retinol dehydrogenase 13-like

Overview
Nameretinol dehydrogenase 13-like
Smed IDSMED30000373
Length (bp)1167
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of retinol dehydrogenase 13-like (SMED30000373) t-SNE clustered cells

Violin plots show distribution of expression levels for retinol dehydrogenase 13-like (SMED30000373) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of retinol dehydrogenase 13-like (SMED30000373) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for retinol dehydrogenase 13-like (SMED30000373) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000373

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000373SMESG000043196.1 Contig5365GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000373SMESG000075916.1 Contig4319GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000373SMESG000049264.1 SMESG000009696.1 SMESG000009679.1 SMESG000009674.1 Contig4319GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000373SMESG000049264.1 SMESG000009696.1 SMESG000009679.1 SMESG000009674.1 Contig5365GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000373SMESG000049264.1 SMESG000009696.1 SMESG000009679.1 SMESG000009674.1 Contig3235GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30000373SMESG000049264.1 SMESG000009696.1 SMESG000009679.1 dd_Smed_v4_2096_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30000373SMESG000049264.1 SMESG000009696.1 SMESG000009679.1 dd_Smed_v4_2096_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000373SMESG000049264.1 SMESG000009696.1 SMESG000009679.1 dd_Smed_v4_2096_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000373SMESG000049264.1 SMESG000009696.1 SMESG000009679.1 dd_Smed_v4_2096_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30000373SMESG000043196.1 Contig5365GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000373SMESG000049264.1 SMESG000009696.1 SMESG000009679.1 SMESG000009674.1 Contig5365GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of retinol dehydrogenase 13-like vs. Ensembl Human
Match: RDH13 (retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:HGNC:19978])

HSP 1 Score: 218.009 bits (554), Expect = 1.649e-67
Identity = 136/313 (43.45%), Postives = 188/313 (60.06%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYAR----PVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQNIL 1084
            L+ Y+ G  C  K  I GK V++TGANTGIG +TA+ELA+RGG I + CR+ +KC  A   +  + +     V    +DLAS+KSI  F  K      ++D+LINNAG+M CP+  TEDGFEMQ GVNHLGHFLLTN LLD +K +  SRII +SS AH+ G I+  DLN +   Y   +AY QSKLA +L  + L++ LQ  GV V +LHPGV  TEL R+  GI    ++     P+F  L+K+P   +Q S   AV  +L  +SG+YF D    ++   + +D+ +A  LW  S   +  +  S+ +  L
Sbjct:   21 LKDYVTGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKDI--RGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHT-GIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYF-DGLKQKAPAPEAEDEEVARRLWAESARLVGLEAPSVREQPL 329          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Human
Match: RDH13 (retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:HGNC:19978])

HSP 1 Score: 218.009 bits (554), Expect = 1.649e-67
Identity = 136/313 (43.45%), Postives = 188/313 (60.06%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYAR----PVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQNIL 1084
            L+ Y+ G  C  K  I GK V++TGANTGIG +TA+ELA+RGG I + CR+ +KC  A   +  + +     V    +DLAS+KSI  F  K      ++D+LINNAG+M CP+  TEDGFEMQ GVNHLGHFLLTN LLD +K +  SRII +SS AH+ G I+  DLN +   Y   +AY QSKLA +L  + L++ LQ  GV V +LHPGV  TEL R+  GI    ++     P+F  L+K+P   +Q S   AV  +L  +SG+YF D    ++   + +D+ +A  LW  S   +  +  S+ +  L
Sbjct:   21 LKDYVTGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKDI--RGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHT-GIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYF-DGLKQKAPAPEAEDEEVARRLWAESARLVGLEAPSVREQPL 329          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Human
Match: RDH11 (retinol dehydrogenase 11 [Source:HGNC Symbol;Acc:HGNC:17964])

HSP 1 Score: 215.312 bits (547), Expect = 1.335e-66
Identity = 132/297 (44.44%), Postives = 188/297 (63.30%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKC-LTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDN-YGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            +R  L   +C    ++ GKVV++TGANTGIG ETA ELA+RG  +++ CR+ +K  L A+    +Q+     +V    +DL+  KSI +F K F      L VLINNAG+MMCPY +T DGFEM IGVNHLGHFLLT+ LL+ +K +  SRI+ VSS AH  G I+    NL+G+  Y    AY  SKLANIL  + LA+ L+  GV   S+HPG V +EL+R+   + ++ +   +F+F +KTP +G+QTS+ CA+   L  LSG +FSDC  +   +++ +++ +A  LW  S D
Sbjct:   24 IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKE---IQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFH--NLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWW---LFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCH-VAWVSAQARNETIARRLWDVSCD 311          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Human
Match: RDH12 (retinol dehydrogenase 12 [Source:HGNC Symbol;Acc:HGNC:19977])

HSP 1 Score: 213.001 bits (541), Expect = 1.011e-65
Identity = 130/295 (44.07%), Postives = 183/295 (62.03%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            +R +  G +C    ++ GKVV+ITGANTGIG ETA ELA RG  +++ CR+  K  +A +++ + +K   S+V    +DL+  KSI +F + F     +L +LINNAG+MMCPY +T DGFE  +GVNHLGHFLLT  LL+ +K +  +R++ VSS AH  G I   DL      Y R  AY  SKLAN+L  R LAK LQ  GV   ++HPGVV +EL+R+   +  L     +F+  +KT  EG+QTS+ CA+   L  LSG+YFSDC+     + + +++  AE LW  S +
Sbjct:   22 IRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVDTK--NSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHIGKIPFHDLQSE-KRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWR---LFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCK-RTWVSPRARNNKTAERLWNVSCE 309          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Human
Match: RDH12 (retinol dehydrogenase 12 [Source:HGNC Symbol;Acc:HGNC:19977])

HSP 1 Score: 213.001 bits (541), Expect = 1.011e-65
Identity = 130/295 (44.07%), Postives = 183/295 (62.03%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            +R +  G +C    ++ GKVV+ITGANTGIG ETA ELA RG  +++ CR+  K  +A +++ + +K   S+V    +DL+  KSI +F + F     +L +LINNAG+MMCPY +T DGFE  +GVNHLGHFLLT  LL+ +K +  +R++ VSS AH  G I   DL      Y R  AY  SKLAN+L  R LAK LQ  GV   ++HPGVV +EL+R+   +  L     +F+  +KT  EG+QTS+ CA+   L  LSG+YFSDC+     + + +++  AE LW  S +
Sbjct:   22 IRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVDTK--NSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHIGKIPFHDLQSE-KRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWR---LFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCK-RTWVSPRARNNKTAERLWNVSCE 309          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Celegans
Match: dhs-22 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q9XVS9])

HSP 1 Score: 177.948 bits (450), Expect = 1.855e-52
Identity = 118/306 (38.56%), Postives = 175/306 (57.19%), Query Frame = 2
Query:  149 LYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMM-CPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHG-LINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFG---VAVVSLHPGVVSTELIR----YLPGIEYLEYARPVFN-FLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            L++ R Y KG   + +    G V ++TG+N GIG ET  EL  R   ++M CR+++K   A+ ++L++   D +++     DL   +S+    K+   S   +D+LINNAGIM    + +T+DG E     NHLG FLLT   L  +K +  +RII VSSR HL    IN   ++ +  ++G + +Y QSKLAN++HAR L K L+  G   V V SLHPGVV+TEL R      PGI+ +     VF  FLMKT  +G+QTS+  A+   +  +SG+YF+DC+ +   N    DD   + L+ +S
Sbjct:   26 LFFTRRYFKGGQFNERVSAKGLVAVVTGSNCGIGFETVRELNLRKADVYMLCRSEEKANEAK-RMLVRQGCDATRLHFIECDLTDFESVRRAAKETLESTDTIDILINNAGIMFQSKHEQTKDGHEKTWQSNHLGPFLLTELFLPAVKKSSYARIINVSSRIHLKSEKINLATVDDK-KSFGMMKSYRQSKLANVMHARALTKELRKDGAEHVTVNSLHPGVVNTELARNTILNTPGIKQIT---AVFRWFLMKTSRDGAQTSIFLALGKKIGGISGKYFADCK-LTQENPLALDDQACQDLYNYS 325          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Celegans
Match: dhs-22 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q9XVS9])

HSP 1 Score: 177.948 bits (450), Expect = 1.855e-52
Identity = 118/306 (38.56%), Postives = 175/306 (57.19%), Query Frame = 2
Query:  149 LYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMM-CPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHG-LINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFG---VAVVSLHPGVVSTELIR----YLPGIEYLEYARPVFN-FLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            L++ R Y KG   + +    G V ++TG+N GIG ET  EL  R   ++M CR+++K   A+ ++L++   D +++     DL   +S+    K+   S   +D+LINNAGIM    + +T+DG E     NHLG FLLT   L  +K +  +RII VSSR HL    IN   ++ +  ++G + +Y QSKLAN++HAR L K L+  G   V V SLHPGVV+TEL R      PGI+ +     VF  FLMKT  +G+QTS+  A+   +  +SG+YF+DC+ +   N    DD   + L+ +S
Sbjct:   26 LFFTRRYFKGGQFNERVSAKGLVAVVTGSNCGIGFETVRELNLRKADVYMLCRSEEKANEAK-RMLVRQGCDATRLHFIECDLTDFESVRRAAKETLESTDTIDILINNAGIMFQSKHEQTKDGHEKTWQSNHLGPFLLTELFLPAVKKSSYARIINVSSRIHLKSEKINLATVDDK-KSFGMMKSYRQSKLANVMHARALTKELRKDGAEHVTVNSLHPGVVNTELARNTILNTPGIKQIT---AVFRWFLMKTSRDGAQTSIFLALGKKIGGISGKYFADCK-LTQENPLALDDQACQDLYNYS 325          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Celegans
Match: DC2.5 (pep chromosome:WBcel235:V:210148:212787:-1 gene:WBGene00017082.1 transcript:DC2.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DC2.5)

HSP 1 Score: 129.413 bits (324), Expect = 4.656e-34
Identity = 100/297 (33.67%), Postives = 153/297 (51.52%), Query Frame = 2
Query:  203 IDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLIN-----ETDLNL-----RGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPG-VVSTELIRYLPGIEYLEYARPVFNFL----MKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPME-STNSKV-KDDNLAEFLWKHSTD 1042
            + GK   ITG  +G+G ETA     +G  I M  RN     T +  +L ++   ++++     DL+S+ S+    +++      L  LI NAG++      T D FE   G+NHL HFLL  ELL V++++  SRI+I+SS       IN     E  L         + Y RL  Y +SK+ N+L A  L +     G++V S+HPG  V T L R +P          +FNFL     K   +G+ TS+ CAV+P++ +LSG+Y+  C   E + + KV +D+ L E LW++S +
Sbjct:   43 LSGKTYAITGTTSGVGTETARAFILKGAHIVMINRNYAASETLKQSLLCETP--DARIDIVQCDLSSLASVKKTAEEYLTKKWPLHGLILNAGVLGRKEKTTADRFEAHFGINHLAHFLLIKELLPVLRSSAPSRIVILSSTLSKFTSINPDSKIEEKLGTLCPKNATEWYYRL--YAKSKMCNMLIAFKLHRDEFENGISVYSVHPGSAVRTNLHRDVPFWS-------IFNFLSIPFTKNASQGAATSLYCAVHPEVQELSGRYWESCWDDELNLDEKVARDEELQEALWEYSEE 328          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Celegans
Match: E04F6.15 (pep chromosome:WBcel235:II:7208773:7210287:-1 gene:WBGene00017131.1 transcript:E04F6.15.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:E04F6.15)

HSP 1 Score: 124.79 bits (312), Expect = 1.352e-32
Identity = 94/291 (32.30%), Postives = 148/291 (50.86%), Query Frame = 2
Query:  203 IDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLIN-ETDLNLRGDN---------YGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGV-VSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMEST-NSKV-KDDNLAEFLWKHS 1036
            + GK   ITG  +GIG+ETA  L  +G  + M  RN      ++  +L+++    +++     DL S+ S+     ++      L  LI NAG+       T DGFE   G+NHL HF+L  ELL V++ +  SRI+IV+S    H  +  ++ +  + D          Y RL  Y +SK+ NIL A  L +      ++V ++HPG  V T+L R        ++    F    K   +G+ TS+ CAV+P++ +LSG+Y+  C   E   + KV +D+ L E LW+HS
Sbjct:   26 LSGKTFAITGTTSGIGVETAKALILKGAHVVMINRNYTASEASKKSLLIETP--NAQIDIVQCDLNSLSSVKKAADEYLEQKWPLHGLILNAGVFGPSEKTTSDGFEAHFGINHLAHFILIKELLPVLRESAPSRIVIVTSMLSKHTCVKPDSRIVEKLDTLCPKEATQWYFRL--YAKSKMCNILTAFKLHRDEFKNRISVYAVHPGSGVRTDLHRDFGLWSIADFLSIPFT---KNASQGAATSLYCAVHPEVKELSGKYWESCWDDEKNLDKKVSRDEELQEALWEHS 309          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Celegans
Match: dhs-8 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:U4PLQ0])

HSP 1 Score: 121.709 bits (304), Expect = 2.412e-31
Identity = 91/296 (30.74%), Postives = 151/296 (51.01%), Query Frame = 2
Query:  203 IDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSR-AHLHGL-----INETDLNLRGDN--YGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGV-VSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSK-VKDDNLAEFLWKHSTDHIDSKI 1060
            + GK   ITG  +GIG+ TA  LA  G  + +  RN  +    + ++L   K   +KV     DL+ +K++    + +      +  LI NAG+      +T+DGFE   GVN + HF L   LL V++ +  SR++ +SS  +  HG      I+E    L+G++     L  YG SK+A++L A  L +     G++  S+HPG  V T++ R     +++ +    F    K   +G+ T+V CA +P++ K+SG+Y+  C   +  + K  +D+ L E LWK   + ID +I
Sbjct:   25 VSGKTFAITGTTSGIGINTAEVLALAGAHVVLMNRNLHESENQKKRIL--EKKPSAKVDIIFCDLSDLKTVRKAGEDYLAKNWPIHGLILNAGVFRPAAAKTKDGFESHYGVNVVAHFTLLRILLPVVRRSAPSRVVFLSSTLSSKHGFKKSMGISEKMSILQGEDSSASTLQMYGASKMADMLIAFKLHRDEYKNGISTYSVHPGSGVRTDIFRNSLLGKFIGFVTTPFT---KNASQGAATTVYCATHPEVEKISGKYWESCWDNDKIDKKTARDEELQEALWK-KLEQIDDRI 314          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Fly
Match: CG2064 (gene:FBgn0033205 transcript:FBtr0088923)

HSP 1 Score: 250.751 bits (639), Expect = 1.782e-80
Identity = 144/302 (47.68%), Postives = 198/302 (65.56%), Query Frame = 2
Query:  140 AVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIE---YLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
             VG+Y+L+ Y++G      T   GKV ++TGANTGIG ETA+E+A+RGG +++ CR+  +C  AR  ++ ++  +   +F+  +DL+S+ SI  F   FK    KL VLINNAG+M CP   T+DG+E+Q+GVNH+GHFLLTN LLDV+KN+  SRI++VSS AH  G IN  DLN    +Y    AY QSKLAN+L  R LAK L+  GV V +LHPGVV TEL R     +      + +P+   L+KTP  G+QTS+  A++P+L  +SG YFSDC+P +   S   DD +A+FLW  S
Sbjct:   20 GVGIYFLKEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKET--NNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSE-KSYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSDCKP-KPVASGALDDKVAKFLWAES 317          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Fly
Match: CG2070 (gene:FBgn0033203 transcript:FBtr0088921)

HSP 1 Score: 247.669 bits (631), Expect = 2.202e-79
Identity = 144/303 (47.52%), Postives = 195/303 (64.36%), Query Frame = 2
Query:  137 SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLP--GIEYLE-YARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            SA+G+Y LR Y++G     KT   G+V ++TG N GIG ET +ELA+RG  ++M CR+ +KC  AR +++     +   +F   +DL S+KSI +F   FK    KL +LINNAGIM CP + TEDGFEMQIGVNH+GHFLLT  LLDV+K++  SR++++SS AH  G I   DLN    +Y R  AY QSKLAN+L  R LAK L   GV V +LHPGVV+TEL R  P  G  + +    P+    +KT   G+QT++  A++P L K+SG+YFSDC+     ++   DD+ A+FLW  S
Sbjct:   19 SAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREII--KATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSE-KSYDRKMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNGAQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDD-AQFLWAES 317          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Fly
Match: CG2070 (gene:FBgn0033203 transcript:FBtr0336999)

HSP 1 Score: 247.669 bits (631), Expect = 2.202e-79
Identity = 144/303 (47.52%), Postives = 195/303 (64.36%), Query Frame = 2
Query:  137 SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLP--GIEYLE-YARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            SA+G+Y LR Y++G     KT   G+V ++TG N GIG ET +ELA+RG  ++M CR+ +KC  AR +++     +   +F   +DL S+KSI +F   FK    KL +LINNAGIM CP + TEDGFEMQIGVNH+GHFLLT  LLDV+K++  SR++++SS AH  G I   DLN    +Y R  AY QSKLAN+L  R LAK L   GV V +LHPGVV+TEL R  P  G  + +    P+    +KT   G+QT++  A++P L K+SG+YFSDC+     ++   DD+ A+FLW  S
Sbjct:   19 SAIGIYLLRQYMQGGQFTTKTNETGRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREII--KATNNQNIFARQLDLCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAPSRVVVLSSIAHRFGRIKRDDLNSE-KSYDRKMAYCQSKLANVLFTRELAKRLSGTGVTVNALHPGVVNTELFRNTPFLGSWFGKLLIAPIIWIFIKTARNGAQTTLYAALDPSLEKVSGRYFSDCKQKHVGSAAQYDDD-AQFLWAES 317          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Fly
Match: CG2065 (gene:FBgn0033204 transcript:FBtr0088922)

HSP 1 Score: 235.728 bits (600), Expect = 3.923e-75
Identity = 139/293 (47.44%), Postives = 188/293 (64.16%), Query Frame = 2
Query:  170 LKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYAR----PVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            ++G     +T   GKV ++TGANTGIG ET +E+AKRGG ++M CR+  +C  AR  ++ ++  +   +F+  +DL+S++SI  F   FK    KL VLINNAG+M CP   T+DGFEMQ+GVNH+GHFLLT+ LLDV+K T  SRI+ VSS  H  G I   DLN    +Y R+ AY QSKLAN+L  R LAK L+  GV   SLHPG V TEL R    +++  +A+    P+   L KTP  G+QT++  A++P L  +SG YFSDCQP E  ++  +DD   +FLW  S
Sbjct:    1 MQGGQFTKQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRET--NNQNIFSRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKTAPSRIVNVSSLVHTQGFIKTADLNSE-KSYSRIGAYSQSKLANVLFTRELAKRLEGTGVTTNSLHPGAVDTELSRNWKFLKH-PFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGLYFSDCQPKE-VSAAAQDDKTGKFLWAES 288          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Fly
Match: CG2065 (gene:FBgn0033204 transcript:FBtr0337000)

HSP 1 Score: 235.728 bits (600), Expect = 3.923e-75
Identity = 139/293 (47.44%), Postives = 188/293 (64.16%), Query Frame = 2
Query:  170 LKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYAR----PVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            ++G     +T   GKV ++TGANTGIG ET +E+AKRGG ++M CR+  +C  AR  ++ ++  +   +F+  +DL+S++SI  F   FK    KL VLINNAG+M CP   T+DGFEMQ+GVNH+GHFLLT+ LLDV+K T  SRI+ VSS  H  G I   DLN    +Y R+ AY QSKLAN+L  R LAK L+  GV   SLHPG V TEL R    +++  +A+    P+   L KTP  G+QT++  A++P L  +SG YFSDCQP E  ++  +DD   +FLW  S
Sbjct:    1 MQGGQFTKQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIIRET--NNQNIFSRELDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDVLKKTAPSRIVNVSSLVHTQGFIKTADLNSE-KSYSRIGAYSQSKLANVLFTRELAKRLEGTGVTTNSLHPGAVDTELSRNWKFLKH-PFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSGLYFSDCQPKE-VSAAAQDDKTGKFLWAES 288          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Zebrafish
Match: si:ch211-107o10.3 (si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131-4716])

HSP 1 Score: 240.35 bits (612), Expect = 2.059e-76
Identity = 137/304 (45.07%), Postives = 190/304 (62.50%), Query Frame = 2
Query:  137 SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHI 1048
            + VGL+  R +L G +C  K R+DGK VLITG NTGIG ETA+++AKRG  + + CR+  +   A  ++  + +     V    +DLAS++S+    K  + S  +LD+LINNAG+MMCP   T++GFEMQIGVNHLGHFLLTN LLD++K +  SRI+ V+S AH  G IN  D+N+  D Y    +Y +SKLAN+L  R LA  L+  GV   +LHPGV+ TEL R++    + +     F F  K P++G+QT++ CAV+  L   SG Y+SDC P E T  + +DD  A  LW  S   +
Sbjct:   25 TGVGLFGFRRWLAGGVCRSKARLDGKTVLITGGNTGIGKETAVDMAKRGARVILACRDMSRAHKAAEEI--RKRSGNENVTVKMLDLASLQSVRDLVKDVQQSEQRLDILINNAGVMMCPKWHTDEGFEMQIGVNHLGHFLLTNLLLDLLKKSAPSRIVNVASVAHERGKINFNDINMDKD-YDPYQSYYRSKLANVLFTRELAIKLRDTGVTTYALHPGVIRTELGRHVFSNLWRKLIILPFYFFFKNPWQGAQTTIYCAVDESLKHSSGLYYSDCAPKE-TAPQGRDDVAARRLWDLSASMV 324          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Zebrafish
Match: si:ch211-107o10.3 (si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131-4716])

HSP 1 Score: 240.35 bits (612), Expect = 2.059e-76
Identity = 137/304 (45.07%), Postives = 190/304 (62.50%), Query Frame = 2
Query:  137 SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHI 1048
            + VGL+  R +L G +C  K R+DGK VLITG NTGIG ETA+++AKRG  + + CR+  +   A  ++  + +     V    +DLAS++S+    K  + S  +LD+LINNAG+MMCP   T++GFEMQIGVNHLGHFLLTN LLD++K +  SRI+ V+S AH  G IN  D+N+  D Y    +Y +SKLAN+L  R LA  L+  GV   +LHPGV+ TEL R++    + +     F F  K P++G+QT++ CAV+  L   SG Y+SDC P E T  + +DD  A  LW  S   +
Sbjct:   25 TGVGLFGFRRWLAGGVCRSKARLDGKTVLITGGNTGIGKETAVDMAKRGARVILACRDMSRAHKAAEEI--RKRSGNENVTVKMLDLASLQSVRDLVKDVQQSEQRLDILINNAGVMMCPKWHTDEGFEMQIGVNHLGHFLLTNLLLDLLKKSAPSRIVNVASVAHERGKINFNDINMDKD-YDPYQSYYRSKLANVLFTRELAIKLRDTGVTTYALHPGVIRTELGRHVFSNLWRKLIILPFYFFFKNPWQGAQTTIYCAVDESLKHSSGLYYSDCAPKE-TAPQGRDDVAARRLWDLSASMV 324          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Zebrafish
Match: si:ch211-107o10.3 (si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131-4716])

HSP 1 Score: 239.58 bits (610), Expect = 4.241e-76
Identity = 137/304 (45.07%), Postives = 191/304 (62.83%), Query Frame = 2
Query:  137 SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHI 1048
            + VGL+ LR +L G +C  K R++GK VLITG NTGIG ETA+++AKRG  + + CR+  +   A  ++  + +     V    +DLAS++S+    K  + S  +LD+LINNAG+MMCP   T++GFEMQIGVNHLGHFLLTN LLD++K +  SRI+ V+S AH  G IN  D+N+  D Y    +Y +SKLAN+L  R LA  L+  GV   +LHPGV+ TEL R++    + +     F F  K P++G+QT++ CAV+  L   SG Y+SDC P E T  + +DD  A  LW  S   +
Sbjct:   25 TGVGLFGLRRWLAGGVCRSKARLNGKTVLITGGNTGIGKETAVDMAKRGARVILACRDMSRAHKAAEEI--RKRSGNENVTVKMLDLASLQSVRDLVKDVQQSEQRLDILINNAGVMMCPKWHTDEGFEMQIGVNHLGHFLLTNLLLDLLKKSAPSRIVNVASVAHERGKINFNDINMDKD-YDPYQSYYRSKLANVLFTRELAIKLRDTGVTTYALHPGVIRTELGRHVFSNLWRKLIILPFYFFFKNPWQGAQTTIYCAVDESLKHSSGLYYSDCAPKE-TAPQGRDDVAARRLWDLSASMV 324          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Zebrafish
Match: rdh12l (retinol dehydrogenase 12, like [Source:ZFIN;Acc:ZDB-GENE-040801-48])

HSP 1 Score: 228.024 bits (580), Expect = 4.989e-72
Identity = 141/281 (50.18%), Postives = 185/281 (65.84%), Query Frame = 2
Query:  200 RIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYL--PGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            R+DGK VLITGANTGIG ETAI+LAKRG  I M CR+ +K   A  +V  +       VF  ++DL+  KSI  F +K      ++++LINNAG+M+CPY +T DGFEMQIGVNH+GHFLLT  LLD+IK +  +RII VSS AH  G IN  D+N    NY +  AY QSKLAN+L  R LAK L+  GV   SLHPGVV T+L R+L  P    + + +P      KT  +G+QTS+ CAV+P+L   SG+Y+SDC P ++  + + DD +A+ LW+ S
Sbjct:   16 RLDGKTVLITGANTGIGKETAIDLAKRGARIIMACRDMEKAEAALKEV--KDSSGNQDVFISSLDLSDSKSIRGFAEKINKEEKQVNILINNAGVMVCPYGKTADGFEMQIGVNHMGHFLLTYLLLDLIKRSAPARIINVSSTAHQWGTINLEDINSE-KNYDKQKAYCQSKLANVLFTRSLAKRLEGTGVTAYSLHPGVVQTDLWRHLSKPQQAVMWFTKP----FTKTSVQGAQTSIYCAVDPELQTESGKYYSDCAPAKAAKAAM-DDEVAQRLWELS 288          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Zebrafish
Match: zgc:112332 (zgc:112332 [Source:ZFIN;Acc:ZDB-GENE-050522-387])

HSP 1 Score: 228.024 bits (580), Expect = 5.730e-72
Identity = 134/279 (48.03%), Postives = 178/279 (63.80%), Query Frame = 2
Query:  200 RIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            R+D K V+ITGANTGIG ETA +LA+RG  + M CR+ +K   AR +++  S      +    +DLA  KSI +F +       ++++LINNAGIMMCPY +T DGFEMQ GVNHLGHFLL   LLD++K +  SRI+ V+S AH    I+  D+N     Y    AYGQSKLANIL  R LAK LQ  GV V SLHPGVV +EL R L   +  + A  VF+   KT  +G+QT++ CA+ P+L + SG Y+SDC P + +  +  DD +A+ LW+ S
Sbjct:   17 RLDEKTVIITGANTGIGKETARDLARRGARVIMACRDLEKAEAARRELMDNSA--NQNIVVKKLDLADTKSIKAFAELINKEEKQVNILINNAGIMMCPYSKTADGFEMQFGVNHLGHFLLIYLLLDLLKKSTPSRIVNVASVAHTWSGIHLEDINSE-KVYSPRRAYGQSKLANILCTRSLAKRLQGSGVNVYSLHPGVVQSELFRNLS--KPAQIAFKVFSPFTKTTSQGAQTTIYCAIEPELDRESGGYYSDCGPAQCSR-EASDDEMAQKLWELS 289          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Xenopus
Match: rdh13 (cystatin-like [Source:Xenbase;Acc:XB-GENE-990109])

HSP 1 Score: 237.654 bits (605), Expect = 1.116e-74
Identity = 141/302 (46.69%), Postives = 181/302 (59.93%), Query Frame = 2
Query:  146 GLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYAR----PVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHST 1039
            G   L+ Y  G  C  K  I G+ V++TGANTGIG ETA+ELAKRGG I M CR+  KC  A   +  + K     VF   +DLAS KSI  F K   +   ++DVLINNA +M CP+ +TED FEMQ GVNHLGHFLLTN LL+ +K +E SRII VSS AH+ G I+  DLN     Y   +AY QSKLAN+L    LAK LQ   +   SLHPGV  TEL R+  G+    ++     P+F FL+K+P + +Q SV  AV  +L  +SG+YF+  +  E     + D+  A  LW+ S 
Sbjct:   17 GAILLKDYTGGGNCPSKASIIGQTVIVTGANTGIGKETALELAKRGGRIIMACRDMGKCENAARDI--RGKTLNHNVFARHLDLASSKSIKEFAKTIINEEERVDVLINNAAVMRCPHWKTEDNFEMQFGVNHLGHFLLTNLLLEKMKRSENSRIINVSSLAHIAGDIDFDDLNWEKKKYNTKAAYCQSKLANVLFTNELAKRLQGTKLTANSLHPGVADTELGRH-TGMHQSAFSSTILAPLFWFLVKSPKQAAQPSVYLAVAENLQGVSGKYFNALKEKEPAPQAL-DEESARKLWEESA 314          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Xenopus
Match: stat3.1 (signal transducer and activator of transcription 3, gene 1 [Source:Xenbase;Acc:XB-GENE-481047])

HSP 1 Score: 183.341 bits (464), Expect = 3.228e-54
Identity = 123/280 (43.93%), Postives = 173/280 (61.79%), Query Frame = 2
Query:  209 GKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFL----MKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            GK V+ITGAN GIG  TA EL K+   + + CR+Q +   A  + L +   +  ++    +DL S++S+  F ++      +LDVLINNAG+  CPY +TEDGFEMQ GVNHLGHFLLT+ LL ++K++  SRI++VSS+ + +G IN  DLN    +Y R   Y +SKLANIL  R LA  L+  GV V +LHPG+V T L R++  I  L   +P+FN +     K+P EG+QTS+  A +P++  +SG YF + +  E    K  DD +A  LW  S
Sbjct:   42 GKTVIITGANCGIGKATAAELVKQEARVILACRDQGRAEEAAAE-LRREAGERGEIVIKQLDLGSLQSVRRFCQEVLKEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTHHLLGLLKSSAPSRIVVVSSKLYKYGEINFDDLNSE-KSYSRSFGYSRSKLANILFTRELASRLEGTGVTVNALHPGIVRTNLGRHI-NIPIL--IKPLFNVVSWAFFKSPEEGAQTSIYLASSPEVEGVSGSYFGNSKE-EELLPKAMDDLVARKLWDIS 315          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Xenopus
Match: dhrs13 (dehydrogenase/reductase (SDR family) member 13 [Source:NCBI gene;Acc:394935])

HSP 1 Score: 171.4 bits (433), Expect = 1.059e-49
Identity = 117/303 (38.61%), Postives = 176/303 (58.09%), Query Frame = 2
Query:  140 AVGLYYLRLY--LKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNY-GRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPG-IEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
             +G Y L  +  ++G  C     + GK V++TGAN GIG  TA+++AKRG  + + CR ++    A   +   S    ++V    +DLAS++S+ SF + F  S  +LD+LINNAG  +  + +T +G+ +  GVNHLGHFLLT+ LLD +K +  SRI++++S AH  G I+   +++  ++    L +Y  SKL N+L AR LA  LQ   V   S+HPG V T L R LP  I+ L    PV    ++TP  G+QTS+ CAV   +   SG+YF +CQ +       +DD +A+ LW+ S
Sbjct:   11 GIGAYILIYFNLIRGRQCRSDASLKGKTVIVTGANVGIGKMTALDMAKRGARVILACRVKETGEAAAYDIRKLS--GNNQVVFMKLDLASLESVRSFCRAFLSSEPRLDILINNAG--LSGFGKTAEGYNIVFGVNHLGHFLLTSLLLDRLKQSTPSRIVVLASYAHEWGKIDFNKISVPSEHVKDTLQSYCDSKLCNVLFARELANRLQGTSVTCYSVHPGTVHTNLARSLPSWIKVL--IEPVSWLFLRTPMNGAQTSIYCAVQEGIEMYSGRYFDNCQ-VRQVKPHARDDAVAKKLWEVS 306          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Xenopus
Match: ENSXETT00000010671.1 (retinol dehydrogenase 14-like [Source:NCBI gene;Acc:100497142])

HSP 1 Score: 154.836 bits (390), Expect = 2.675e-43
Identity = 108/296 (36.49%), Postives = 168/296 (56.76%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYL--ETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPG-VVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            LR   +  +C    R+DGK VLITG  +GIG ETAI LAKRG  + +   +++K  TA  Q+  +S     K+    +++A+++SI  F K F     +LD+LINNAG+   P +   T++GF M  GVNHLG FLLT+ L + +K+   SR+I V+S  H +  ++  DLN    N   L +Y +SKLAN+   + LA+ ++  GV   ++HPG VV     ++      + Y      F+  +  EG+Q+ + CAV+ D+ + +G YFSDC+P +      +D  +A+ LW+ S
Sbjct:   38 LRRLKRKRVCLDPKRLDGKTVLITGGTSGIGKETAIALAKRGARVIITNEDEEKGDTALRQIKRESVSMNVKIMR--LNMANLQSIREFCKDFVQKEKRLDILINNAGV---PAVLDWTDNGFSMCFGVNHLGTFLLTSLLTERLKSCSPSRVITVTSEVHKYQRLDFADLNY---NIVPLFSYCRSKLANVYFTQELARQIERHGVTSCAVHPGYVVGDWTSKFSVLFRIVMYVISSMFFI--SCLEGAQSVIHCAVSDDILQHNGGYFSDCKPCK-LRPHAQDTGIAKKLWEVS 322          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Xenopus
Match: runx1 (RUNX family transcription factor 1 [Source:Xenbase;Acc:XB-GENE-483164])

HSP 1 Score: 129.798 bits (325), Expect = 1.608e-33
Identity = 98/253 (38.74%), Postives = 144/253 (56.92%), Query Frame = 2
Query:  203 IDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINET----DLNLRG---DNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPG-VVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLH 937
            + GKVV++TGANTGIG ETA  LA  G ++ + CRN QK   A++++L   +  ++KV   ++DLAS++S+ SF + FK     L VLI NA  +  P+  TEDG EM   VNHLGHF L + L DV++ +  SR+++VSS +H    I ++    DLNL      +Y  + AY +SKL NIL ++ L + L P GV   ++HPG ++ + + R   G   L        F +  P+    T   C   PD+H
Sbjct:  122 LSGKVVIVTGANTGIGFETARSLALHGTLVILACRNLQKGNEAKHKIL--EEWHKAKVEVMSLDLASLRSVQSFAEAFKSRNLALHVLICNAAYLGGPWQLTEDGLEMTFQVNHLGHFYLVSLLQDVLQRSIPSRVVVVSSESHRFTEIKDSSGKLDLNLLSPLKKDYWAMLAYNRSKLCNILFSKELNRRLSPHGVTSNAVHPGNMMYSSIHRNWWGYTLL--------FALVRPF----TKSMCIKYPDVH 360          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Mouse
Match: Rdh12 (retinol dehydrogenase 12 [Source:MGI Symbol;Acc:MGI:1925224])

HSP 1 Score: 216.853 bits (551), Expect = 1.984e-67
Identity = 133/297 (44.78%), Postives = 186/297 (62.63%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIR--YLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            +R +  G +C    +I GKVV+ITGANTGIG ETA ELA+RG  +++ CR+  K  +A +++   +K   S+V    +DL+  KSI +F ++F     KL +LINNAG+MMCPY +T DGFE   GVNHLGHFLLT  LL+ +K +  +R++ +SS AHL G I   DL  +   Y    AYG SKLAN+L  R LAK LQ  GV   ++HPGVV +E+ R  YL  + +      +F+   K+  +G+QTS+ CA+  DL  LSG+YFSDC+ M   +S+ ++   AE LW  S +
Sbjct:   22 IRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTK--NSQVLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFHDLQGQ-KRYCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITRNSYLLCLLW-----RLFSPFFKSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMW-VSSRARNKKTAERLWNVSCE 309          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Mouse
Match: Rdh11 (retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MGI:102581])

HSP 1 Score: 211.846 bits (538), Expect = 1.127e-65
Identity = 134/296 (45.27%), Postives = 182/296 (61.49%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDN-YGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            LR  L   +C    ++ GKV ++TGANTGIG ETA +LA+RG  +++ CR+  K   A  ++  Q+    S+VF   +DLA  KSI +F K F      L +LINNAG+MMCPY +T DGFEM IGVNHLGHFLLT+ LL+ +K +  SRI+ +SS  H  G I+    NL+G+  Y    AY  SKLANIL  + LAK L+  GV   S+HPG V +EL RY   + +L     +F   +KTP EG+QTS+ CA+   L  LSG +FSDCQ +   + + +++ +A  LW  S D
Sbjct:    5 LRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAREI--QAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFH--NLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMRWL---WQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQ-LAWVSYQGRNEIIARRLWDVSCD 292          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Mouse
Match: Rdh11 (retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MGI:102581])

HSP 1 Score: 211.075 bits (536), Expect = 3.508e-65
Identity = 133/296 (44.93%), Postives = 182/296 (61.49%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDN-YGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            +R  L   +C    ++ GKV ++TGANTGIG ETA +LA+RG  +++ CR+  K   A  ++  Q+    S+VF   +DLA  KSI +F K F      L +LINNAG+MMCPY +T DGFEM IGVNHLGHFLLT+ LL+ +K +  SRI+ +SS  H  G I+    NL+G+  Y    AY  SKLANIL  + LAK L+  GV   S+HPG V +EL RY   + +L     +F   +KTP EG+QTS+ CA+   L  LSG +FSDCQ +   + + +++ +A  LW  S D
Sbjct:   21 IRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAREI--QAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFH--NLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMRWL---WQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQ-LAWVSYQGRNEIIARRLWDVSCD 308          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Mouse
Match: Rdh13 (retinol dehydrogenase 13 (all-trans and 9-cis) [Source:MGI Symbol;Acc:MGI:1918732])

HSP 1 Score: 211.46 bits (537), Expect = 4.960e-65
Identity = 131/302 (43.38%), Postives = 182/302 (60.26%), Query Frame = 2
Query:  146 GLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYA----RPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHST 1039
            G   L+ Y+ G  C  K  I GK V++TGANTGIG +TA+ELAKRGG + + CR+ +KC  A   +  + +    +V    +DLAS+KSI  F +K      ++D+L+NNA +M CP+  TEDGFEMQ GVN+LGHFLLTN LLD +K +  SRII +SS AH+ G I+  DLN +   Y   +AY QSKLA +L  + L+  LQ  GV V +LHPGV  TEL R+  G+    ++     P F  L K+P   +Q S   AV  +L  +SG+YF D    ++ + + +D+ +A  LW  S 
Sbjct:   17 GTVLLKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDMEKCEVAAKDI--RGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCPHWTTEDGFEMQFGVNYLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFEDLNWQMKKYDTKAAYCQSKLAVVLFTKELSHRLQGSGVTVNALHPGVARTELGRHT-GMHNSAFSGFMLGPFFWLLFKSPQLAAQPSTYLAVAEELENVSGKYF-DGLREKAPSPEAEDEEVARRLWTESA 314          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Mouse
Match: Rdh14 (retinol dehydrogenase 14 (all-trans and 9-cis) [Source:MGI Symbol;Acc:MGI:1920402])

HSP 1 Score: 207.223 bits (526), Expect = 2.247e-63
Identity = 129/285 (45.26%), Postives = 179/285 (62.81%), Query Frame = 2
Query:  209 GKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQV---LLQS-----KVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFL----MKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLW 1027
            GK VLITGAN+G+G  TA EL + G  + MGCR++ +   A  Q+   L Q+        + ++    +DLAS++S+ +F ++      +LDVLINNAG+  CPY +TEDGFEMQ GVNHLGHFLLTN LL ++K++  SRI++VSS+ + +G IN  DLN    +Y +   Y +SKLANIL  R LA+ L+   V V  LHPG+V T L R+   I     ARP+FN +     KTP EG+QTS+  A +PD+  +SG+YF DC+  E    K  D+++A  LW
Sbjct:   44 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRQELCQAGGAGPDGTDGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFHCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGEINFEDLNSE-QSYNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRH---IHIPLLARPLFNLVSWAFFKTPLEGAQTSIYLACSPDVEGVSGRYFGDCKE-EELLPKAMDESVARKLW 323          
BLAST of retinol dehydrogenase 13-like vs. UniProt/SwissProt
Match: sp|Q8NBN7|RDH13_HUMAN (Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 GN=RDH13 PE=1 SV=2)

HSP 1 Score: 218.009 bits (554), Expect = 7.919e-67
Identity = 136/313 (43.45%), Postives = 188/313 (60.06%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYAR----PVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQNIL 1084
            L+ Y+ G  C  K  I GK V++TGANTGIG +TA+ELA+RGG I + CR+ +KC  A   +  + +     V    +DLAS+KSI  F  K      ++D+LINNAG+M CP+  TEDGFEMQ GVNHLGHFLLTN LLD +K +  SRII +SS AH+ G I+  DLN +   Y   +AY QSKLA +L  + L++ LQ  GV V +LHPGV  TEL R+  GI    ++     P+F  L+K+P   +Q S   AV  +L  +SG+YF D    ++   + +D+ +A  LW  S   +  +  S+ +  L
Sbjct:   21 LKDYVTGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKDI--RGETLNHHVNARHLDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVARTELGRHT-GIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYF-DGLKQKAPAPEAEDEEVARRLWAESARLVGLEAPSVREQPL 329          
BLAST of retinol dehydrogenase 13-like vs. UniProt/SwissProt
Match: sp|Q8BYK4|RDH12_MOUSE (Retinol dehydrogenase 12 OS=Mus musculus OX=10090 GN=Rdh12 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 1.388e-66
Identity = 133/297 (44.78%), Postives = 186/297 (62.63%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIR--YLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            +R +  G +C    +I GKVV+ITGANTGIG ETA ELA+RG  +++ CR+  K  +A +++   +K   S+V    +DL+  KSI +F ++F     KL +LINNAG+MMCPY +T DGFE   GVNHLGHFLLT  LL+ +K +  +R++ +SS AHL G I   DL  +   Y    AYG SKLAN+L  R LAK LQ  GV   ++HPGVV +E+ R  YL  + +      +F+   K+  +G+QTS+ CA+  DL  LSG+YFSDC+ M   +S+ ++   AE LW  S +
Sbjct:   22 IRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRADTK--NSQVLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSKTTDGFETHFGVNHLGHFLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFHDLQGQ-KRYCSAFAYGHSKLANLLFTRELAKRLQGTGVTAYAVHPGVVLSEITRNSYLLCLLW-----RLFSPFFKSTSQGAQTSLHCALAEDLEPLSGKYFSDCKRMW-VSSRARNKKTAERLWNVSCE 309          
BLAST of retinol dehydrogenase 13-like vs. UniProt/SwissProt
Match: sp|Q8TC12|RDH11_HUMAN (Retinol dehydrogenase 11 OS=Homo sapiens OX=9606 GN=RDH11 PE=1 SV=2)

HSP 1 Score: 215.312 bits (547), Expect = 6.410e-66
Identity = 132/297 (44.44%), Postives = 188/297 (63.30%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKC-LTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDN-YGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            +R  L   +C    ++ GKVV++TGANTGIG ETA ELA+RG  +++ CR+ +K  L A+    +Q+     +V    +DL+  KSI +F K F      L VLINNAG+MMCPY +T DGFEM IGVNHLGHFLLT+ LL+ +K +  SRI+ VSS AH  G I+    NL+G+  Y    AY  SKLANIL  + LA+ L+  GV   S+HPG V +EL+R+   + ++ +   +F+F +KTP +G+QTS+ CA+   L  LSG +FSDC  +   +++ +++ +A  LW  S D
Sbjct:   24 IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKE---IQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFH--NLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWW---LFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCH-VAWVSAQARNETIARRLWDVSCD 311          
BLAST of retinol dehydrogenase 13-like vs. UniProt/SwissProt
Match: sp|Q96NR8|RDH12_HUMAN (Retinol dehydrogenase 12 OS=Homo sapiens OX=9606 GN=RDH12 PE=1 SV=3)

HSP 1 Score: 213.001 bits (541), Expect = 4.853e-65
Identity = 130/295 (44.07%), Postives = 183/295 (62.03%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            +R +  G +C    ++ GKVV+ITGANTGIG ETA ELA RG  +++ CR+  K  +A +++ + +K   S+V    +DL+  KSI +F + F     +L +LINNAG+MMCPY +T DGFE  +GVNHLGHFLLT  LL+ +K +  +R++ VSS AH  G I   DL      Y R  AY  SKLAN+L  R LAK LQ  GV   ++HPGVV +EL+R+   +  L     +F+  +KT  EG+QTS+ CA+   L  LSG+YFSDC+     + + +++  AE LW  S +
Sbjct:   22 IRKFFAGGVCRTNVQLPGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESAASEIRVDTK--NSQVLVRKLDLSDTKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSAPARVVNVSSVAHHIGKIPFHDLQSE-KRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWR---LFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCK-RTWVSPRARNNKTAERLWNVSCE 309          
BLAST of retinol dehydrogenase 13-like vs. UniProt/SwissProt
Match: sp|Q9QYF1|RDH11_MOUSE (Retinol dehydrogenase 11 OS=Mus musculus OX=10090 GN=Rdh11 PE=1 SV=2)

HSP 1 Score: 211.075 bits (536), Expect = 2.454e-64
Identity = 133/296 (44.93%), Postives = 182/296 (61.49%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDN-YGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            +R  L   +C    ++ GKV ++TGANTGIG ETA +LA+RG  +++ CR+  K   A  ++  Q+    S+VF   +DLA  KSI +F K F      L +LINNAG+MMCPY +T DGFEM IGVNHLGHFLLT+ LL+ +K +  SRI+ +SS  H  G I+    NL+G+  Y    AY  SKLANIL  + LAK L+  GV   S+HPG V +EL RY   + +L     +F   +KTP EG+QTS+ CA+   L  LSG +FSDCQ +   + + +++ +A  LW  S D
Sbjct:   21 IRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAREI--QAVTGNSQVFVRKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFH--NLQGEKFYSAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRYSSIMRWL---WQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQ-LAWVSYQGRNEIIARRLWDVSCD 308          
BLAST of retinol dehydrogenase 13-like vs. TrEMBL
Match: A0A336MUF0 (CSON005967 protein OS=Culicoides sonorensis OX=179676 GN=CSON005967 PE=3 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 4.735e-85
Identity = 154/302 (50.99%), Postives = 207/302 (68.54%), Query Frame = 2
Query:  143 VGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLP-GIEYLEYA---RPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            V +Y  RLY++G       RIDGKVV+ITGANTGIG ETAIELAKRGG I++ CR+ ++   A+ +++   K   S+VF   +DL S +SI  F K+F  +  KLD+LINNAGIM CP + T+DGFEMQ G NHLGHFLLTN LL+ +K +  SRI+ VSS AHL+G IN+ D+N    +Y  ++AY QSKLAN++  R LAK L+  GV V SLHPGV+STEL R+L  GI ++  +   RP+ N   KTP  G+QT++ CA++PDL   +G+Y+S+C+ ++  N    DD L E+LW  S
Sbjct:   18 VVIYLYRLYIQGASYKKNNRIDGKVVIITGANTGIGKETAIELAKRGGKIYLACRDPKRASEAQKEII--EKSGSSEVFVEILDLTSFESIKDFAKRFLSNEEKLDILINNAGIMACPKMLTKDGFEMQFGTNHLGHFLLTNLLLNQLKKSAPSRIVNVSSMAHLYGKINKIDINSE-KSYNSVTAYSQSKLANVMFTRELAKRLEGTGVTVYSLHPGVISTELTRHLSDGIFFIFQSWLIRPLQNMFNKTPKAGAQTTIYCAIDPDLQNETGKYYSECK-IDKVNPIALDDELCEWLWNTS 315          
BLAST of retinol dehydrogenase 13-like vs. TrEMBL
Match: A0A1S3JRW8 (retinol dehydrogenase 13 OS=Lingula unguis OX=7574 GN=LOC106175350 PE=3 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 5.571e-84
Identity = 149/305 (48.85%), Postives = 197/305 (64.59%), Query Frame = 2
Query:  140 AVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDES--KVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYL----PGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            A  +  ++ Y  G +C    R+DGK V+ITGANTGIG ETAI+LAKRG  + + CR+ +K   A  +V   S V ES   V  H +DLAS+KS+     +      K+D+LINNAG+MMCPY +TEDGFEMQ G NHLGHFLLTN LLD IK +  SRI+ V+SRAH  G +N  DL +    Y  + AYGQSKLANIL  R LA+ L+  GV+  ++HPG V TEL R+L    P  EYL +  PV   L+KTP +G+QTS+ C+V  +L  +SG+Y+SDC  +E +     +D+ A+ LW+ S
Sbjct:   15 AAAVLLIKCYTGGGICRSTARLDGKTVVITGANTGIGKETAIDLAKRGARVILACRDMKKGQQALEEV---SNVSESPNSVVLHHLDLASLKSVRKCADEILKKEEKIDILINNAGVMMCPYTKTEDGFEMQFGTNHLGHFLLTNLLLDRIKASAPSRIVNVASRAHEMGEMNFADL-MGEKGYSSVKAYGQSKLANILFTRELARRLEGCGVSTYAVHPGAVKTELGRHLFLSHPIFEYLLF--PVIWLLLKTPKQGAQTSIYCSVAEELDGISGKYYSDCAELEPSRRAQNEDD-AKKLWEIS 312          
BLAST of retinol dehydrogenase 13-like vs. TrEMBL
Match: B3MHS1 (Uncharacterized protein OS=Drosophila ananassae OX=7217 GN=Dana\GF13190 PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 2.136e-83
Identity = 152/301 (50.50%), Postives = 201/301 (66.78%), Query Frame = 2
Query:  143 VGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLP--GIEYLEY-ARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            + LY +R Y++G     KT   GKVV++TG NTGIG ET +ELA RG  ++M CRN  KC  AR +++         +F+  +DL+S+ SI SF  +F    +KL +LINNAGIM CP + T+DGFEMQIGVNH+GHFLLT  LLDV+K T  SRI++VSS AH  G I + DLN    +Y R  AY QSKLAN+L  R LAK L   GV V +LHPGVV TELIRY+   G + +++ +RPV+    KTP  G+QT++  A++P L  +SGQYFSDC+P  S  S  K++ +A+FLW+ S
Sbjct:   21 IALYLIRHYVQGRQFTKKTDETGKVVIVTGCNTGIGKETVLELAHRGATVYMACRNMVKCEEARKEII--KATGNRNIFSSQLDLSSMASIRSFATRFMSEESKLHILINNAGIMDCPRMLTKDGFEMQIGVNHMGHFLLTLLLLDVLKATAPSRIVVVSSLAHRFGTIKQHDLNSE-KSYSRKFAYAQSKLANVLFTRELAKRLTGSGVTVNALHPGVVDTELIRYMRFFGWKIIKFISRPVYWVFFKTPKSGAQTTLFAALDPKLENVSGQYFSDCKPT-SVGSNAKNEKVAKFLWEES 317          
BLAST of retinol dehydrogenase 13-like vs. TrEMBL
Match: A0A1W4VZG7 (retinol dehydrogenase 13-like OS=Drosophila ficusphila OX=30025 GN=LOC108101602 PE=3 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 4.059e-83
Identity = 149/298 (50.00%), Postives = 195/298 (65.44%), Query Frame = 2
Query:  152 YYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIR---YLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            Y+LR Y++G     +T   GKV ++TGANTGIG ET +E+AKRGG ++M CR+  +C  AR  ++ +S  + S +F   +DL+S+ S+  F   FK    KL VLINNAG+M CP   T++G EMQ+GVNH+GHFLLT+ L+DV+K T  SRII VSS AH  G IN  DLN    +Y R+ AY QSKLAN+L  R LAK L+  GV V SLHPGVV TEL+R    L  I      +P+   L+KTP  G+QTS+  A++PDL  +SG YFSDC+P +   +  KDDN  +FLW  S
Sbjct:   47 YFLRKYMQGGQFTKQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDIVRES--NNSNIFARELDLSSLDSVRKFAAGFKKEQDKLHVLINNAGVMHCPKTLTKEGIEMQLGVNHIGHFLLTHLLMDVLKETAPSRIINVSSLAHTQGTINIGDLNSE-KSYSRIDAYSQSKLANVLFTRELAKRLEGTGVTVNSLHPGVVDTELLRNWKILQNIFVQLLVKPLQWTLLKTPKNGAQTSLYAALDPDLKVVSGLYFSDCKPKDVAPA-AKDDNTGKFLWAES 340          
BLAST of retinol dehydrogenase 13-like vs. TrEMBL
Match: A0A553NB65 (Uncharacterized protein OS=Tigriopus californicus OX=6832 GN=TCAL_07957 PE=3 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 1.242e-82
Identity = 146/317 (46.06%), Postives = 202/317 (63.72%), Query Frame = 2
Query:  140 AVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPG----IEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQN 1078
            AV +Y+LR + KG +C  + R+DG+ V+ITG N GIG ETA++L++RG  + M CRN +    A + +    +  +  V  +  DLA++KS+  F ++      ++DVLINNAG+MMCPY +TEDGFEMQIG NHLGHFLLTN LLD IK +  +RI+ VSSRAH  G ++  DL      Y  ++AYGQSKLAN+L +  LA+ L   GV   SLHPGVV TEL R++      ++YL Y      F MK   EG+QTS+ CAV   L + SG+YFSDC+  E+     KD+ LA+ LW+     + SK+ +LN++
Sbjct:   16 AVSVYFLREWFKGGVCTSQARMDGQTVVITGCNVGIGKETALDLSQRGAKVVMACRNLELAHKAADDI---RQATQGNVVVYQCDLANLKSVRRFAQEVNEKEERIDVLINNAGVMMCPYSKTEDGFEMQIGTNHLGHFLLTNLLLDKIKASAPARIVHVSSRAHERGQMDLDDLQWEKKKYNSMNAYGQSKLANVLFSNELARRLHGTGVTSNSLHPGVVKTELGRHIEAAIGPLKYLLYFFVF--FFMKNAKEGAQTSIHCAVEETLKEESGKYFSDCKEKEA-QPLAKDEGLAKRLWE-----LSSKLVNLNES 321          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Cavefish
Match: rdh12l (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:103044420])

HSP 1 Score: 248.054 bits (632), Expect = 8.733e-80
Identity = 143/297 (48.15%), Postives = 187/297 (62.96%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYL----PGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            LR Y K        ++DGK VLITGANTGIG ETAI+LAKRG  I M CR+ +K   A  +V+  S      V T  +DLA  KSI  F +       ++++LINNAG+M+CPY +T DGFEMQIGVNH+GHFLLT  L+D+IK +  +RI+ VSS AH  G IN  D+N    +Y +  AY QSKLAN+L  R LAK L   GV V  LHPGVV TEL R+L     G+ ++   +P      KT  +G+QT++ CAV P+L   SG+Y+SDC P   +N+ + DD++A+ LW  S
Sbjct:    4 LRNYFKP--WSSSAKLDGKTVLITGANTGIGKETAIDLAKRGARIIMACRDMEKADGALKEVIEAS--GNQDVVTKKLDLADTKSIREFAQMINSEEKQVNILINNAGVMVCPYGKTADGFEMQIGVNHMGHFLLTFLLMDLIKKSSPARIVNVSSMAHKWGTINIDDINSE-KSYDKSKAYSQSKLANVLFTRCLAKHLDGTGVTVYVLHPGVVQTELWRHLNRAQQGVMWM--VKP----FTKTSVQGAQTTIYCAVAPELETESGKYYSDCAPASCSNAAM-DDDMAKRLWDLS 288          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Cavefish
Match: zgc:153441 (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:103027802])

HSP 1 Score: 231.876 bits (590), Expect = 4.484e-73
Identity = 146/337 (43.32%), Postives = 197/337 (58.46%), Query Frame = 2
Query:   41 YLPDFQFFKELVS*I*KKYKMNXXXXXXXXXXSAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFN--------FLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLW 1027
            YL   Q ++EL S    KY         +T  +A+ L  LR ++ G +CH   R+DG+ V+ITGANTGIG ETA +LAKRG  + M CR+  +   A  ++  +       V    +DLAS  S+  F  ++  +  +LD+LINNAG+MMCP+  TEDG+E Q  VNHLGHFLLT  LLD++KN+  SRII VSS AH  G I+  DLN     Y  L +Y QSKLAN+L  R L++ ++  GV   ++HPGV+ TEL R      Y+E   PV +         LMKTP +G+QT++ C +   L K +G YFSDC+ ME    + KDD  A  LW
Sbjct:    4 YLSAAQLWEELKSNHLAKY-------GAVTAATAISLVLLRKWIAGGVCHSHVRLDGRTVVITGANTGIGKETARDLAKRGARVVMACRDLTRAEKAAAEI--RRSTGNGNVVVRHLDLASFFSVRQFAHEYISTEDRLDILINNAGVMMCPHSLTEDGYETQFAVNHLGHFLLTVLLLDMLKNSTPSRIINVSSIAHKGGKIHFDDLNFNKTPYNSLISYRQSKLANVLFTRELSRRIKGSGVTAFAVHPGVIRTELGR------YVEMRHPVVSTLLSLPAILLMKTPKQGAQTTIYCTITEGLEKYNGCYFSDCRMMEPA-LEAKDDLAAMRLW 324          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Cavefish
Match: zgc:112332 (zgc:112332 [Source:ZFIN;Acc:ZDB-GENE-050522-387])

HSP 1 Score: 229.565 bits (584), Expect = 1.334e-72
Identity = 134/284 (47.18%), Postives = 179/284 (63.03%), Query Frame = 2
Query:  200 RIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHID 1051
            R+DGK V+ITGANTGIG ETA +LAKRG  + + CR+ +K   AR +++  S      +    +DL+  KSI  F         +L++LINNAGIMMCPYL+T DGFEMQ GVNHLGHFLLT  LLD++K +  +RI+ V+S AH  G I   D+N    +Y    AYGQSKLANIL  R LAK L+  GV V SLHPGVV ++L R L   + ++ A  +     K+  +G+QTS+ C+V P L + SG Y+SDC P   +  +  DD +A+ LW+ S   +D
Sbjct:   16 RLDGKTVIITGANTGIGKETARDLAKRGARVILACRDVEKAEAARKELVEDS--GNPNIVAKEMDLSDTKSIKEFADIINTEEKQLNILINNAGIMMCPYLKTADGFEMQFGVNHLGHFLLTYLLLDLLKRSAPARIVNVASVAHTWGSIRLDDINSE-KSYAPRRAYGQSKLANILFTRSLAKRLKGTGVTVYSLHPGVVRSDLWRNLS--KPIQAAVKILTPFSKSTTQGAQTSIYCSVEPQLERESGGYYSDCAPAICSR-EASDDEMAQKLWELSCHMLD 293          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Cavefish
Match: si:dkey-23o4.6 (retinol dehydrogenase 13-like [Source:NCBI gene;Acc:103040905])

HSP 1 Score: 230.335 bits (586), Expect = 1.362e-72
Identity = 138/303 (45.54%), Postives = 188/303 (62.05%), Query Frame = 2
Query:  137 SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVF--NFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHST 1039
            +AV ++ LRL++ G +C  K R+DGK VLITG+NTGIG ETA +LA+RG  + M CRN  +         ++  +    V    ++LAS+ S+  F ++F  +  +LD+LINNAG+MMCP   TEDG+EMQ+ VNHLGHFLLTN LL ++KN+  SR++ VSS AH  G I+  DL      Y  L +Y QSKLAN+L ++ LA+ L+  GV+  SLHPG++ TE+ R+      L  A        LMKTP++G+QTS+ CAV   L   SG YFSDC   E       DD +A+ LWK S 
Sbjct:   20 TAVCIFLLRLWISGGVCKSKARLDGKTVLITGSNTGIGKETARDLARRGARVVMACRNLAR--AEAAAEEIRRSIGNGNVVVRHLNLASLHSVREFAQEFLATEERLDILINNAGVMMCPKWITEDGYEMQLAVNHLGHFLLTNLLLKMLKNSAPSRVVTVSSIAHGGGNIDFDDLFFDKRPYSSLVSYKQSKLANVLFSKELARRLRGTGVSSYSLHPGIIYTEIGRHWESWYPLVKAILCLPSTLLMKTPWQGAQTSIYCAVTEGLENKSGCYFSDCAEKEPAPLG-NDDKVAQRLWKESA 319          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Cavefish
Match: zgc:112332 (zgc:112332 [Source:ZFIN;Acc:ZDB-GENE-050522-387])

HSP 1 Score: 229.18 bits (583), Expect = 2.024e-72
Identity = 134/284 (47.18%), Postives = 179/284 (63.03%), Query Frame = 2
Query:  200 RIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHID 1051
            R+DGK V+ITGANTGIG ETA +LAKRG  + + CR+ +K   AR +++  S      +    +DL+  KSI  F         +L++LINNAGIMMCPYL+T DGFEMQ GVNHLGHFLLT  LLD++K +  +RI+ V+S AH  G I   D+N    +Y    AYGQSKLANIL  R LAK L+  GV V SLHPGVV ++L R L   + ++ A  +     K+  +G+QTS+ C+V P L + SG Y+SDC P   +  +  DD +A+ LW+ S   +D
Sbjct:   24 RLDGKTVIITGANTGIGKETARDLAKRGARVILACRDVEKAEAARKELVEDS--GNPNIVAKEMDLSDTKSIKEFADIINTEEKQLNILINNAGIMMCPYLKTADGFEMQFGVNHLGHFLLTYLLLDLLKRSAPARIVNVASVAHTWGSIRLDDINSE-KSYAPRRAYGQSKLANILFTRSLAKRLKGTGVTVYSLHPGVVRSDLWRNLS--KPIQAAVKILTPFSKSTTQGAQTSIYCSVEPQLERESGGYYSDCAPAICSR-EASDDEMAQKLWELSCHMLD 301          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Sea Lamprey
Match: rdh14b (retinol dehydrogenase 14b [Source:ZFIN;Acc:ZDB-GENE-030131-6605])

HSP 1 Score: 195.282 bits (495), Expect = 1.480e-59
Identity = 115/282 (40.78%), Postives = 169/282 (59.93%), Query Frame = 2
Query:  203 IDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFL----MKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            + GK V++TGAN G+G  T + LA+ G  + +  R+  +   A  ++  +   +E+++    +DLAS+ S+  F  + +    +LDVL+NNAG+  CPY  TEDGFE Q GVNHLGHFLLT  LL ++  +  SR+++VSS  +  G IN  DL     +Y   +AYG+SKLAN++ AR LA+ L+  GV   +LHPGVV T L R+   +     ARP+FN L     +TP +G++T+V  A +PD+  +SG YF DC+  E       DD +A  LW+ S
Sbjct:   51 MRGKTVVVTGANCGLGRATTLALARLGARVILAVRDSARGEEAAVELRRELGSEEAELVVRELDLASLASVRRFCARLEREEERLDVLVNNAGVFRCPYALTEDGFETQFGVNHLGHFLLTALLLPLLGRSAPSRVVVVSSALYKQGRINFDDLASE-RSYDPAAAYGRSKLANVMFARELARRLRGQGVTANALHPGVVRTNLGRH---VSMPALARPLFNLLAWAAFRTPEQGARTAVFLAASPDVADVSGAYFGDCR-QEELLPVATDDAVAAKLWEVS 327          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Sea Lamprey
Match: RDH13 (retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:HGNC:19978])

HSP 1 Score: 149.058 bits (375), Expect = 5.947e-42
Identity = 98/270 (36.30%), Postives = 152/270 (56.30%), Query Frame = 2
Query:  245 IGLETAIELAKRGGI-IHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYAR----PVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHST 1039
            +G E A  LA R G  + + CR++  C  A  ++  ++    +      +DLAS++S+  F          + +L+NNA +M CP+  T DGFEMQ GVNHLGHFLLTN LLD ++ +  SR++ VSS A +   ++ +DLN     Y    AY  SKLAN+L +  L+K LQ  GV   S++PGV +T L R+  G+    ++     P F  ++++P  G+Q S+  AV+ +L  +SG+YF   + ++   +K  D+ LA  LW+ S 
Sbjct:   48 VGFEGACVLAVRAGARVILACRDEAACEDAAREIRGETL---NPRVARRLDLASLESVRDFAAHINQDEENVHILVNNAAVMRCPHSTTADGFEMQFGVNHLGHFLLTNLLLDKLRASAPSRVVTVSSLAQVAACLDLSDLNWERRKYDPKLAYCDSKLANVLFSLELSKRLQGTGVTANSVNPGVCNTSLGRHT-GMHKSAFSSSVLGPFFWLVVRSPRLGAQPSINLAVSEELRDVSGRYFDGMRQVD-PGTKANDEELARQLWEASA 312          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Sea Lamprey
Match: rdh12l (retinol dehydrogenase 12, like [Source:ZFIN;Acc:ZDB-GENE-040801-48])

HSP 1 Score: 117.472 bits (293), Expect = 5.942e-31
Identity = 90/263 (34.22%), Postives = 132/263 (50.19%), Query Frame = 2
Query:  281 GGIIHMGCRNQQKCLTARNQVLLQSKVD--ESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHG--------LINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQP-FGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            G  + + CR+ +K     N V +  +V+    +V  H +DL++  SI  F ++      KL++LINNAG+M CP+ +T +GFEMQ GVNHLG    T + L   +        + S     +G         I   DL +            +S LA  L A   A+   P  GV V SLHPG V T+L R+L  +  ++    +   L K+P +G+QTS+ CAV  +L  ++G YFSDC P +S +S   DD  A+ LW  S
Sbjct:    1 GARVILACRDVEK----GNAVAVGIRVETHNPQVLVHKLDLSNAASIREFAERINKDEEKLNILINNAGVMTCPFSKTTEGFEMQFGVNHLGKVPSTRQPLTPAQPPLAQTSFVTSGTFGTNGWDFFFLRIFIFNPDLAIE---------LCKSSLAQ-LPAAVSARAPSPGTGVTVNSLHPGSVMTDLQRHLGVVHAMQR---ILWPLSKSPAQGAQTSIHCAVAEELANVTGVYFSDCAP-KSVSSLASDDAAAQKLWALS 245          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Sea Lamprey
Match: dhrsx (dehydrogenase/reductase (SDR family) X-linked [Source:ZFIN;Acc:ZDB-GENE-060620-2])

HSP 1 Score: 104.76 bits (260), Expect = 8.414e-26
Identity = 84/277 (30.32%), Postives = 131/277 (47.29%), Query Frame = 2
Query:  200 RIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWK 1030
            R  G+V ++TG   GIGLET   LA+ G  + +   N+++   A     L+S     KV    +DL S+ S+  F  +F+     L +L+NNAG+M+ P   + D  E  + VN +G FLLT  L    +     R++ VSS  H  G +   D+N   + Y   +AY +SKLA  L +R L +      V  V++ PGVV +EL R+  G  +         FL ++  + +      A  P+L      Y  +   +E   + V+D  L   LW+
Sbjct:   28 RQTGRVAVVTGGGRGIGLETGRRLAELGAHVILASNNEKEGSEAAQA--LRSDTGNDKVDFMHLDLRSLSSVRDFVNRFRSRKLPLHILVNNAGVMLVPLRLSADALEEHLAVNCVGPFLLTALLTGASEGPTPLRVVCVSSATHRAGCLLFHDINC-SERYSSYAAYARSKLALTLWSRQLHEQGGDR-VTSVAVDPGVVDSELYRH-AGAFFRMGQWLTGRFLFRSTRQAAAGVTYAATAPELKGRPWAYLENGHQIEPAQA-VEDAALRTRLWE 298          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003709.1 (pep scaffold:Pmarinus_7.0:GL492885:3043:4555:-1 gene:ENSPMAG00000003392.1 transcript:ENSPMAT00000003709.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 4.985e-18
Identity = 43/93 (46.24%), Postives = 59/93 (63.44%), Query Frame = 2
Query:  767 GVAVVSLHPGVVSTELIRY-LPGIEYLEYA--RPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            GV V SLHPGVV TE+ R+ L G+   + A   P+   L+KTP +G+QTS+ CAV  +L  +SG Y+SDC P +    + KDD+ A  LW+ S
Sbjct:    3 GVTVNSLHPGVVKTEVARHVLAGVAAWKAALLYPIILLLVKTPPQGAQTSIYCAVAEELENVSGLYYSDCAP-KDVAPQGKDDDAARRLWELS 94          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Yeast
Match: ENV9 (Protein proposed to be involved in vacuolar functions; mutant shows defect in CPY processing and defects in vacuolar morphology; has similarity to oxidoreductases, found in lipid particles; required for replication of Brome mosaic virus in S. cerevisiae, a model system for studying replication of positive-strand RNA viruses in their natural hosts [Source:SGD;Acc:S000005772])

HSP 1 Score: 99.7525 bits (247), Expect = 4.799e-24
Identity = 94/311 (30.23%), Postives = 155/311 (49.84%), Query Frame = 2
Query:  203 IDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKV------DESKV---------------FTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAH----LHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPG-VVSTELIRY---LP--GIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDL--HKLSGQYFSDCQPMESTNSKVK---DDNLAEFLW 1027
            ++ K+ ++TG NTGIG  T + L   G ++++  RN  K   A  ++L ++K       D S                 + H +DL  +K +     K       +DVL+NNAGIM  P   T+DGFE+Q+  N++ HF+ T  LL ++++  + RII +SS  H    ++  +++T  + + +       Y  SK A I   + LA I  P  V  +S+HPG V++T L  Y   LP  GI +    + V  F   +  +GS  S+ CA++P+L   K +G+YF+     ES +S V    D+  + ++W
Sbjct:   14 VERKIAVVTGGNTGIGWYTVLHLYLHGFVVYICGRNSHKISKAIQEILAEAKKRCHEDDDGSSPGAGPGPSIQRLGSLHYIH-LDLTDLKCVERAALKILKLEDHIDVLVNNAGIMAVPLEMTKDGFEVQLQTNYISHFIFTMRLLPLLRHC-RGRIISLSSIGHHLEFMYWKLSKT-WDYKPNMLFTWFRYAMSKTALIQCTKMLA-IKYP-DVLCLSVHPGLVMNTNLFSYWTRLPIVGIFFWLLFQVVGFFFGVSNEQGSLASLKCALDPNLSVEKDNGKYFT-TGGKESKSSYVSNNVDEAASTWIW 318          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Yeast
Match: AYR1 (Bifunctional triacylglycerol lipase and 1-acyl DHAP reductase; NADPH-dependent 1-acyl dihydroxyacetone phosphate reductase involved in phosphatidic acid biosynthesis; lipid droplet triacylglycerol lipase involved in the mobilization of non-polar lipids; found in lipid particles, the endoplasmic reticulum and the mitochondrial outer membrane; required for spore germination; role in cell wall biosynthesis; capable of metabolizing steroid hormones; oleic acid inducible [Source:SGD;Acc:S000001386])

HSP 1 Score: 51.9878 bits (123), Expect = 5.357e-8
Identity = 67/228 (29.39%), Postives = 104/228 (45.61%), Query Frame = 2
Query:  212 KVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXX--XXXXXXXXXLDVLINNAGIMMC--PYLETED-GFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELI--RYLP--GIEYLEYARPVFN 868
            K+ ++TGA+ GIG E   ELA+ G +++   R     L    Q+ +Q   D  K   + +D++  + I++F+   +      KLD+L NNAG   C  P L+  D   E    VN  GH  +  EL + +    K  I+   S   L G++          ++   S Y  SK A   +AR L   ++PF V V++   G V+T++   R LP   I      R  FN
Sbjct:   10 KIAVVTGASGGIGYEVTKELARNGYLVYACARR----LEPMAQLAIQFGNDSIK--PYKLDISKPEEIVTFSGFLRANLPDGKLDLLYNNAG-QSCTFPALDATDAAVEQCFKVNVFGHINMCRELSEFLIKA-KGTIVFTGS---LAGVV----------SFPFGSIYSASKAAIHQYARGLHLEMKPFNVRVINAITGGVATDIADKRPLPETSIYNFPEGREAFN 216          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Yeast
Match: PBR1 (Putative oxidoreductase; required for cell viability [Source:SGD;Acc:S000005125])

HSP 1 Score: 46.595 bits (109), Expect = 3.906e-6
Identity = 73/341 (21.41%), Postives = 137/341 (40.18%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANT-GIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSI--LXXXXXXXXXXXXLDVLINNAGIMMCPY----------LETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKS---RIIIVSSRAHLHGLINETDLNLRGDNY-GRLSAYGQSKLANILHARHLAKILQP--------------FGVAVVSLHPGVVSTELIRYL--------PGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLS-----GQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHI 1048
            ++ + +G     + ++ GKV L+TGA + G+G   A ++A+ G  + +  R   + +T   + L + K     +F    DL+++  I   + +        +LD +I  +G M  P+            ++DG E+QI  N++  F L N L    K        RII+ +    + G IN  D   +   Y   L  +  SKL   L    L + L                  V +  + PG + +  +R +          I Y     P+     K+   G Q+ +   + P+L +++      +Y SDC  ++    +  D+ L + L+ ++   I
Sbjct:   36 IKYWSRGPSNTWERKLHGKVYLVTGATSQGMGTSVAYKMAELGAQLIILTREVDEWVTEWCEEL-REKTKNELIFVEKCDLSNLWEIRKFATSWLDNSPPRRLDGVIVMSGDME-PWGIPKISLPQRRSSKDGLELQIATNYVAIFHLLNLLQPSFKAQPPDRDVRIILATCWLQVVGDINIEDPLWQNAKYKSALKFFASSKLQLGLSMMELQRRLTEDIKNQKTNGAERTGKNVTITMVQPGTMRSNSLRRVISNGSVVLLIILYCILLYPILWLFTKSGRRGDQSFLYALMTPELEEVNLKDTKVKYISDCSIVKFARKEFDDEELQKKLFDNTERDI 374          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Nematostella
Match: EDO36070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJM9])

HSP 1 Score: 220.705 bits (561), Expect = 2.098e-69
Identity = 127/295 (43.05%), Postives = 181/295 (61.36%), Query Frame = 2
Query:  152 YYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGD--NYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLE-YARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLW 1027
            Y++R + +G +C  + R+DGK V+ITGA TGIG ETA++LAKRG  + +G RN  +   A   +  Q+     +VF   +DLAS+ S+  F +       ++D+L+NNAG+   P+  TEDGFEM  GVNHL HFLLTN LLD +K +  SRII VSS++HL    +E D     D   Y  LS Y  SKLAN+L AR LAK L+  GV   SLHPG + T+L R +PG ++++ +  P+     K+  +G+QT +CCAV+ +    +G Y+ DCQ  E + +  +DD  A+ LW
Sbjct:   18 YFIREHCQGRVCTSEARLDGKTVIITGATTGIGKETAVDLAKRGARVIIGARNLDRGNAAVRDI--QASSGSQQVFVEHLDLASLSSVRKFAEVINKKEERVDILMNNAGVAWIPFKRTEDGFEMMFGVNHLSHFLLTNLLLDKLKRSAPSRIINVSSKSHL--FTSEIDFVDWNDESKYSMLSRYANSKLANVLFARELAKRLKDTGVTTYSLHPGTIMTDLGRDIPGGKFIKVFLWPIQKVFFKSLEQGAQTQICCAVSEEHANETGLYYDDCQVTEPSKA-AQDDEAAKKLW 307          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Nematostella
Match: EDO47050 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNF1])

HSP 1 Score: 174.866 bits (442), Expect = 6.544e-52
Identity = 116/285 (40.70%), Postives = 169/285 (59.30%), Query Frame = 2
Query:  200 RIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEK----SRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQ--PFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            R  GKV ++TG N GIG ETA  L + G  + MGCR+++   +A  Q L   + D    + H +DL+ + S+  F K F  S  +L+VL+NNAG+M+ PY  T+DGFE QIG+ H GHFLLT  LLD +K +      SRI+ VSS AH  G IN  DL  +  +Y R  AY Q+K+AN+L    L + L      V   +LHPGVV+TEL R+LP I     AR        TP +G+ TS+   ++PDL  + G+Y ++C+ ++S+++   ++++ E LW+ S
Sbjct:   12 RAAGKVAIVTGGNCGIGYETARGLIRSGMTVIMGCRSEKAAESAI-QHLKDEQPDARVRYIH-LDLSDLSSVREFVKSFHQSENQLNVLVNNAGVMLTPYALTKDGFEQQIGICHFGHFLLTMLLLDTLKKSGTKDCHSRIVTVSSTAHSSGSINFEDLQSK-KSYSRFGAYAQAKVANVLFTYALQRRLSIDSTHVTANALHPGVVNTELFRHLPWI-----ARAPMGLFFLTPEQGAATSLYACLSPDLEGVGGKYLANCE-VQSSSAYSYNEDIQERLWRVS 287          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Nematostella
Match: EDO35001 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMN3])

HSP 1 Score: 173.326 bits (438), Expect = 5.932e-51
Identity = 120/305 (39.34%), Postives = 174/305 (57.05%), Query Frame = 2
Query:  149 LYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLIN-------ETD-LNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFL-MKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            ++  R YL G  C    R+ GK V++TGAN+GIG  TA+ELA+RG  + M CR+ +    A +++  + KV +++V    +DL S+ S+  F +       +LD+L+NNAG+      +T DGFE Q GVNHLGHFLLTN LLD++K +  SRI++VSSR      ++       +TD  ++RG +   +  YG+SKLAN L    L+K L P GV V +L PG+V T L R       ++       FL +K P EG+QT + CA  P L  +SG+ F+DC   +   +   DD  A+ LW  S
Sbjct:   25 IWLFRRYLVGRRCTNTVRLHGKTVIVTGANSGIGKATALELARRGARVIMACRDLESAEKAASEI--RYKVPKAEVVCRFLDLNSLISVRKFAEDVMREEKRLDILVNNAGVYQPANKKTVDGFETQFGVNHLGHFLLTNMLLDLLKASAPSRIVVVSSRLGFRANLDFDAFDKEDTDKKSMRGGHVMPV-GYGRSKLANFLFTHELSKRL-PQGVTVNALCPGMVWTGLGRTSKMSWKMKLLFWPLGFLFLKRPMEGAQTVIYCATEPKLSNVSGKCFTDCHQTD-MPANCTDDETAKRLWNVS 324          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Nematostella
Match: EDO46815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNX1])

HSP 1 Score: 164.466 bits (415), Expect = 4.247e-48
Identity = 114/282 (40.43%), Postives = 163/282 (57.80%), Query Frame = 2
Query:  212 KVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGD-NYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVF----NFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            K V+ITGAN+GIG+E A +LA R   + M CR+  K + A  +++         V    +DLAS  SI  F K+     +++DVLINNAG +     +T D  E  + VN+LG FLLTN LL  +K +  SRII VSS  H    I+    NL+G+ +YGR +AY +SKLA +L  + LA  L  + V V +LHPG+V T L R L  +  +   RP++     F  KTP +G+QT++ CAV P+L  ++G+YF DCQ  E      +D+ L + LW+ S +
Sbjct:    2 KTVIITGANSGIGMEVARDLAWRKARVIMACRDVHKGMKAAAEIV--QSAGNMDVEVKKLDLASFASIREFAKEVNEEESRVDVLINNAGYLGSQK-KTVDKLEYTLQVNYLGPFLLTNLLLGKLKTSSPSRIINVSSHQHKKASIDFD--NLQGEKSYGRFAAYSRSKLALMLFTKQLANKLAGYKVTVNALHPGLVCTNLFRNLRFLR-IWAIRPIYWLVQYFFFKTPIQGAQTTIHCAVAPELADVTGKYFVDCQEAE-CGEVARDEGLGKKLWEKSEE 276          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Nematostella
Match: EDO32533 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS7])

HSP 1 Score: 154.451 bits (389), Expect = 6.061e-43
Identity = 109/301 (36.21%), Postives = 162/301 (53.82%), Query Frame = 2
Query:  203 IDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETD------LNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPG-VVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQNIL 1084
            +DG+VV++TGA++GIGL TA  LA  G  + M CR+ +K   A   +   +K  + K+    VDLAS  SI  F  KFK     L VL+ NAG++  P+  T D  E    VN+LGHFLL   L DV+ ++  +RI+++SS +H    +N +D      + L  D Y  + AY QSKL +I+ +  L + L   GV   ++HPG ++ T L  Y     Y    R +     KTP + + T V CAV+P+L+ + GQYF +C+P E +  +  D + A  LW  S   + S  +    NI+
Sbjct:  132 LDGRVVMVTGASSGIGLATASALAAHGAHVVMACRDMEKAHKAELHIKKTNK--DCKLEVMFVDLASFASIHDFVDKFKKKSMPLHVLVCNAGVLGGPWRCTGDNIEYTFAVNYLGHFLLIKLLQDVLCSSSPARIVMLSSESHRFQDLNYSDKLHISTVPLSRDKYHSILAYNQSKLCSIMLSMELNRRLSSEGVTCNAVHPGNLIYTSL--YGKSWCYWLIFR-IARLFAKTPEQAASTVVYCAVSPELNGVGGQYFINCRPCEPS-VEAADPDKARALWTLSERLVTSLKRPQGSNII 426          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Medaka
Match: rdh12l (retinol dehydrogenase 12 [Source:NCBI gene;Acc:101168330])

HSP 1 Score: 249.21 bits (635), Expect = 2.269e-80
Identity = 138/281 (49.11%), Postives = 183/281 (65.12%), Query Frame = 2
Query:  200 RIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIE--YLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHS 1036
            ++DGK V+ITGANTGIG ETAI+LAKRG  + + CR+ +K   A  +++   K + + V +  +DL++ +SI  F +       KL++LINNAG+M+CPY +T DGFEMQIGVNHLGHFLLT  L+D+IK +  +RI+ VSS AH  G IN  DLN    +Y +  AY QSKLAN+L  R LAK L+  GV   SLHPGVV T+L R+L   E  +++ ARP      K   +G+QT++ CAV P L   SG Y+SDC    S +S  KDD +AE LW  S
Sbjct:   17 KLDGKTVVITGANTGIGKETAIDLAKRGARVIIACRDMEKAQAAVKEIM--EKSNSNAVVSMKLDLSNSQSIREFAEVINRDEPKLNILINNAGVMVCPYGKTADGFEMQIGVNHLGHFLLTYLLIDLIKRSAPARIVTVSSMAHAWGSINLDDLNSE-KSYSKSKAYAQSKLANVLFTRSLAKRLEGTGVTAYSLHPGVVQTDLWRHLSAPEQFFMKIARP----FTKNSLQGAQTTIYCAVEPSLDTESGGYYSDCAAA-SCSSAGKDDTVAEKLWDLS 289          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Medaka
Match: zgc:112332 (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:111946613])

HSP 1 Score: 242.276 bits (617), Expect = 1.252e-77
Identity = 137/281 (48.75%), Postives = 187/281 (66.55%), Query Frame = 2
Query:  200 RIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD 1042
            R+DGK V+ITGANTGIG ETA +LA+RG  I M CR+ ++   AR  +  +   +E+ V    +DL+  KSI +F +       +++VLINNAGIMMCPY +T DGFEMQ+GVNHLGHFLLT  LLD++K +  +RI++V+S AH    +   D+N    +Y  + AYGQSKLAN++ AR LAK L+  GV+V SLHPGVV ++L R+    + ++ A  +F    KTP EG+QT++ CAV P L  LSG+YFSDC P   + +   DD LAE LW+ S +
Sbjct:   16 RLDGKTVIITGANTGIGKETARDLARRGARIIMACRDLERAEEARTDIF-EDTGNENMVI-RKLDLSDTKSIKAFAELINKEEKQVNVLINNAGIMMCPYSKTADGFEMQLGVNHLGHFLLTYLLLDLMKRSAPARIVVVASVAHTWTGLRLDDIN-SAKSYDTMKAYGQSKLANVMFARSLAKRLKATGVSVFSLHPGVVQSDLWRHQH--QCIQVAVKIFRVFTKTPVEGAQTTIYCAVEPGLEILSGEYFSDCAPARCSRA-AADDALAERLWEISCE 290          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Medaka
Match: si:ch211-107o10.3 (retinol dehydrogenase 13 [Source:NCBI gene;Acc:101171076])

HSP 1 Score: 243.432 bits (620), Expect = 1.252e-77
Identity = 144/307 (46.91%), Postives = 194/307 (63.19%), Query Frame = 2
Query:  137 SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIR-YLPGIEYLEYA--RPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHI 1048
            + VGL+  + ++ G +C  K R+DGK VLITGANTGIG ETA++LA+RG  + M CR+ ++   A   V  + +     V    +DLAS++S+   +K+   S  +LD+LINNAGIM CP  +TEDGFEMQ GVNHLGHFLLTN LLD++K +  SRI+ VSS AH  G I   D+NL  D Y    +Y QSKLAN+L  R LAK L+  GV   SLHPGV+ TEL R +LP I   +    +P F+F +K+  +G+QT++ CAV   L   SG Y+SDC P ++   +  DD  A+ LW  S   +
Sbjct:   19 TGVGLFAFKRWMAGGVCCSKVRLDGKTVLITGANTGIGKETAVDLAQRGARVIMACRDMERANKAAEDV--RKRSGNGNVIVKKLDLASLESVRHLSKEVLASEERLDILINNAGIMSCPQWKTEDGFEMQFGVNHLGHFLLTNCLLDLLKKSTPSRIVNVSSLAHEKGEIYFDDINLEKD-YHPWKSYRQSKLANVLFTRELAKRLEGTGVTTYSLHPGVIKTELGRHFLPTIPLWKRVLYKP-FSFFIKSSSQGAQTTIYCAVEEKLQNESGLYYSDCAP-KTPAPQALDDEAAKRLWDVSASMV 320          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Medaka
Match: RDH13 (retinol dehydrogenase 13 [Source:NCBI gene;Acc:101164512])

HSP 1 Score: 229.95 bits (585), Expect = 2.725e-72
Identity = 141/311 (45.34%), Postives = 195/311 (62.70%), Query Frame = 2
Query:  158 LRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYAR----PVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQN 1078
            L+ ++ G  C  K  I GK V+ITGANTGIG ETA ELAKRGG I MGCR+ +KC TA  ++  +       V+   +DLASIKSI  F ++      ++DVLINNAG+M CP  +TEDGF+MQ GVNHLGHFLLTN LL+ +K    SR+I +SS AH+ G I+  DLN     +    AY QSKLAN+L  R LAK LQ  GV V ++HPGVV+TEL R+  G+   +++     P F+ L+K+P  G+Q SV  AV+ ++  ++G+Y+ D    +   ++  DD +A  LW+     + S++  L +N
Sbjct:   21 LKHHVTGGRCPSKATITGKTVVITGANTGIGKETARELAKRGGRILMGCRDMEKCETAAKEI--RGATLNPHVYACHLDLASIKSIREFAERVNKEEKRVDVLINNAGVMRCPAWKTEDGFDMQFGVNHLGHFLLTNLLLEKLKEPAPSRVINLSSLAHIIGNIDFEDLNWEKKTFDTKQAYCQSKLANVLFTRELAKRLQGTGVTVNAVHPGVVATELGRHT-GLHQSQFSSFMLGPFFSLLVKSPALGAQPSVFLAVSEEMEGVTGRYY-DVMTEKEPAAQALDDEVACRLWE-----VSSRLVGLQEN 322          
BLAST of retinol dehydrogenase 13-like vs. Ensembl Medaka
Match: si:dkey-23o4.6 (retinol dehydrogenase 12-like [Source:NCBI gene;Acc:101167436])

HSP 1 Score: 228.024 bits (580), Expect = 9.883e-72
Identity = 140/319 (43.89%), Postives = 192/319 (60.19%), Query Frame = 2
Query:  146 GLYYL-----RLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPG--IEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHID-SKIKSLNQN 1078
            G YYL     R ++ G +C    R+DGK VL+TGAN+GIG ET+ +LA+RG  + M CR+  + + A  ++  +       V    +DLAS+ S+ +F K+F  +  +LD+LINNAG+MMCP   TEDGFE Q+ VNHLGHFLLTN LL  ++++  SR++ VSS AH  G I+  DL      YG L +Y QSKLANIL  R LA+ L+  GV+   LHPGV+ TEL R++           R     LMKTP++G QT++ CAV P L   SG YFSDC+  E+   + +DD  A  LW  S   +    I S++Q+
Sbjct:    4 GQYYLSVAALRRWIGGGVCRCTIRLDGKTVLVTGANSGIGKETSRDLARRGARVVMACRDLSRAVQAAEEI--RKSTGNGNVVVRHLDLASLYSVRTFAKEFLDTEDRLDILINNAGVMMCPKRLTEDGFETQLAVNHLGHFLLTNLLLPKLRSSSPSRVVNVSSIAHRGGRIDFDDLFFSRRPYGALESYRQSKLANILFTRDLARRLKGSGVSAFCLHPGVIRTELGRHVESWFPLLGALLRLPALLLMKTPWQGCQTTLFCAVTPGLEDRSGCYFSDCEEREAA-PEGRDDEAARRLWDASARLVRLGDISSVSQD 319          
BLAST of retinol dehydrogenase 13-like vs. Planmine SMEST
Match: SMESG000049264.1 (SMESG000049264.1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 324/328 (98.78%), Postives = 326/328 (99.39%), Query Frame = 2
Query:  101 MNXXXXXXXXXXSAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQNIL 1084
            MNLLNLLVLTILSAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDE+KVFTHTVDLASIKSILSFTKKFKHSF KLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIK+TEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTD IDSKIKSLNQNIL
Sbjct:    1 MNLLNLLVLTILSAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDETKVFTHTVDLASIKSILSFTKKFKHSFKKLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKSTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDLIDSKIKSLNQNIL 328          
BLAST of retinol dehydrogenase 13-like vs. Planmine SMEST
Match: SMESG000009696.1 (SMESG000009696.1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 322/328 (98.17%), Postives = 325/328 (99.09%), Query Frame = 2
Query:  101 MNXXXXXXXXXXSAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQNIL 1084
            MNLLNLLVLTILSAVGLYYL LYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILSFTKKFKHSFTKLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHAR+LAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQP+ESTNS+ KDDNLAEFLWKHSTD IDSKIKSLNQNIL
Sbjct:    1 MNLLNLLVLTILSAVGLYYLGLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILSFTKKFKHSFTKLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARYLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPIESTNSQAKDDNLAEFLWKHSTDLIDSKIKSLNQNIL 328          
BLAST of retinol dehydrogenase 13-like vs. Planmine SMEST
Match: SMESG000009674.1 (SMESG000009674.1)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 291/316 (92.09%), Postives = 303/316 (95.89%), Query Frame = 2
Query:  137 SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQNIL 1084
            SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILSFTKKFKHSF KLDVLINNAGIMM  Y +TEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRII VSSRAHLHG+IN+TD+NLRG N+  LS+YGQSKL+NILHARHLAKILQPFGVAVVSLHPGVVST L +YLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSG YFSDCQP+ESTNS+ +DDNLAEFLWKHSTD IDSKIKSLN+NIL
Sbjct:   13 SAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILSFTKKFKHSFKKLDVLINNAGIMMWYYQDTEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIINVSSRAHLHGIINKTDINLRGVNFNLLSSYGQSKLSNILHARHLAKILQPFGVAVVSLHPGVVSTGLPKYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGLYFSDCQPIESTNSQAEDDNLAEFLWKHSTDLIDSKIKSLNKNIL 328          
BLAST of retinol dehydrogenase 13-like vs. Planmine SMEST
Match: SMESG000009679.1 (SMESG000009679.1)

HSP 1 Score: 504.597 bits (1298), Expect = 0.000e+0
Identity = 256/263 (97.34%), Postives = 260/263 (98.86%), Query Frame = 2
Query:  296 MGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFLWKHSTDHIDSKIKSLNQNIL 1084
            MGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILSFTKKFKHSFTKLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFL+KT YEGSQTSVCCAVNPDLHKLSGQYFSDCQP+ESTNS+ KDDNLAEFLWKHSTD IDSK+KSLNQNIL
Sbjct:    1 MGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILSFTKKFKHSFTKLDVLINNAGIMMCPYLETEDGFEMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEYARPVFNFLIKTAYEGSQTSVCCAVNPDLHKLSGQYFSDCQPIESTNSQAKDDNLAEFLWKHSTDLIDSKMKSLNQNIL 263          
BLAST of retinol dehydrogenase 13-like vs. Planmine SMEST
Match: SMESG000010175.1 (SMESG000010175.1)

HSP 1 Score: 133.65 bits (335), Expect = 9.199e-36
Identity = 94/313 (30.03%), Postives = 161/313 (51.44%), Query Frame = 2
Query:  137 SAVGLYYL-RLYLKGNLCHIKTRIDGKVVLITGANTGIGLETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLASIKSILXXXXXXXXXXXXLDVLINNAGIMMCPYLETEDGF-EMQIGVNHLGHFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSAYGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTEL---IRYLPGIEYLEYARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVKDDNLAEFL------WKHSTD 1042
            S +G++YL + Y           + GKVVLITG ++GIG E A  LA R   + +GCRN  KC  +R ++ L+S  +   V+   +DL S  SI  F K+    F ++D+LINNAG       E    F E Q+ +N +G  LLT +L+ ++  ++ +R++ +    +  G IN +D+N+  + Y +  A+ QS+L  +L  RH AK   P  ++  +  PG+V T       Y   I      + +   +++  ++  +T V C V+ +L+ ++GQ + D +P+E  N  + D +   F+      W ++ D
Sbjct:   13 SILGIFYLYKTYYAVPKYEGNEDLTGKVVLITGGSSGIGKELAYRLAMRQATLILGCRNINKCKESRQKIFLKS--NNKNVYCSELDLESYDSINGFVKRLSEKFDRVDILINNAGYKGGKIREITGAFVEKQLAINFIGAHLLTKKLISLLSASKGARVLYLICPQYKEGNINMSDINMIKE-YDKYKAFNQSQLMRMLSMRHFAKKFPPSQISFNACDPGMVYTNFHNQSSYNKNIISRLLFKYINTLILRGAWQAPETPVMCCVSDELNGVTGQLYRDLKPLE-INENILDPSSLAFIDLLCDKWSNAPD 321          
The following BLAST results are available for this feature:
BLAST of retinol dehydrogenase 13-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RDH131.649e-6743.45retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:H... [more]
RDH131.649e-6743.45retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:H... [more]
RDH111.335e-6644.44retinol dehydrogenase 11 [Source:HGNC Symbol;Acc:H... [more]
RDH121.011e-6544.07retinol dehydrogenase 12 [Source:HGNC Symbol;Acc:H... [more]
RDH121.011e-6544.07retinol dehydrogenase 12 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhs-221.855e-5238.56DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
dhs-221.855e-5238.56DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
DC2.54.656e-3433.67pep chromosome:WBcel235:V:210148:212787:-1 gene:WB... [more]
E04F6.151.352e-3232.30pep chromosome:WBcel235:II:7208773:7210287:-1 gene... [more]
dhs-82.412e-3130.74DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG20641.782e-8047.68gene:FBgn0033205 transcript:FBtr0088923[more]
CG20702.202e-7947.52gene:FBgn0033203 transcript:FBtr0088921[more]
CG20702.202e-7947.52gene:FBgn0033203 transcript:FBtr0336999[more]
CG20653.923e-7547.44gene:FBgn0033204 transcript:FBtr0088922[more]
CG20653.923e-7547.44gene:FBgn0033204 transcript:FBtr0337000[more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-107o10.32.059e-7645.07si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
si:ch211-107o10.32.059e-7645.07si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
si:ch211-107o10.34.241e-7645.07si:ch211-107o10.3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
rdh12l4.989e-7250.18retinol dehydrogenase 12, like [Source:ZFIN;Acc:ZD... [more]
zgc:1123325.730e-7248.03zgc:112332 [Source:ZFIN;Acc:ZDB-GENE-050522-387][more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdh131.116e-7446.69cystatin-like [Source:Xenbase;Acc:XB-GENE-990109][more]
stat3.13.228e-5443.93signal transducer and activator of transcription 3... [more]
dhrs131.059e-4938.61dehydrogenase/reductase (SDR family) member 13 [So... [more]
ENSXETT00000010671.12.675e-4336.49retinol dehydrogenase 14-like [Source:NCBI gene;Ac... [more]
runx11.608e-3338.74RUNX family transcription factor 1 [Source:Xenbase... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rdh121.984e-6744.78retinol dehydrogenase 12 [Source:MGI Symbol;Acc:MG... [more]
Rdh111.127e-6545.27retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MG... [more]
Rdh113.508e-6544.93retinol dehydrogenase 11 [Source:MGI Symbol;Acc:MG... [more]
Rdh134.960e-6543.38retinol dehydrogenase 13 (all-trans and 9-cis) [So... [more]
Rdh142.247e-6345.26retinol dehydrogenase 14 (all-trans and 9-cis) [So... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NBN7|RDH13_HUMAN7.919e-6743.45Retinol dehydrogenase 13 OS=Homo sapiens OX=9606 G... [more]
sp|Q8BYK4|RDH12_MOUSE1.388e-6644.78Retinol dehydrogenase 12 OS=Mus musculus OX=10090 ... [more]
sp|Q8TC12|RDH11_HUMAN6.410e-6644.44Retinol dehydrogenase 11 OS=Homo sapiens OX=9606 G... [more]
sp|Q96NR8|RDH12_HUMAN4.853e-6544.07Retinol dehydrogenase 12 OS=Homo sapiens OX=9606 G... [more]
sp|Q9QYF1|RDH11_MOUSE2.454e-6444.93Retinol dehydrogenase 11 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A336MUF04.735e-8550.99CSON005967 protein OS=Culicoides sonorensis OX=179... [more]
A0A1S3JRW85.571e-8448.85retinol dehydrogenase 13 OS=Lingula unguis OX=7574... [more]
B3MHS12.136e-8350.50Uncharacterized protein OS=Drosophila ananassae OX... [more]
A0A1W4VZG74.059e-8350.00retinol dehydrogenase 13-like OS=Drosophila ficusp... [more]
A0A553NB651.242e-8246.06Uncharacterized protein OS=Tigriopus californicus ... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdh12l8.733e-8048.15retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
zgc:1534414.484e-7343.32retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
zgc:1123321.334e-7247.18zgc:112332 [Source:ZFIN;Acc:ZDB-GENE-050522-387][more]
si:dkey-23o4.61.362e-7245.54retinol dehydrogenase 13-like [Source:NCBI gene;Ac... [more]
zgc:1123322.024e-7247.18zgc:112332 [Source:ZFIN;Acc:ZDB-GENE-050522-387][more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdh14b1.480e-5940.78retinol dehydrogenase 14b [Source:ZFIN;Acc:ZDB-GEN... [more]
RDH135.947e-4236.30retinol dehydrogenase 13 [Source:HGNC Symbol;Acc:H... [more]
rdh12l5.942e-3134.22retinol dehydrogenase 12, like [Source:ZFIN;Acc:ZD... [more]
dhrsx8.414e-2630.32dehydrogenase/reductase (SDR family) X-linked [Sou... [more]
ENSPMAT00000003709.14.985e-1846.24pep scaffold:Pmarinus_7.0:GL492885:3043:4555:-1 ge... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ENV94.799e-2430.23Protein proposed to be involved in vacuolar functi... [more]
AYR15.357e-829.39Bifunctional triacylglycerol lipase and 1-acyl DHA... [more]
PBR13.906e-621.41Putative oxidoreductase; required for cell viabili... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360702.098e-6943.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470506.544e-5240.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350015.932e-5139.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468154.247e-4840.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325336.061e-4336.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdh12l2.269e-8049.11retinol dehydrogenase 12 [Source:NCBI gene;Acc:101... [more]
zgc:1123321.252e-7748.75retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
si:ch211-107o10.31.252e-7746.91retinol dehydrogenase 13 [Source:NCBI gene;Acc:101... [more]
RDH132.725e-7245.34retinol dehydrogenase 13 [Source:NCBI gene;Acc:101... [more]
si:dkey-23o4.69.883e-7243.89retinol dehydrogenase 12-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of retinol dehydrogenase 13-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049264.10.000e+098.78SMESG000049264.1[more]
SMESG000009696.10.000e+098.17SMESG000009696.1[more]
SMESG000009674.10.000e+092.09SMESG000009674.1[more]
SMESG000009679.10.000e+097.34SMESG000009679.1[more]
SMESG000010175.19.199e-3630.03SMESG000010175.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000373 ID=SMED30000373|Name=retinol dehydrogenase 13-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1167bp
GTTTAACTAATATAAATATTTTAATTGGACACCAAAAGAATATCTTCCTG
ATTTTCAATTTTTTAAAGAATTAGTTAGTTGAATTTAAAAAAAGTATAAA
ATGAATTTATTAAACTTGCTGGTACTAACAATCTTATCGGCTGTTGGCCT
CTACTATTTGAGGCTTTACCTCAAAGGCAACCTATGCCATATAAAAACTC
GTATTGATGGCAAAGTCGTCCTAATTACTGGTGCAAATACTGGCATCGGA
TTGGAGACTGCTATAGAGTTAGCAAAGCGTGGAGGGATAATTCACATGGG
TTGTAGAAATCAACAAAAGTGCCTAACTGCCAGAAATCAAGTTTTGTTGC
AATCGAAGGTAGACGAAAGCAAGGTATTCACTCATACTGTTGATTTGGCT
TCAATAAAATCTATTCTATCCTTCACCAAAAAATTCAAACATTCGTTTAC
AAAATTAGATGTGCTCATTAATAATGCTGGAATCATGATGTGCCCATATC
TGGAAACAGAGGATGGTTTTGAAATGCAAATCGGAGTGAACCATTTAGGC
CATTTTCTTTTGACTAATGAATTATTAGATGTAATAAAAAACACGGAGAA
ATCTAGGATAATAATCGTGTCCTCTAGAGCACATTTGCATGGTCTTATAA
ATGAAACAGACCTTAATTTGCGTGGTGACAACTATGGCAGATTATCTGCT
TATGGCCAAAGCAAATTAGCAAACATATTGCATGCTAGACATCTAGCTAA
GATTCTACAACCATTTGGTGTGGCAGTTGTCAGTTTACACCCAGGAGTTG
TAAGCACAGAGTTAATAAGATATTTGCCCGGTATTGAATATTTGGAATAT
GCTAGACCTGTTTTCAATTTTCTTATGAAAACACCTTATGAAGGCTCTCA
GACCAGCGTTTGCTGTGCTGTTAATCCAGACCTTCATAAACTCTCTGGTC
AGTATTTCAGTGACTGCCAGCCAATGGAATCTACGAATTCCAAAGTCAAG
GATGATAACTTAGCAGAATTCCTCTGGAAACACAGCACTGATCACATAGA
TTCCAAAATAAAATCGCTTAATCAAAACATACTTTAATTAGAACTTTGTA
ATTTCATACCAAACTTTGGACGCCGTCTTGAATTTTAGTTTTACTGGTCA
AGACTTCTATGTTAAAT
back to top

protein sequence of SMED30000373-orf-1

>SMED30000373-orf-1 ID=SMED30000373-orf-1|Name=SMED30000373-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=329bp
MNLLNLLVLTILSAVGLYYLRLYLKGNLCHIKTRIDGKVVLITGANTGIG
LETAIELAKRGGIIHMGCRNQQKCLTARNQVLLQSKVDESKVFTHTVDLA
SIKSILSFTKKFKHSFTKLDVLINNAGIMMCPYLETEDGFEMQIGVNHLG
HFLLTNELLDVIKNTEKSRIIIVSSRAHLHGLINETDLNLRGDNYGRLSA
YGQSKLANILHARHLAKILQPFGVAVVSLHPGVVSTELIRYLPGIEYLEY
ARPVFNFLMKTPYEGSQTSVCCAVNPDLHKLSGQYFSDCQPMESTNSKVK
DDNLAEFLWKHSTDHIDSKIKSLNQNIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 222..239
score: 29.61
coord: 201..220
score: 28.76
coord: 162..178
score: 23.53
coord: 117..128
score: 56.09
coord: 39..56
score: 44.64
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 38..239
e-value: 1.8E-29
score: 102.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 31..321
e-value: 3.1E-75
score: 255.0
NoneNo IPR availablePANTHERPTHR24320FAMILY NOT NAMEDcoord: 5..317
NoneNo IPR availablePANTHERPTHR24320:SF142coord: 5..317
NoneNo IPR availableCDDcd05327retinol-DH_like_SDR_c_likecoord: 37..309
e-value: 4.7701E-108
score: 314.162
NoneNo IPR availableTMHMMTMhelixcoord: 2..24
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 36..292