTTGAAAATAAAGATTTGTCTCAGGAATTTGAA
TCCATCAGTTTCCTTGAAAAACGCTTGAATACTTATCTGTCTTTCTCAAT
AGTCCAAGGAGCCCGAGGAGTGCCATATTCGGTGCTAGTTCATAAACGGC
TGGTGAGCCATGAAGATTACGAGAGAATGATCAGAGAGATATTGGTTTTG
ATTTGTCCTGACGTTGATCCTAAGAAAGATGAATTAGTTTCTTCTTTATT
TGGCCTGATGATCGACTTCGATGAGATGTGCTTGAAACAATTTAATGCCA
TTAAAGGGAAGCAATTACCCTTATTCGGCTCTTGTGCAGATGGCGTAGCG
AGATTCCTTATACAACTTCTCGTCAAGCATAATCGACCCTTACATCTCCA
TGGTCCAAGGGATCGCATAGATTCCTTTACAGACTCCATTAGATATAATA
AACGGATCAAACTCGACAGCTGTTTGGAATTTTCTATGATGCGTAAATCA
CTTTACAATAGAACCGAGAAGTATTGGGACATTTTATCTAATAAGGACCC
CTTGTCAAATGTATGTGATAATAAGGACATCATATTATTGGATGACTTTT
CGACAGATTTAGATACAAGTGAGCAATGTATTTCCATGTTGCGATTCTCG
ATTGAATACAAGAGTTTATATGATTCGACCCTCGAGGATTCCTGTTATGA
GGAACTGTCTCTGGGAGACTTCCTTGTTGTCCTTACAAGGAGCCATGAAT
CAAATGAGCCTAATTATACACCTGGCAAATGGACTCGATGGTTTACTTGC
ATAAATTTTATTAATCCCCACTTGATAGAAGTTCCACAAATCTTGTACAA
GGCCCTCTATCCTTGGATATGTCAACTACCGAAATTGGATAAGGAATTAT
ACAAGATCCTAGCTAAGAAGTTGGCAGCCTTCATTCCCGATGTCTGTCTG
GCCGTAGAAAATGAAAACCGAACTTATTTAATATTGAAAATTTGTGATTC
TAATTTGGCAACTACTTACCCCTTACAGCAGAATTGGAGTCGGATTATAC
AGATCTCCAAATCCCTCATTTCTCTTCCTCTCGACATGTTCGTTAGCACT
TTTAGGAAATTTGAAAAACTTCTTCCATTCGAATTCGAAAGCCATTCAGC
GAATCAACCTAAAGATATGAATGAGAGGTTTAAGGCTTACAAAATAAGGG
CGAGTAAAGTGCGCGTTATGCGCTACCTAATATTTACGGTATCTCGGTTC
TTGTTGGACCCATTAGAGCACGACATTCAGAGAAATCGAGTCATTTCTGT
AATAAATAACCAATTGGACAATCATTTCTTTACCGATTTACCGTTTGAAG
TTGATCAAATTCTTTTTAAAAGTTTCCCAATTTTGGTTGAAAATTTGAAT
GATATTGTCATGCTCTCCAGTCGAATCTGTGAGGAAGCACCAGAGGACGA
AAGTCCATATTATCAGCCGATTTTTGAGCCGCATTCTTGGAAAATCTTCG
ACCTTGCAAAAACCAACATCAGCAAAATTGATGTAGTCAAAGTCCATCTA
CAAAGGTCAACTCATTTGAAATCCTTTGTGGGAACAGGAGAATTCGTGAA
GGACCTAATGAAAATCTACAAACATTTTTGTCAGTATTCTTTGAGTAACT
CCGCTTTGTTTGTAAAGTCTTATTCTTCTTTAGTCAATGGATATGATTGG
GGGGTGTTTATATCGGGCCTAATTCAGGCTGTTCATATACCTTTAAATGC
ATCGGGAAGTCACTCTTTACCGCGTTTTTATCAATCACTTCAATCAGCTA
TGCACAAAGCCGGGAAAGAACACCAGAAAGTCGTTTTCCATATAGATTCG
AACATTATCAATATAACAAGGGATATTTTGTCGGTTTTAACTAAGCTCAT
TCAACAAGATTCTTTGGTTGCGATCCAACAGTTTTTATACGATAATAAAC
GTTCATTGAGCAGCATCAAGACCGATAGAGAAATAAGATTAACTAGAGTA
TTTCTGCAAAACATTCGAAGAAATCTAAGATTTTGATAACTGTTGATAGT
AAGGATTTAGAATACAATAAAGATATCAAAAAGGTTTCCGAATGGTTTCT
AACATCATCTCGCAATTACCTCGTACTTGGTGATCAGAATGTACAAAGTT
ACAAAGACTCATTAGACAATATGGTCCCAATTCTTTCGACATCCCATTCA
ACCGAATTGCAAATGTTGGCAGAAGCTCATATTTACCTCAACAAATATCT
CTACCGAATTCTCCAACGTTTCGGAGTCGCATTCGACTGCAACGGGAAAT
ATCTCGATTTCTCAATGGCGGTCTTTAATCACCTGTTTGAGGTTTTCCGT
GTGAAAACCGAGTCGAAGATCCAACGCGTTGAATCCGCCATGAAGTCGGT
GAAAAATGCAGAAAGTAAAATCGAAAAGTTATCATCGAAGCTTGAAAGCT
TACAAAAAGAGTTGGCAAGTCTCAATGTGGATATCAGTAACTCGGCGAGC
CACATGAAACAAATGAAGGAAAGCTATGGATTGGCACTGAATCAATGTAT
ATCCCAAGAAAAGTTGATTAAGGAATTGACAGGACCTTTGAATGAATTGA
AGGAGAAATCAAAGTCTAATTTGAATGAAGTTAGTCCAACTTATTTAGCA
GCCTTAGAGACAATTAGGAACCTGGATCCGGGAGCTATTGAAGAAATAAA
AACATATATTAAGCCTCCAGAACCAGTCAGAGATCTGGTAGAAATAGTCT
TCCTCCTATTGGGATACGATAACAGCTGGGAGGAAATCAAGGAGATTATG
GTCAAGATTAATCTCTATGAAGAATTATTATATTTCGATAAAGATCATAT
CGATGAGAAGAAATACAAAGTTTTGACGAAAGTCTTGACCAATGAGACTT
TACACCAAGAATCCCTTATGAATGTCAGCCAAGCTGCAGCATCGCTTAGT
GGTTGGCTGTATGCAATATTGAGGTACACAAATCTGAGTCGGGAGATCAA
TCCCCAGCTGGGAGAATTGTTGGCAGTCCAGGAAAAAGTTAGCATAGCTC
AAAGTGAATTGGGTAAAATGAAAGTGCGTACTGATTTGATGAGGCAAGAC
CTAGAAGTAAAGGTTTATGAGCACAAGGAGCTTCTGGCTAAAAGGAAATC
AATGTCCGACCAAATACGAGATTTTAAGTACAAAATTGATTCGGGCAAGA
ATATGTTATCAGATATAGAAACCTATGTCAAGAATTGGACTGACCAAAGA
ACTCAATTCCATCAATTGATGCAGGATTTACCTCGCTCAATTCTGTCGTT
TATCATTTCTAATATGTATTTGTCTCGGTTCCCTTTGGCAATGAGGAATG
AGGTACTCGATGACATTCAAGAGCGGTTTGCACAAGCCATAAAGGAGGTG
GCTCGCCTAACAGTATTCGAAGACGGAGATCTGGAGAACATGATAGAGTG
GCATCAGTGGGATTCTTTGATAAGGTTACACCTTGATAATGCTAGTGCTT
TCGCCCTTATTTTGAGCTGTCCTTCCATTTCGTTCCCTGACTTCGGATCT
CTATTTTTAATTCACTATCAAGCTGATGAGTCTGGGAATTTGGCGGAAAT
TCTAAAATTGGTCTTCGAATCCAAATCGATTTCTGAAATTCGGGTGAAGG
AGCATGAAGATCATTGTGAAGAATCAAAAGAGTTTGTGCATTACATTGAT
TGTTCAAGGACGGATGAGGAGGATCTGGAGGAGAAATTATCTCATTTGAT
GAGAACAAATGCCATCTTGTTGGTTGATAACATAGAGATGTTGAGGCACT
TGTGTCCGACTCTTCATCTTCTACTATATAGTTCCGGAAACGGCAGCTTT
GATGACACCAATCCGCAATTTCGATTAGTTTTATTAACTAGAATAATGAA
TTCTCCTTCCGATCTCCACTGCAGTTTATTCACTTCATCTAAACTATTCC
ATTATGAGTTCGGATTGACCCGGCACAATGTGCAGCACATTTTATCGGAT
TTCACAGTGAAAATCTGTCAACCGGCACTTTTCGAGAATTTACTACAACT
TGATAAACAGATCTTTGAAATACGTCAAATGTGTAAACTTGAAAAGGTAA
TAATGAGAATTATATACTCTAAATGTTCCGCGAACTAAAAAAGTTGTGAA
ATATTGGTCTATCCAGTACTGCTAGATAAGCCATTCTTATCTACTTTGGT
TGAAACAGGTCCATTTTTTGAAGAGATTTGGTGAATTTACATATTTCTGT
ACCAAAACCTGGTTTAGTTTTGCTTGGGCTTTAAGGCGATTGTTTAAGCG
AGCTCAAATTATTACCATCAGATCTGAAATGTTTTCGAAAATTGATATAT
TTATTCGATGCTGTATTTTAATTTTTATAACCCACATATCGCTGCATGTA
ATTTGGAGGCCGTGAAATTCAACACGATTTCACACAACTACTTTGTGATA
TTTTTATGACTTTATATCAGTGCAGTTGGGATGAAAACCTGCAACATCAA
TTTTGATGTGTCAATACAAATATTGCAATTGTTTTATTGATTGCTATCAC
GTCGG
back to top

protein sequence of SMED30000376-orf-1

>SMED30000376-orf-1 ID=SMED30000376-orf-1|Name=SMED30000376-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=973bp
MKNTRSLKLNNIKYGNLQSHSSDKDNYIWACNDRKNMLERFENFGDIDID
ELKSVQSQLLALTVEVNKRPKLSIWQELNEHLNHISALSDIILIDKKLES
ELNTVYKYLLANPEFSYLLPGMEMKLRQFLGIRNKTLSKQVDRNKEEEGE
YYPLPIRKCNKMLSSKIMPENVVEWFVDREKGDLFNPATIDRNITVKPKK
IKMKDFLAAIGSVAKEIIFTQYAFEKPLENLIRAFDVDLSEFKSINTGEV
DDRFSEIEECSLKIPESEDLSEDSKNVDLAKGFPKPKSGRDTIIYMIKCF
HLREMRVAYLNYTKQRIRDLYSLTVVRKTQVEPEHYIFSSFGIIHRFPDG
TGVAMSLTDWYRESILYCALKCMPFVKQFLVRKYFQGWRSLTVSNRHLSV
GKYLSRNLMSVNVTYGKSILQIARLLDEISQIKFLPTELSEVQTEASFAQ
LISHSSSVANEYLIKFYKYVQMMVNETAAELYKALQFSQVQSHSNNLYSK
DSIYMKKIKQMHRQQALTDCLDQVYKLGDFVKLVNFMLNSKIVEIALNNI
TILGELLCAMEINIGNEGPADNKPNKIAIFRTKAVIVPTDEKLMLKAFPG
VEDIEAMFTNIINSIPKLILKHCYPLDGLIRSDHLNRFKEIIVGNLSENR
TGHSTILTSKSEILTEIMSKSERRLDKITKPDLPYIKLPVKSEDNLRVAT
PPAVNPNIFDKPSLKLFGRSIPAKFTPINTEDVFEMLRLNPIYCNLIDGF
TELFHECQQEMNALFQEVNWMVDVRNEYNLWAKVNMSTEWITQSPYFYEQ
KLVKVKRYIHNLENTEKQVILSNRIFTVSFEAIIEELLAEMEFELETISD
FILNSVRKLGLEFIGKITDVLQFLRERTLEVEIFTKVVHYIGYSRDNHAE
FQKSVDFIKSLFDVLRISAKHIKEKDKSIEDEVTSLWESFIFQLQEANDF
VNSEKENVLFTIKTRIKTLIRV*
back to top

protein sequence of SMED30000376-orf-2

>SMED30000376-orf-2 ID=SMED30000376-orf-2|Name=SMED30000376-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2036bp
MEISKVLEGCDQIHGELDSLFKCYQSIAIEECPKTVDLDQIRSLVSLVYS
NWTLLFNSADQIEIWKRSLFSLFQISTAAERISEWETETAAFKLNYNSRI
MIVEQTRDGVNEFASFMPFFRQLSSQMFTLQHWQQFFLQIGHEFIDPYDK
LTVQDLIDLDVREHSRILEALHNDAAMKYKANKEFNHHLRYWITKEFEFE
EHRTDLRCQRSLHERFESIAISKTPVGNRTRSELERYHDNKSLENKLEKL
SRLPITNNENREIFLIGELNKLEEDIADSIISIQLKKPQAKGDDRYKLLV
RALEDLRLSTTILGECQEKWLFLERIFEEESFVQAHLETAANFVNVNKDI
LVLLDQIKQSPLVFHYSPIGKVLLSQKDSEDSNLKSRLLELIERMNGIIC
NIEEIMKNVRHHFPRLFFLPDYQLIELLNCKFSQNIQSINRFMPSIFPAV
KRLLFDEATNAISLISQTGERLDLYKPVCPRNSASQWLKEFELVFKSTLK
FYIESCLVQQSEESNEVTKEAKSAIFMTERTKSTMFQEIDTIDQLTHRMS
ESNKEKVEELVNSILLTFESWLMKYPLQVLLVADKIFFAKTLRKALTDPG
HEIASFKLNLMLKKHNYVHLINKISKNENLEQLRMLSAIQNLVVLNDRHI
EILAKLMEDPDCSSKSFVYQAIVKYDTGDNEANLLIPSNVHRFGNVTIQC
CMSQFLYDYEYIAISRCDLFLTSVTEQVTVNMLLGLYSNEIPTIIGNFNS
NKLEIAKSFSEVLGRNLFAISSGRSIYSESFRKYFLGALMSGSLLFVNNF
DEISVGDISEMSKYLWKLRLLLQERSNLENKSGMIRRLSLPSRVGNERIV
KDSFRDKDLHSLSERIIRSASQSGRCRTDYYEMQTNKLNKGNNWPFFTPE
YEKSTEDDYDTYVPNYVTGMEIYDEIIDVRYGFGVCCGIMNDRFKLGSIP
MSLKSQMRIHCLIETDKRFHIKSYIIMAGQEKNSEVLESCISSLFNEVNR
FQNHLSGVLSTLTPLVISKCDWSFGSSPIKALKQSFITEIGKRISNEFKD
QDLFMSCLEKCFQRDACEEDEGERSKSVNEGSGLLHQIKCQIRLRNREIF
SSDIDKIMELKSCILSHQIVVVTGPSCSGKTSAIDILVQALNTVVNPGHT
PRFDMKSRGNIDVLKSLSNERKSLSQSDYLYGRETNRKIILKRITLSNFT
REELKGQRWINGIEKPSVLSSIFDPLLKIQKLEKFRLWLCVETDWRNIND
DISIVRSCLGEDVKVIIEVTESVDHGAKISPVHGIVQFPRIGNINVLIIE
QYINSLLSEKVISYYGCKYLKEITLNMFSKLFDVLRFHIEISQEYELEIN
WISQSLDILEVLLLENKDLSQEFESISFLEKRLNTYLSFSIVQGARGVPY
SVLVHKRLVSHEDYERMIREILVLICPDVDPKKDELVSSLFGLMIDFDEM
CLKQFNAIKGKQLPLFGSCADGVARFLIQLLVKHNRPLHLHGPRDRIDSF
TDSIRYNKRIKLDSCLEFSMMRKSLYNRTEKYWDILSNKDPLSNVCDNKD
IILLDDFSTDLDTSEQCISMLRFSIEYKSLYDSTLEDSCYEELSLGDFLV
VLTRSHESNEPNYTPGKWTRWFTCINFINPHLIEVPQILYKALYPWICQL
PKLDKELYKILAKKLAAFIPDVCLAVENENRTYLILKICDSNLATTYPLQ
QNWSRIIQISKSLISLPLDMFVSTFRKFEKLLPFEFESHSANQPKDMNER
FKAYKIRASKVRVMRYLIFTVSRFLLDPLEHDIQRNRVISVINNQLDNHF
FTDLPFEVDQILFKSFPILVENLNDIVMLSSRICEEAPEDESPYYQPIFE
PHSWKIFDLAKTNISKIDVVKVHLQRSTHLKSFVGTGEFVKDLMKIYKHF
CQYSLSNSALFVKSYSSLVNGYDWGVFISGLIQAVHIPLNASGSHSLPRF
YQSLQSAMHKAGKEHQKVVFHIDSNIINITRDILSVLTKLIQQDSLVAIQ
QFLYDNKRSLSSIKTDREIRLTRVFLQNIRRNLRF*
back to top

protein sequence of SMED30000376-orf-3

>SMED30000376-orf-3 ID=SMED30000376-orf-3|Name=SMED30000376-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=656bp
MVPILSTSHSTELQMLAEAHIYLNKYLYRILQRFGVAFDCNGKYLDFSMA
VFNHLFEVFRVKTESKIQRVESAMKSVKNAESKIEKLSSKLESLQKELAS
LNVDISNSASHMKQMKESYGLALNQCISQEKLIKELTGPLNELKEKSKSN
LNEVSPTYLAALETIRNLDPGAIEEIKTYIKPPEPVRDLVEIVFLLLGYD
NSWEEIKEIMVKINLYEELLYFDKDHIDEKKYKVLTKVLTNETLHQESLM
NVSQAAASLSGWLYAILRYTNLSREINPQLGELLAVQEKVSIAQSELGKM
KVRTDLMRQDLEVKVYEHKELLAKRKSMSDQIRDFKYKIDSGKNMLSDIE
TYVKNWTDQRTQFHQLMQDLPRSILSFIISNMYLSRFPLAMRNEVLDDIQ
ERFAQAIKEVARLTVFEDGDLENMIEWHQWDSLIRLHLDNASAFALILSC
PSISFPDFGSLFLIHYQADESGNLAEILKLVFESKSISEIRVKEHEDHCE
ESKEFVHYIDCSRTDEEDLEEKLSHLMRTNAILLVDNIEMLRHLCPTLHL
LLYSSGNGSFDDTNPQFRLVLLTRIMNSPSDLHCSLFTSSKLFHYEFGLT
RHNVQHILSDFTVKICQPALFENLLQLDKQIFEIRQMCKLEKVIMRIIYS
KCSAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0005488binding
GO:0003777microtubule motor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR042222Dynein_2_N
IPR042228Dynein_2_C
IPR026983DHC_fam
IPR019774Aromatic-AA_hydroxylase_C
IPR024743Dynein_HC_stalk
IPR013602Dynein_heavy_dom-2
IPR027417P-loop_NTPase
IPR016024ARM-type_fold
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0007018microtubule-based movement
Vocabulary: cellular component
TermDefinition
GO:0005930axoneme
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR042222Dynein heavy chain, domain 2, N-terminalGENE3DG3DSA:1.20.140.100coord: 77..233
e-value: 2.2E-6
score: 29.5
IPR013602Dynein heavy chain, domain-2PFAMPF08393DHC_N2coord: 76..330
e-value: 3.6E-30
score: 105.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 548..667
e-value: 5.4E-5
score: 25.2
NoneNo IPR availableGENE3DG3DSA:1.20.58.1120coord: 388..540
e-value: 1.2E-10
score: 43.6
IPR042228Dynein heavy chain, domain 2, C-terminalGENE3DG3DSA:3.20.180.20coord: 236..334
e-value: 4.6E-12
score: 48.1
IPR026983Dynein heavy chainPANTHERPTHR10676DYNEIN HEAVY CHAIN FAMILY PROTEINcoord: 65..1859
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 941..1048