ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30000370
Length (bp)4190
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30000370) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30000370) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30000370) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30000370) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000370

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000370SMESG000013802.1 SmedASXL_010865SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30000370SMESG000013802.1 dd_Smed_v4_11317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000370SMESG000013802.1 dd_Smed_v4_11317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000370SMESG000013802.1 dd_Smed_v4_11317_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30000370SMESG000013802.1 dd_Smed_v4_7813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000370SMESG000013802.1 dd_Smed_v4_7813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000370SMESG000013802.1 dd_Smed_v4_7813_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30000370SMESG000013802.1 dd_Smed_v6_7813_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000370SMESG000013802.1 dd_Smed_v6_11317_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000370SMESG000013802.1 dd_Smed_v4_11317_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000370SMESG000013802.1 dd_Smed_v4_7813_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 119.398 bits (298), Expect = 1.673e-26
Identity = 102/342 (29.82%), Postives = 161/342 (47.08%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNN-----LAALECMNDYI--TDKTRFIQIPDNSGNY-PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE-NVNEKNNSGQTALHLA 3076
            +D+ G++ LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ +  Y +     L A E   D +  T  T  +   DN     PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D I     +H   + G+ E    L    N +P    ++ D NG TP+  +V N +   V  L+   A +D  D++GRT  H+ A  G  +C++ LL +G     +   G  P+H +A  G+  +   LL + ++++ N    +N G TALH A
Sbjct:  280 KDKFGRSPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLL--IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWA 609          

HSP 2 Score: 95.5153 bits (236), Expect = 4.750e-19
Identity = 99/356 (27.81%), Postives = 165/356 (46.35%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN----NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGA----NFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE-LNAKL-DIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            ++R+ SG+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    NA V+  DGNG+T L L+V+  +    +C+   + +K   +   D  G   LH        + +V   +  ++ LL+       RD   RTP+ L+    H+  +  LL++ A    N  T D     ++H+ C  G+   +E+  +  VF+      T+ N  +P+  AV N NE   + LI+ L A + +  D  GRT  H AA     +CL+LLLS+     S    G  PL  AA  G     E+L+++ SA   +  ++NS  TALHLA  +       L++ K
Sbjct:  423 DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNA-VDIQDGNGQTPLMLSVLNGHT---DCVYSLL-NKGANVDAKDKWGRTALH--------RGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQK-----TEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASA--ELTLQDNSKNTALHLACSKGHETSALLILEK 758          

HSP 3 Score: 92.0485 bits (227), Expect = 5.074e-18
Identity = 100/410 (24.39%), Postives = 172/410 (41.95%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASM-IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGA--------------------------DIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYN-NVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQ-------YNVNLWKLNNDSN-----YPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            SY  L  A   G    VK LL+   D+ +     +  L   C+  +  V   L     +++   + G+T LH A+        L  L+    D+N ++ D ++ L +  ++      + + ++ A ++  D NG +P+H AA+    L     +       K G                           DID  D + R+ L  A    NL  +  L+  GA    KD  G S LHYA +N N + +  L+      +   D   CT L YA + + +   +E LL   +N    D +  NA H+++  G    LQ++            +   + +DS+      PLH A+Y GH++ +E L+      + +L+ ++ RNS+G+T L L+  K ++E   +L+  GA
Sbjct:   52 SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGS-GASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLV------QSLLD-LDVRNSSGRTPLDLAAFKGHVECVDVLINQGA 453          

HSP 4 Score: 86.2705 bits (212), Expect = 3.375e-16
Identity = 98/414 (23.67%), Postives = 197/414 (47.58%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC-FK-YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLS-KNPD--INKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACI----YSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLER--GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A   G+++ ++ L+++  D+ DVR+ + +T L    FK +  CV+++++    +L        T +H A+       LR L+    P   ++ ++ + ++ L+L+V+  + + V  L    A V+  D  G + +H  A            E ++ LL+HGA     D   R+P+  +    ++  +  L++  A +     + D+ G + LH+A  NG+   +++LL+   F  + T+ N  + L  A   +N    E+L++    S VNA DSK R   H A+    ++ LQ+L  +N  +  +++    PL  A+  G    VE L+++   +  +      ++++  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  403 AAYHGHHQALEVLVQSLLDL-DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGA-------VTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVF--QKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTL------QDNSKNTALHLACSKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVL 799          

HSP 5 Score: 84.7297 bits (208), Expect = 8.247e-16
Identity = 102/362 (28.18%), Postives = 172/362 (47.51%), Query Frame = 2
Query:  260 GDVRDLTDK---TLLHYCFKYESCVELILSVAPQLLDTGEK--NGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTK-MKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFD--LET------TDSNN---CTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVL-HQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            G V D  DK   T LH   +Y   + LI ++     DT ++  +G   LHLA++       R LLS   DI+  ++  R+ L  A    N E + LL    A+ N  D  G SP+HYAA            + +  L+  GA ++ LD    +PL +A  S+   K +++L+   A    +D  G + +HY+ + G+   +Q++  +   D  +ET      +DS+N    + L  A  + +   +E+L++   +++  +S  R     A+ KG ++ + VL +Q    L K       P+H A+  GH+E +  LI N EP+    N ++ ++ NGQT L LS +  + +    LL  GA+
Sbjct:  175 GAVIDCEDKNGNTPLHIAARYGHEL-LINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAA-------NCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQ----NAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGAN 524          

HSP 6 Score: 77.411 bits (189), Expect = 1.796e-13
Identity = 92/368 (25.00%), Postives = 160/368 (43.48%), Query Frame = 2
Query: 2087 GEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLA---VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHD-GTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G V +  D++G T LH + +   EL    L  +     K     +  LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  +     D  G  PLHYA   C Y     QC   +  L+     +   D    TPL  A   +   + +E LL+N AN   RD Q   +VHY            + SE  L++  + +   +  + D   T    ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K +     P+H AA  G+ E   +L+        V+ ++ +GQT L L+ +       + L++K + ++
Sbjct:  175 GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK----KDKFGRSPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRAT----ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVD 526          

HSP 7 Score: 76.6406 bits (187), Expect = 2.544e-13
Identity = 60/199 (30.15%), Postives = 98/199 (49.25%), Query Frame = 2
Query: 2495 MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPN--GLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEK--GAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            ++LLL    +I   D+  R  +  A  + H+E V+ L+ +GA    +D ++   +H   S G + +   L    +   ++ +PN  G TP+  A  N  + +V  LI+  A ++  ++ G T  H AA    GA  CLELL+  G D   K  DG  PLH  A  G    ++ ++ + + I+   +KN  G T LH+AA
Sbjct:    2 VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLL---DLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGAL-CLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVID-CEDKN--GNTPLHIAA 193          

HSP 8 Score: 73.9442 bits (180), Expect = 1.766e-12
Identity = 83/335 (24.78%), Postives = 149/335 (44.48%), Query Frame = 2
Query: 2108 DQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            D+  +  +H++  + + E+ +L++    E+  K D+ + T LH    S  I  +  LL    ++N P+  G T L++A  YN    +  +N+ I D    +   +  G  PLH+A        ++C     +ELL+    D+  + +  +TPL +          +T++++GA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:   16 DKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCK-DKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVAC-YNGQDVV--VNELI-DCGAIVNQKNEKGFTPLHFAAA--STHGALC-----LELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL-ITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAATSDTDGKCL 334          

HSP 9 Score: 69.3218 bits (168), Expect = 4.270e-11
Identity = 89/350 (25.43%), Postives = 141/350 (40.29%), Query Frame = 2
Query: 2156 LFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNH-VEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPD 3202
            + +L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +  P+  GN PLH A   C   + V      +  L++    +  ++    TPL  A    H    +E L+ NGA+   +       +H     G     +Q  +      +  D NG TP+  A    +E ++  LI   A       +G    H AA  G   C   LLS G D  +    G   LH AA  G  E   +LLNT +   + N+K+  G++ LH AA   +    F L+   + +N+L     D    T    A T D
Sbjct:    1 MVKLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVK----YLLDLGVDMNEPNAYGNTPLHVA---CYNGQDV-----VVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFS-RSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGA---DFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDL-----DERGCTPLHYAATSD 328          

HSP 10 Score: 67.3958 bits (163), Expect = 2.002e-10
Identity = 79/328 (24.09%), Postives = 138/328 (42.07%), Query Frame = 2
Query:  425 LRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            ++ LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +  K+  G + LH+A ++ +  +   LL     D+     +  T L     +      + +++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++    +   +F       G+T LH +    NLE   +LL  GAD N   +   G+S      AN N   L  +  +G S +DL
Sbjct:    2 VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDF-------GRTCLHAAAAGGNLECLNLLLNTGADFNKKDKF--GRSPLHYAAANCNYQCLFALVGSGASVNDL 313          

HSP 11 Score: 65.0846 bits (157), Expect = 8.921e-10
Identity = 86/361 (23.82%), Postives = 154/361 (42.66%), Query Frame = 2
Query:  227 VKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNI 1300
            VK LL    ++ +  D  D+  +H+     +   V+L++S   ++    +K  YT LH A+     + ++YLL    D+N+ N    + L +A        V  L +  A VN  +  G +P+H+AA         +    + +L+ +GAD++      ++PL         ++ + +I+ GA I  +D +G + LH A   G+  +I  L+     D      +    L  A      D    LL  G +++  D   R   H A+  G+L+ L +L     +  K +     PLH A+   + + +  L+ +          +N  +  G T LH +   D    C + LL+N A+P I
Sbjct:    2 VKLLLSRGANI-NAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEV-TCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAA------STHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITS-GADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGAS-------VNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGI 346          

HSP 12 Score: 60.8474 bits (146), Expect = 1.769e-8
Identity = 78/299 (26.09%), Postives = 126/299 (42.14%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFEL--ILKKTPEL---VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT-RDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            G+ E V + +  G +   +RD  G+T +H S     +  L  +L+    +       D    T LH    +     + LLL+        +GN  + L+ AVI +N  A E + D  T     +   D+ G  PLH A     +   V +C   ++LLL  N  +   D   +TPL++A        VE L+ + +  LT +D     ++H  CS+G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  543 GHEECVDALLQHGAKC-LLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLID--TLGASIVNATDSKGRTPLHAA----AFTDHV-EC---LQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHET--SALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 827          

HSP 13 Score: 55.4546 bits (132), Expect = 7.709e-7
Identity = 82/338 (24.26%), Postives = 146/338 (43.20%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLH--YCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINK----RNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSN---VNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYP-LHEASYKGHNEIVEFLITNMEP 1171
            L+ +   G+   V  LL    +V D +D   +T LH      +E CV+ +L    + L   +  G T +HL++       L  LL     ++      +N   ++L  A    +   V+LL E       T+ N  SP+H A         +NE     ++   GA I +  D   R+PL  A  ++++  ++ L+   A + S DS+G + L  A  NG    ++ML+     +L   D++  TAL  ACS  +     L+LE+ ++   +NA ++  +   H A+  G    +Q L     ++  ++ +   P L  A  K   + +  ++  M P
Sbjct:  503 LMLSVLNGHTDCVYSLLNKGANV-DAKDKWGRTALHRGAVTGHEECVDALLQHGAKCL-LRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAV------INDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILATMMP 831          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 118.627 bits (296), Expect = 2.024e-26
Identity = 102/342 (29.82%), Postives = 161/342 (47.08%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNN-----LAALECMNDYI--TDKTRFIQIPDNSGNY-PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE-NVNEKNNSGQTALHLA 3076
            +D+ G++ LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ +  Y +     L A E   D +  T  T  +   DN     PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D I     +H   + G+ E    L    N +P    ++ D NG TP+  +V N +   V  L+   A +D  D++GRT  H+ A  G  +C++ LL +G     +   G  P+H +A  G+  +   LL + ++++ N    +N G TALH A
Sbjct:  378 KDKFGRSPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLL--IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWA 707          

HSP 2 Score: 90.8929 bits (224), Expect = 9.826e-18
Identity = 103/412 (25.00%), Postives = 175/412 (42.48%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCV--ELILSVAPQLLDTGEKNGYTVLHLASM-IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGA--------------------------DIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYN-NVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQ-------YNVNLWKLNNDSN-----YPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            SY  L  A   G    VK LL+   D+ +     +  L   C+  +  V  ELI   A  +++   + G+T LH A+        L  L+    D+N ++ D ++ L +  ++      + + ++ A ++  D NG +P+H AA+    L     +       K G                           DID  D + R+ L  A    NL  +  L+  GA    KD  G S LHYA +N N + +  L+      +   D   CT L YA + + +   +E LL   +N    D +  NA H+++  G    LQ++            +   + +DS+      PLH A+Y GH++ +E L+      + +L+ ++ RNS+G+T L L+  K ++E   +L+  GA
Sbjct:  150 SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGA--IVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGS-GASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLV------QSLLD-LDVRNSSGRTPLDLAAFKGHVECVDVLINQGA 551          

HSP 3 Score: 85.5001 bits (210), Expect = 4.490e-16
Identity = 81/329 (24.62%), Postives = 140/329 (42.55%), Query Frame = 2
Query:  422 SLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIP 1303
            +++ LL  + D+N R+ + ++ L +A      +  + L    + VN++D  G + +H+AA            E++ +LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +++ LL D   D+   ++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q + Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G D + P
Sbjct:   33 AVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAA-------FSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLL-DLGVDMNEPNAYGNTPLHVAC-YNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTP 345          

HSP 4 Score: 80.1073 bits (196), Expect = 1.794e-14
Identity = 83/311 (26.69%), Postives = 133/311 (42.77%), Query Frame = 2
Query: 2153 ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEK--GAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            E  +++LK + + VN  D+   T LH+   +K ++    L+   +NVN  D  GRTAL+ A                            SG+  +                   ++LLL    +I   D+  R  +  A  + H+E V+ L+ +GA    +D ++   +H   S G + +   L      D N  +  G TP+  A  N  + +V  LI+  A ++  ++ G T  H AA    GA  CLELL+  G D   K  DG  PLH  A  G    ++ ++ +  A+ +  +KN  G T LH+AA
Sbjct:   32 EAVQVLLKHSAD-VNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAF--------------------------SGHGEM-------------------VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGAL-CLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQS-GAVIDCEDKN--GNTPLHIAA 291          

HSP 5 Score: 79.7221 bits (195), Expect = 2.420e-14
Identity = 84/333 (25.23%), Postives = 139/333 (41.74%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKNKELFELILKKTPEL--VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA-----IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
            RD++ +T LH +  NK + +      P L  VN  D    T LH    S   E + LLL   AN+N  D   R A++ A    ++  ++ +  +  + T      D     PLH A     I + KY             LL++  D+   +    TPL +A        V  L+  GA    ++ +    +H+  +  +  +  +L V    D N+   +G TP+     +      + +I+  A +D  D+ G T  H AA  G    +  L++ G D   +   G  PLH AA  G+ +    LL   S+  +++  ++ G+T LH AA 
Sbjct:   47 RDKNWQTPLHIAAANKAV-KCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVT----CKDKKSYTPLHAAASSGMISVVKY-------------LLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLL---SSGFDIDTPDDFGRTCLHAAAA 358          

HSP 6 Score: 79.7221 bits (195), Expect = 2.462e-14
Identity = 95/370 (25.68%), Postives = 154/370 (41.62%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNH-VEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPD 3202
            + D++G+T LH++    + E+ +L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +  P+  GN PLH A   C   + V      +  L++    +  ++    TPL  A    H    +E L+ NGA+   +       +H     G     +Q  +      +  D NG TP+  A    +E ++  LI   A       +G    H AA  G   C   LLS G D  +    G   LH AA  G  E   +LLNT +   + N+K+  G++ LH AA   +    F L+   + +N+L     D    T    A T D
Sbjct:   79 VSDRAGRTALHHAAFSGHGEMVKLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVK----YLLDLGVDMNEPNAYGNTPLHVA---CYNGQDV-----VVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFS-RSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGA---DFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDL-----DERGCTPLHYAATSD 426          

HSP 7 Score: 78.9518 bits (193), Expect = 4.963e-14
Identity = 98/399 (24.56%), Postives = 171/399 (42.86%), Query Frame = 2
Query:  221 KKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            + V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       ++ LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +  K+  G + LH+A ++ +  +   LL     D+     +  T L     +      + +++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++         F I+  +  G+T LH +    NLE   +LL  GAD N   +   G+S      AN N   L  +  +G S +DL
Sbjct:   32 EAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVKCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSS--------GFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKF--GRSPLHYAAANCNYQCLFALVGSGASVNDL 411          

HSP 8 Score: 76.2554 bits (186), Expect = 2.861e-13
Identity = 93/367 (25.34%), Postives = 160/367 (43.60%), Query Frame = 2
Query: 2087 GEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNG------------LTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTM---PLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G V +  D++G T LH + +   EL    L  +     K     +  LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  +     D  G  PLHYA   C Y     QC   +  L+     +   D    TPL  A   +   + +E LL+N AN   RD Q   +VHY  + G+  +  QL   E     + + +G            ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K  D  +   P+H AA  G+ E   +L+        V+ ++ +GQT L L+ +       + L++K + ++
Sbjct:  273 GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK----KDKFGRSPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGH-RLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVK--DYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVD 624          

HSP 9 Score: 73.9442 bits (180), Expect = 1.720e-12
Identity = 61/215 (28.37%), Postives = 99/215 (46.05%), Query Frame = 2
Query: 2495 MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF-LLISKDSKIN 3136
            +++LL+ + D+  RD+  +TPL +A     V+  E L+   +N    D     ++H+    G+ E+  +L +    + N  D      I +A    + ++VK L+   A++   D+   T  H AA  G    ++ LL  GVD       G  PLH A Y G   +   L++   AI  VN+KN  G T LH AA      +C  LL+   + +N
Sbjct:   34 VQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMV-KLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDC-GAI--VNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN 244          

HSP 10 Score: 71.2478 bits (173), Expect = 1.087e-11
Identity = 62/232 (26.72%), Postives = 118/232 (50.86%), Query Frame = 2
Query:  734 LTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNM-EP---------------KEKILN-------FINHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            L  ++ L++  A + ++D +  + LH A +N  ++  + L+     ++  +D    TAL +A    + ++V+LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   +V++L+    +M EP               ++ ++N        +N +N  G T LH +    +  +C ++L+ NGAD N  ++  +GK+   MTAL
Sbjct:   31 LEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLS-NVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN--MKSKDGKTPLHMTAL 259          

HSP 11 Score: 58.9214 bits (141), Expect = 7.064e-8
Identity = 61/233 (26.18%), Postives = 100/233 (42.92%), Query Frame = 2
Query:  671 DIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSS-GLSILHYATSNGNLEIIQMLLDDYKFD--LETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNE 1360
            D+D  +   R+PL  A    ++  +  LI +GA I  KD     + +H A +NG+ E +++L+ + +    ++  D N  T LM +    + D V  LL +G+NV+A+D   R A                                 LH  +  GH E V+ L   ++   K L     R+S G+T +HLS    ++ +   LLQ+ A  +     ++    TAL  A  NE
Sbjct:  519 DLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTA---------------------------------LHRGAVTGHEECVDAL---LQHGAKCLL----RDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNE 711          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 119.398 bits (298), Expect = 2.255e-26
Identity = 102/342 (29.82%), Postives = 161/342 (47.08%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNN-----LAALECMNDYI--TDKTRFIQIPDNSGNY-PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE-NVNEKNNSGQTALHLA 3076
            +D+ G++ LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ +  Y +     L A E   D +  T  T  +   DN     PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D I     +H   + G+ E    L    N +P    ++ D NG TP+  +V N +   V  L+   A +D  D++GRT  H+ A  G  +C++ LL +G     +   G  P+H +A  G+  +   LL + ++++ N    +N G TALH A
Sbjct:  434 KDKFGRSPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLL--IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWA 763          

HSP 2 Score: 95.5153 bits (236), Expect = 5.382e-19
Identity = 99/356 (27.81%), Postives = 165/356 (46.35%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN----NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGA----NFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE-LNAKL-DIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            ++R+ SG+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    NA V+  DGNG+T L L+V+  +    +C+   + +K   +   D  G   LH        + +V   +  ++ LL+       RD   RTP+ L+    H+  +  LL++ A    N  T D     ++H+ C  G+   +E+  +  VF+      T+ N  +P+  AV N NE   + LI+ L A + +  D  GRT  H AA     +CL+LLLS+     S    G  PL  AA  G     E+L+++ SA   +  ++NS  TALHLA  +       L++ K
Sbjct:  577 DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNA-VDIQDGNGQTPLMLSVLNGHT---DCVYSLL-NKGANVDAKDKWGRTALH--------RGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQK-----TEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASA--ELTLQDNSKNTALHLACSKGHETSALLILEK 912          

HSP 3 Score: 92.0485 bits (227), Expect = 5.754e-18
Identity = 100/410 (24.39%), Postives = 172/410 (41.95%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASM-IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGA--------------------------DIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYN-NVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQ-------YNVNLWKLNNDSN-----YPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            SY  L  A   G    VK LL+   D+ +     +  L   C+  +  V   L     +++   + G+T LH A+        L  L+    D+N ++ D ++ L +  ++      + + ++ A ++  D NG +P+H AA+    L     +       K G                           DID  D + R+ L  A    NL  +  L+  GA    KD  G S LHYA +N N + +  L+      +   D   CT L YA + + +   +E LL   +N    D +  NA H+++  G    LQ++            +   + +DS+      PLH A+Y GH++ +E L+      + +L+ ++ RNS+G+T L L+  K ++E   +L+  GA
Sbjct:  206 SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGS-GASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLV------QSLLD-LDVRNSSGRTPLDLAAFKGHVECVDVLINQGA 607          

HSP 4 Score: 90.5077 bits (223), Expect = 1.541e-17
Identity = 87/338 (25.74%), Postives = 154/338 (45.56%), Query Frame = 2
Query:  416 PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNM-EP---------------KEKILN-------FINHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            P  +R L+ K  D+N ++N+ R+ L  A    + E ++LL  + A VN  D   ++P+H A             E + +LLKH AD++  D   ++PL  A  +  +   + L+   + +   D +G + LH+A  +G+ E+                                  V+LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   +V++L+    +M EP               ++ ++N        +N +N  G T LH +    +  +C ++L+ NGAD N  ++  +GK+   MTAL
Sbjct:   21 PDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVA-------SCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEM----------------------------------VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN--MKSKDGKTPLHMTAL 315          

HSP 5 Score: 88.1965 bits (217), Expect = 9.639e-17
Identity = 90/368 (24.46%), Postives = 149/368 (40.49%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAX--------------------------XXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIP 1303
            T LH A+ +     +  L+     +N +++   + L  AV   + EAV++L +++A+VN  D N  +P+H AA  KA                                  E++ +LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +++ LL D   D+   ++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q + Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G D + P
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLL-DLGVDMNEPNAYGNTPLHVAC-YNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTP 401          

HSP 6 Score: 86.2705 bits (212), Expect = 3.653e-16
Identity = 98/414 (23.67%), Postives = 197/414 (47.58%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC-FK-YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLS-KNPD--INKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACI----YSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLER--GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A   G+++ ++ L+++  D+ DVR+ + +T L    FK +  CV+++++    +L        T +H A+       LR L+    P   ++ ++ + ++ L+L+V+  + + V  L    A V+  D  G + +H  A            E ++ LL+HGA     D   R+P+  +    ++  +  L++  A +     + D+ G + LH+A  NG+   +++LL+   F  + T+ N  + L  A   +N    E+L++    S VNA DSK R   H A+    ++ LQ+L  +N  +  +++    PL  A+  G    VE L+++   +  +      ++++  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  557 AAYHGHHQALEVLVQSLLDL-DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGA-------VTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVF--QKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTL------QDNSKNTALHLACSKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVL 953          

HSP 7 Score: 83.5741 bits (205), Expect = 2.098e-15
Identity = 93/388 (23.97%), Postives = 159/388 (40.98%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI-----EICKY--------------KKSVCQCKTYM------ELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSN-----CNEKIV-----------------------------KRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
             +D   +T LH +  L + E+ EL++      VN  D   LT LH  + S   E + +LLK++A+VN  D N +T L++A     +   E +   +++    + + D +G   LH+A      E+ K                +       YM      +LL+    ++ C+D+ S TPL  A +   +  V+ LL  G +    +      +H  C  G   + N+L +      N  +  G TP+ +A ++     C E +V                             + +I+  A +D  D+ G T  H AA  G    +  L++ G D   +   G  PLH AA  G+ +    LL   S+  +++  ++ G+T LH AA 
Sbjct:   36 FQDNEKRTPLHAAAYLGDAEIIELLILSGAR-VNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSN----VNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNEL-IDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLL---SSGFDIDTPDDFGRTCLHAAAA 414          

HSP 8 Score: 80.8777 bits (198), Expect = 1.451e-14
Identity = 100/409 (24.45%), Postives = 175/409 (42.79%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    + + V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       ++ LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +  K+  G + LH+A ++ +  +   LL     D+     +  T L     +      + +++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++         F I+  +  G+T LH +    NLE   +LL  GAD N   +   G+S      AN N   L  +  +G S +DL
Sbjct:   78 LHRAVASCSEEAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVKCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSS--------GFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKF--GRSPLHYAAANCNYQCLFALVGSGASVNDL 467          

HSP 9 Score: 78.5666 bits (192), Expect = 8.117e-14
Identity = 83/363 (22.87%), Postives = 149/363 (41.05%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA--------------------------IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+ +L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +  P+  GN PLH A                               +  +       +ELL+    D+  + +  +TPL +          +T++++GA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:  135 VSDRAGRTALHHAAFSGHGEMVKLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVK----YLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL-ITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAATSDTDGKCL 488          

HSP 10 Score: 77.0258 bits (188), Expect = 2.152e-13
Identity = 92/368 (25.00%), Postives = 160/368 (43.48%), Query Frame = 2
Query: 2087 GEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLA---VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHD-GTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G V +  D++G T LH + +   EL    L  +     K     +  LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  +     D  G  PLHYA   C Y     QC   +  L+     +   D    TPL  A   +   + +E LL+N AN   RD Q   +VHY            + SE  L++  + +   +  + D   T    ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K +     P+H AA  G+ E   +L+        V+ ++ +GQT L L+ +       + L++K + ++
Sbjct:  329 GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK----KDKFGRSPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRAT----ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVD 680          

HSP 11 Score: 60.8474 bits (146), Expect = 1.964e-8
Identity = 78/299 (26.09%), Postives = 126/299 (42.14%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFEL--ILKKTPEL---VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT-RDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            G+ E V + +  G +   +RD  G+T +H S     +  L  +L+    +       D    T LH    +     + LLL+        +GN  + L+ AVI +N  A E + D  T     +   D+ G  PLH A     +   V +C   ++LLL  N  +   D   +TPL++A        VE L+ + +  LT +D     ++H  CS+G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  697 GHEECVDALLQHGAKCL-LRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLID--TLGASIVNATDSKGRTPLHAA----AFTDHV-EC---LQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHET--SALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 981          

HSP 12 Score: 55.4546 bits (132), Expect = 8.284e-7
Identity = 81/331 (24.47%), Postives = 143/331 (43.20%), Query Frame = 2
Query:  212 GNNKKVKKLLENCTDVGDVRDLTDKTLLH--YCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINK----RNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSN---VNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYP-LHEASYKGHNEIVEFLITNMEP 1171
            G+   V  LL    +V D +D   +T LH      +E CV+ +L    + L   +  G T +HL++       L  LL     ++      +N   ++L  A    +   V+LL E       T+ N  SP+H A         +NE     ++   GA I +  D   R+PL  A  ++++  ++ L+   A + S DS+G + L  A  NG    ++ML+     +L   D++  TAL  ACS  +     L+LE+ ++   +NA ++  +   H A+  G    +Q L     ++  ++ +   P L  A  K   + +  ++  M P
Sbjct:  664 GHTDCVYSLLNKGANV-DAKDKWGRTALHRGAVTGHEECVDALLQHGAKCL-LRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAV------INDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILATMMP 985          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANKRD28 (ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:HGNC:29024])

HSP 1 Score: 119.398 bits (298), Expect = 2.255e-26
Identity = 102/342 (29.82%), Postives = 161/342 (47.08%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNN-----LAALECMNDYI--TDKTRFIQIPDNSGNY-PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE-NVNEKNNSGQTALHLA 3076
            +D+ G++ LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ +  Y +     L A E   D +  T  T  +   DN     PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D I     +H   + G+ E    L    N +P    ++ D NG TP+  +V N +   V  L+   A +D  D++GRT  H+ A  G  +C++ LL +G     +   G  P+H +A  G+  +   LL + ++++ N    +N G TALH A
Sbjct:  434 KDKFGRSPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLL--IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWA 763          

HSP 2 Score: 95.5153 bits (236), Expect = 5.382e-19
Identity = 99/356 (27.81%), Postives = 165/356 (46.35%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN----NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGA----NFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE-LNAKL-DIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            ++R+ SG+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    NA V+  DGNG+T L L+V+  +    +C+   + +K   +   D  G   LH        + +V   +  ++ LL+       RD   RTP+ L+    H+  +  LL++ A    N  T D     ++H+ C  G+   +E+  +  VF+      T+ N  +P+  AV N NE   + LI+ L A + +  D  GRT  H AA     +CL+LLLS+     S    G  PL  AA  G     E+L+++ SA   +  ++NS  TALHLA  +       L++ K
Sbjct:  577 DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNA-VDIQDGNGQTPLMLSVLNGHT---DCVYSLL-NKGANVDAKDKWGRTALH--------RGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQK-----TEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASA--ELTLQDNSKNTALHLACSKGHETSALLILEK 912          

HSP 3 Score: 92.0485 bits (227), Expect = 5.754e-18
Identity = 100/410 (24.39%), Postives = 172/410 (41.95%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASM-IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGA--------------------------DIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYN-NVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQ-------YNVNLWKLNNDSN-----YPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            SY  L  A   G    VK LL+   D+ +     +  L   C+  +  V   L     +++   + G+T LH A+        L  L+    D+N ++ D ++ L +  ++      + + ++ A ++  D NG +P+H AA+    L     +       K G                           DID  D + R+ L  A    NL  +  L+  GA    KD  G S LHYA +N N + +  L+      +   D   CT L YA + + +   +E LL   +N    D +  NA H+++  G    LQ++            +   + +DS+      PLH A+Y GH++ +E L+      + +L+ ++ RNS+G+T L L+  K ++E   +L+  GA
Sbjct:  206 SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGS-GASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLV------QSLLD-LDVRNSSGRTPLDLAAFKGHVECVDVLINQGA 607          

HSP 4 Score: 90.5077 bits (223), Expect = 1.541e-17
Identity = 87/338 (25.74%), Postives = 154/338 (45.56%), Query Frame = 2
Query:  416 PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNM-EP---------------KEKILN-------FINHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            P  +R L+ K  D+N ++N+ R+ L  A    + E ++LL  + A VN  D   ++P+H A             E + +LLKH AD++  D   ++PL  A  +  +   + L+   + +   D +G + LH+A  +G+ E+                                  V+LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   +V++L+    +M EP               ++ ++N        +N +N  G T LH +    +  +C ++L+ NGAD N  ++  +GK+   MTAL
Sbjct:   21 PDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVA-------SCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEM----------------------------------VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN--MKSKDGKTPLHMTAL 315          

HSP 5 Score: 88.1965 bits (217), Expect = 9.639e-17
Identity = 90/368 (24.46%), Postives = 149/368 (40.49%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAX--------------------------XXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIP 1303
            T LH A+ +     +  L+     +N +++   + L  AV   + EAV++L +++A+VN  D N  +P+H AA  KA                                  E++ +LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +++ LL D   D+   ++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q + Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G D + P
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLL-DLGVDMNEPNAYGNTPLHVAC-YNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTP 401          

HSP 6 Score: 86.2705 bits (212), Expect = 3.653e-16
Identity = 98/414 (23.67%), Postives = 197/414 (47.58%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC-FK-YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLS-KNPD--INKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACI----YSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLER--GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A   G+++ ++ L+++  D+ DVR+ + +T L    FK +  CV+++++    +L        T +H A+       LR L+    P   ++ ++ + ++ L+L+V+  + + V  L    A V+  D  G + +H  A            E ++ LL+HGA     D   R+P+  +    ++  +  L++  A +     + D+ G + LH+A  NG+   +++LL+   F  + T+ N  + L  A   +N    E+L++    S VNA DSK R   H A+    ++ LQ+L  +N  +  +++    PL  A+  G    VE L+++   +  +      ++++  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  557 AAYHGHHQALEVLVQSLLDL-DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGA-------VTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVF--QKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTL------QDNSKNTALHLACSKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVL 953          

HSP 7 Score: 83.5741 bits (205), Expect = 2.098e-15
Identity = 93/388 (23.97%), Postives = 159/388 (40.98%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI-----EICKY--------------KKSVCQCKTYM------ELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSN-----CNEKIV-----------------------------KRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
             +D   +T LH +  L + E+ EL++      VN  D   LT LH  + S   E + +LLK++A+VN  D N +T L++A     +   E +   +++    + + D +G   LH+A      E+ K                +       YM      +LL+    ++ C+D+ S TPL  A +   +  V+ LL  G +    +      +H  C  G   + N+L +      N  +  G TP+ +A ++     C E +V                             + +I+  A +D  D+ G T  H AA  G    +  L++ G D   +   G  PLH AA  G+ +    LL   S+  +++  ++ G+T LH AA 
Sbjct:   36 FQDNEKRTPLHAAAYLGDAEIIELLILSGAR-VNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSN----VNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNEL-IDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLL---SSGFDIDTPDDFGRTCLHAAAA 414          

HSP 8 Score: 80.8777 bits (198), Expect = 1.451e-14
Identity = 100/409 (24.45%), Postives = 175/409 (42.79%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    + + V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       ++ LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +  K+  G + LH+A ++ +  +   LL     D+     +  T L     +      + +++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++         F I+  +  G+T LH +    NLE   +LL  GAD N   +   G+S      AN N   L  +  +G S +DL
Sbjct:   78 LHRAVASCSEEAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVKCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSS--------GFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKF--GRSPLHYAAANCNYQCLFALVGSGASVNDL 467          

HSP 9 Score: 78.5666 bits (192), Expect = 8.117e-14
Identity = 83/363 (22.87%), Postives = 149/363 (41.05%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA--------------------------IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+ +L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +  P+  GN PLH A                               +  +       +ELL+    D+  + +  +TPL +          +T++++GA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:  135 VSDRAGRTALHHAAFSGHGEMVKLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVK----YLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL-ITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAATSDTDGKCL 488          

HSP 10 Score: 77.0258 bits (188), Expect = 2.152e-13
Identity = 92/368 (25.00%), Postives = 160/368 (43.48%), Query Frame = 2
Query: 2087 GEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLA---VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHD-GTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G V +  D++G T LH + +   EL    L  +     K     +  LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  +     D  G  PLHYA   C Y     QC   +  L+     +   D    TPL  A   +   + +E LL+N AN   RD Q   +VHY            + SE  L++  + +   +  + D   T    ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K +     P+H AA  G+ E   +L+        V+ ++ +GQT L L+ +       + L++K + ++
Sbjct:  329 GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK----KDKFGRSPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRAT----ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVD 680          

HSP 11 Score: 60.8474 bits (146), Expect = 1.964e-8
Identity = 78/299 (26.09%), Postives = 126/299 (42.14%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFEL--ILKKTPEL---VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT-RDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            G+ E V + +  G +   +RD  G+T +H S     +  L  +L+    +       D    T LH    +     + LLL+        +GN  + L+ AVI +N  A E + D  T     +   D+ G  PLH A     +   V +C   ++LLL  N  +   D   +TPL++A        VE L+ + +  LT +D     ++H  CS+G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  697 GHEECVDALLQHGAKCL-LRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLID--TLGASIVNATDSKGRTPLHAA----AFTDHV-EC---LQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHET--SALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 981          

HSP 12 Score: 55.4546 bits (132), Expect = 8.284e-7
Identity = 81/331 (24.47%), Postives = 143/331 (43.20%), Query Frame = 2
Query:  212 GNNKKVKKLLENCTDVGDVRDLTDKTLLH--YCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINK----RNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSN---VNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYP-LHEASYKGHNEIVEFLITNMEP 1171
            G+   V  LL    +V D +D   +T LH      +E CV+ +L    + L   +  G T +HL++       L  LL     ++      +N   ++L  A    +   V+LL E       T+ N  SP+H A         +NE     ++   GA I +  D   R+PL  A  ++++  ++ L+   A + S DS+G + L  A  NG    ++ML+     +L   D++  TAL  ACS  +     L+LE+ ++   +NA ++  +   H A+  G    +Q L     ++  ++ +   P L  A  K   + +  ++  M P
Sbjct:  664 GHTDCVYSLLNKGANV-DAKDKWGRTALHRGAVTGHEECVDALLQHGAKCL-LRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAV------INDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILATMMP 985          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: EHMT2 (euchromatic histone lysine methyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:14129])

HSP 1 Score: 113.235 bits (282), Expect = 1.424e-24
Identity = 61/198 (30.81%), Postives = 111/198 (56.06%), Query Frame = 2
Query:  665 GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKG-HNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNL 1255
            GA+I+ +D  +R+PLM AV +N+L   ++++++G C+YSK+  G + LH+A   GNLE++ +LL   + D+   DS   T +++A  + +++V+ +LL RG++V   D++     H+AS  G     +VL     +L  +N   + PLH A+ +  H+ ++ FL     P+         RN  G TA  L+  + ++
Sbjct:  386 GANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPE--------LRNKEGDTAWDLTPERSDV 575          

HSP 2 Score: 80.8777 bits (198), Expect = 1.203e-14
Identity = 63/230 (27.39%), Postives = 103/230 (44.78%), Query Frame = 2
Query: 2402 IQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRND 3091
             Q    S   PLH A +    K SV  C     +LL+   +I   D+  RTPL+ A+  NH+E    +++ G    +++      +H+    GNLE+ + L      D N  D  G TPI +A  + + ++++ L+   A + + D       H A+  G+    E+LL+   D  +  + G  PLH AA   Y +   + L+  +   N   +N  G TA  L   R+D
Sbjct:  356 FQSDQQSKRTPLHAAAQ----KGSVEIC----HVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGA---NPELRNKEGDTAWDLTPERSD 574          

HSP 3 Score: 58.9214 bits (141), Expect = 6.395e-8
Identity = 41/163 (25.15%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  806 LHYATSNGNLE-IIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            L+ +   G L+ +I MLLD+   + ++   +  T L  A    +V++  +LL+ G+N+NA D ++R     A     L+  + + Q    ++    D +  LH A+  G+ E+V  L++  +        +N ++S G T +  +    ++E+ ++LL  GAD
Sbjct:  332 LYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVD------VNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGAD 488          

HSP 4 Score: 58.151 bits (139), Expect = 1.101e-7
Identity = 48/202 (23.76%), Postives = 92/202 (45.54%), Query Frame = 2
Query:  368 EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSN 973
            +++  T LH A+          LL    +IN  +   R+ L+ AV+ ++ E  + + +    V   + +G + +H+AAK+         L           D++  D    +P++WA    ++  ++ L+ +GA +   D+     LH+A+  G+  I ++LL + + DL   + +  T L  A   +  D V L L RG+N
Sbjct:  360 QQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQ------VDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLL-NARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGAN 554          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: nphp-2 (NePHronoPhthisis (Human kidney disease) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVZ6])

HSP 1 Score: 137.502 bits (345), Expect = 1.628e-32
Identity = 115/390 (29.49%), Postives = 185/390 (47.44%), Query Frame = 2
Query:  227 VKKLLENCTDVGDVRDLTDKTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITD-VNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDY-KFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKF 1384
            ++K+LE   +     +   K  +HY         ++L+      LLD  +  G T L  A M     +  +L +   D    +   R++L  AV+    +++      N EVN  D     +P+HYA      +  E    I+  LLKHGAD + +D   R+P+ W   + NL  +K L   G  +  +D   L+ILH A S+G  E+I+  L    K  ++  D    TAL YA S+ + +    LL+  +N N +D +   A H A+ KG ++ L++L Q+N +    N   + P HEA   G  ++VE+L+      E +L+  NH   NG+TA+HL+    NLE+  ILL        PL     +  T LDLA K +  +++V++
Sbjct:   18 IQKILEEHPEEASQPNEEKKVAIHYAAASGDLKTLKLVFLADRSLLDVKDATGQTPLLCALMAGKIENADFLANTGADAECHDEQGRNALHWAVVCGQLDSLNWAINKNVEVNAKDQYQRCTPLHYAT-CSEDIAPEVSQAILITLLKHGADPNAIDADDRTPIHWCSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVIEFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQNNANPNHQDQRLATAAHSAASKGQMRMLKLLKQFNASFDIQNYRGDLPFHEAVQAGSKDVVEWLLA---VDESVLDIPNH---NGRTAIHLAASVGNLEMV-ILLCTKKCFVDPLCSREKEIFTPLDLATK-QNHVVVVEY 398          

HSP 2 Score: 120.553 bits (301), Expect = 3.160e-27
Identity = 103/363 (28.37%), Postives = 171/363 (47.11%), Query Frame = 2
Query: 2120 KTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGN-YPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNV--TDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLAT 3193
            K  +HY+  + +L   +L+      L++  D T  T L   +M+ +IE    L    A+    D  GR AL+ AV+   L +L    ++  +K   +   D      PLHYA   C    +    +  +  LL+   D    D   RTP+    +  ++EA++ L  +G + L RD ++L  +H   S G  E+  + A+     P +   D  G T +FYA+S  + +   +L++ NA  +  DQ   T  H AA KG  + L+LL  +      + + G +P HEA   G K++ E LL    ++ ++   N++G+TA+HLAA   +  M  LL +K   ++ L   + + E  T  DLAT
Sbjct:   37 KVAIHYAAASGDLKTLKLVFLADRSLLDVKDATGQTPLLCALMAGKIENADFLANTGADAECHDEQGRNALHWAVVCGQLDSL----NWAINKNVEVNAKDQYQRCTPLHYAT--CSEDIAPEVSQAILITLLKHGADPNAIDADDRTPIHWCSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVI-EFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQNNANPNHQDQRLATAAHSAASKGQMRMLKLLKQFNASFDIQNYRGDLPFHEAVQAGSKDVVEWLLAVDESVLDI--PNHNGRTAIHLAASVGNLEMVILLCTKKCFVDPLC--SREKEIFTPLDLAT 388          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: nphp-2 (NePHronoPhthisis (Human kidney disease) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVZ6])

HSP 1 Score: 137.117 bits (344), Expect = 1.931e-32
Identity = 115/390 (29.49%), Postives = 185/390 (47.44%), Query Frame = 2
Query:  227 VKKLLENCTDVGDVRDLTDKTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITD-VNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDY-KFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKF 1384
            ++K+LE   +     +   K  +HY         ++L+      LLD  +  G T L  A M     +  +L +   D    +   R++L  AV+    +++      N EVN  D     +P+HYA      +  E    I+  LLKHGAD + +D   R+P+ W   + NL  +K L   G  +  +D   L+ILH A S+G  E+I+  L    K  ++  D    TAL YA S+ + +    LL+  +N N +D +   A H A+ KG ++ L++L Q+N +    N   + P HEA   G  ++VE+L+      E +L+  NH   NG+TA+HL+    NLE+  ILL        PL     +  T LDLA K +  +++V++
Sbjct:   18 IQKILEEHPEEASQPNEEKKVAIHYAAASGDLKTLKLVFLADRSLLDVKDATGQTPLLCALMAGKIENADFLANTGADAECHDEQGRNALHWAVVCGQLDSLNWAINKNVEVNAKDQYQRCTPLHYAT-CSEDIAPEVSQAILITLLKHGADPNAIDADDRTPIHWCSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVIEFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQNNANPNHQDQRLATAAHSAASKGQMRMLKLLKQFNASFDIQNYRGDLPFHEAVQAGSKDVVEWLLA---VDESVLDIPNH---NGRTAIHLAASVGNLEMV-ILLCTKKCFVDPLCSREKEIFTPLDLATK-QNHVVVVEY 398          

HSP 2 Score: 120.168 bits (300), Expect = 3.311e-27
Identity = 103/363 (28.37%), Postives = 171/363 (47.11%), Query Frame = 2
Query: 2120 KTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGN-YPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNV--TDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLAT 3193
            K  +HY+  + +L   +L+      L++  D T  T L   +M+ +IE    L    A+    D  GR AL+ AV+   L +L    ++  +K   +   D      PLHYA   C    +    +  +  LL+   D    D   RTP+    +  ++EA++ L  +G + L RD ++L  +H   S G  E+  + A+     P +   D  G T +FYA+S  + +   +L++ NA  +  DQ   T  H AA KG  + L+LL  +      + + G +P HEA   G K++ E LL    ++ ++   N++G+TA+HLAA   +  M  LL +K   ++ L   + + E  T  DLAT
Sbjct:   37 KVAIHYAAASGDLKTLKLVFLADRSLLDVKDATGQTPLLCALMAGKIENADFLANTGADAECHDEQGRNALHWAVVCGQLDSL----NWAINKNVEVNAKDQYQRCTPLHYAT--CSEDIAPEVSQAILITLLKHGADPNAIDADDRTPIHWCSSNGNLEAIKALYNSGGDLLCRDKEHLTILHCAASHGYHEVI-EFALKHVNKPFIDEIDRAGHTALFYAISFGHYESALKLLQNNANPNHQDQRLATAAHSAASKGQMRMLKLLKQFNASFDIQNYRGDLPFHEAVQAGSKDVVEWLLAVDESVLDI--PNHNGRTAIHLAASVGNLEMVILLCTKKCFVDPLC--SREKEIFTPLDLAT 388          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 102.064 bits (253), Expect = 2.163e-21
Identity = 105/377 (27.85%), Postives = 171/377 (45.36%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSK--NPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            Y+  L       + +V KLL + +   + R L   T LH   K      VEL+L     +  T E +G T LH+A+ +     + YLL +  NPD+     ++   L LA   +  + V++L  N A+V+       +P+H A+++          +I+ +LL+ GA+ +       SPL  A           L++  A        G + LH A+  GNLE++++LL+     D+E    N  T L  A  YNN  V  LLLE G++  A         H A+ K  ++    L Q+  +    +     PLH ++ +GH EI   LI N        + +  + +NG TA+HL   +D++ + +IL  NGA+ N
Sbjct:  359 YLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTE-SGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET--PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLG-------NTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE--GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENG-------SDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN 716          

HSP 2 Score: 100.138 bits (248), Expect = 1.024e-20
Identity = 101/385 (26.23%), Postives = 160/385 (41.56%), Query Frame = 2
Query: 2000 EITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM---NDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            ++T  Y   L  +   G+   V   + D       R  +G T LH + K   +   EL+LK     +    E+ LT LH+      I  +  LL+  AN +     G T L+LA   N    +  +      +  + R +Q P       LH A  +      +        LLL+   +     R + +PL +A      E    LL + A+      +    +H     GNLE+   L   E   P ++   N +TP+  A    N+K+   L+E  A      + G T  H AA+K   +    LL +  DP +K   G  PLH +A  G+KEI+ +L+   S   +V  K N+G TA+HL A  +  P+  +L +  ++IN
Sbjct:  354 DVTVDYLTPLHVAAHCGHVR-VAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYR-AAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTP-------LHIASRLGNTDIVI--------LLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL--LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS---DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN 716          

HSP 3 Score: 91.6633 bits (226), Expect = 4.013e-18
Identity = 99/380 (26.05%), Postives = 173/380 (45.53%), Query Frame = 2
Query:  293 LHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD-YKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA---NKNETKLLIVKFNGKSSDDLLK 1414
            LH   K+   +   L+LS    ++D+  K+  T LH A+       +  L+ +   I+ +  +  + L +A   D+ +A + L  + A V+   V+ ++P+H AA           + +  +LL   AD +   L   +PL  A   N +  ++ L++  A I +   SGL+ LH A   G + I+  LL      D+ET      T L  A   N  DVV +L+  G+ V+A+  + +   H AS  G+   + +L Q   N      D+  PLH A+ +G  E+   L+ +   K  +          G T LHL++   NLE+ ++LL+ G     P+ +     +T L +A   N ++  +L+++ NG S+    K
Sbjct:  264 LHVATKWGRTNMANLLLSRG-AIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCG-------HVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLL-------TKKGFTPLHLASKYGNLEVVRLLLERGT----PVDIEGKNQVTPLHVAAHYNNDKVAMLLLE-NGASAKAAAK 621          

HSP 4 Score: 89.3521 bits (220), Expect = 1.576e-17
Identity = 94/356 (26.40%), Postives = 159/356 (44.66%), Query Frame = 2
Query:  329 LILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-DDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI-----TNMEPKEKI--LNFINHRN-------------------SNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVS 1315
            L++  AP  +    KNG   LH+A+      + R LL     ++    D  + L +A    +    KLL + +A+ N   +NG +P+H A K       +N ++++ +LLK+ A I+       +PL  A     +  + +L+++GA    +   G + LH A      +++++L+ +  K D +  +    T L  A    N D+V LLL+ G+N NA      +  H A+ +G  +   +L  +N +   L      PLH AS  G+ E+V  L+      ++E K ++  L+   H N                    NG T LH++  K+ +EI   LLQ  ADPN   R  
Sbjct:  312 LVVQGAP--ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACK-------KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG 656          

HSP 5 Score: 88.9669 bits (219), Expect = 2.172e-17
Identity = 95/371 (25.61%), Postives = 157/371 (42.32%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-----DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
             L+A + G+ +KV +LL   TD+                                 +T   NG   LHLAS       +R L+ +   ++       ++L +A +      V +L EN A VN+  VNG +P++ AA+       EN  E++  LLKHGA+      DG      +PL  A+   +   +  L+E      SK    L  LH A    +     +LL + + + + T  +  T L  A  Y + +V +LLLE+G+NVN +     +  H A+  G      +L      +     D   PLH A+  GH+++V+ L+    P       I+ +  NG   LH++   D+++  + LL + A
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDI---------------------------------NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ-------ENHEEVVKYLLKHGANQALSTEDGF-----TPLAVALQQGHDRVVAVLLEND----SKGKVRLPALHIAAKKDDTTAATLLLQN-EHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAP-------ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA 350          

HSP 6 Score: 84.7297 bits (208), Expect = 4.423e-16
Identity = 89/353 (25.21%), Postives = 152/353 (43.06%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDV-GDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGE------KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLS 1237
            A +      V+ L+ N   V    R+L  +T LH   +  +   +IL     LL  G       ++ Y+ LH+A+          LL  N D         + L LA  Y N E V+LL E    V+I   N V+P+H AA            ++  +LL++GA          +PL  A   N +     L++  A   +K  +G + LH +   G+ EI  +L+++   D+    +N  TA+      ++V V ++L   G+ +N++ +      H A   G L  ++ L +   ++ +    S  PLH+A+ +GHN  V +L+ N           N + + GQT L ++
Sbjct:  465 AARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVIL-----LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYN-------NDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS-DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASP-------NEQTATGQTPLSIA 795          

HSP 7 Score: 82.0333 bits (201), Expect = 2.738e-15
Identity = 103/393 (26.21%), Postives = 155/393 (39.44%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHY-SLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLA----------VIYNN-------LAALE--CMNDYITDKTRFIQ------IPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDS 3127
            L  + + G+ E+V   I    +V +   + G T LH  SL  + L   IL +    VN       T L+M       E +  LLK+ AN      +G T L +A          V+  N       L AL      D  T  T  +Q      +   SG  PLH A             +   +LLLE   ++  + R + +PL +A           LL  GA   +R    L  +H     G+ ++ + L V +    +    NGL P+  A    +    + L+   A +D V     T  H AA  G  +  +LLL    DP S+  +G  PLH A  +   ++ E+LL   +AIE   E   SG T LH+AA      +   L+ + +
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQV-DAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGH--------ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVD-LLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTE---SGLTPLHVAAFMGAINIVIYLLQQGA 449          

HSP 8 Score: 77.7962 bits (190), Expect = 6.165e-14
Identity = 98/378 (25.93%), Postives = 164/378 (43.39%), Query Frame = 2
Query: 1988 RQIIE-ITESYKDYLFASCRIGNFEIVCSFIHDGG--EVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNG--DIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVR--NDC 3094
            R  IE  TES    L  +  +G   IV   +  G   +V  +R   G+T LH + +    ++  ++++   ++  +  E   T LH+       + + LLL+  AN N    +  + L++A           + D+  DKT   +     G  PLH A    KY          + LLLE     DIE +++V  TPL +A + N+ +    LL+NGA+           +H    +  +EI + L  F+  DPN     G TP+  +    +++I   LIE  + +      G T  H  A++      ++L + G +  SK + G  PLH A + G   + + L+   +   +V EK  +  T LH AA +  N+C
Sbjct:  415 RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK----KGFTPLHLA---SKYGN-----LEVVRLLLERGTPVDIEGKNQV--TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKA-DPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA---DVGEKTRASYTPLHQAAQQGHNNC 770          

HSP 9 Score: 73.9442 bits (180), Expect = 9.650e-13
Identity = 85/334 (25.45%), Postives = 138/334 (41.32%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPE--LVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNN-LAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMEL---LLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            L  + R+GN +IV   +  G   S    +   + LH + K   +E+  ++L    +  L+ K      T LH+      +E + LLL+    V+    N  T L++A  YNN   A+  + +  + K         +G  PLH A +           K  ME+   LL+   D   + R   TPL L+    H E    L++NG++   +    L ++H    E ++ +  Q+      + N     G TP+  A       +VK L+E  A +    +   T  H+AA++G   C+  LL  G  P  +   G  PL  A   GY  + E L
Sbjct:  495 LHIASRLGNTDIVILLLQAGAN-SNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK---KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-----KNGYTPLHIAAK-----------KNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPV-AQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 10 Score: 66.6254 bits (161), Expect = 1.589e-10
Identity = 74/301 (24.58%), Postives = 127/301 (42.19%), Query Frame = 2
Query: 2192 VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI-----EICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            +N  +   L  LH+       E +  L+K  A V+     G TAL++A    +LA    +   + +    + +   +G  PL+ A      E+ KY             LL+   +         TPL +A+   H   V  LL+N +    R    L ++H    + +      L   E+ +P+VT  +G TP+  A    +E + + L+E  A ++   ++  +  H A + G      LLLS G    S+  D   PLH AA  G+ ++ ++L+   + I   + K  +G   LH+AA
Sbjct:   59 INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIA----SLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKY-------------LLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEH-NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPI---SAKTKNGLAPLHMAA 334          

HSP 11 Score: 55.0694 bits (131), Expect = 5.121e-7
Identity = 54/233 (23.18%), Postives = 106/233 (45.49%), Query Frame = 2
Query:  755 IEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-------------------MEPKEKILNFINHRNSNGQT---ALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVK 1381
            ++  A      + G +    A   G+LE +  LL     D+ T+++N   +L  A    + +VV  L++R + V+A   K   A H AS  G+  +  + V +  NVN+  +N  +  PL+ A+ + H E+V++L+ +                    +  ++++  +   +S G+    ALH++  KD+     +LLQN  +P++  +        A    ++N  +LL+ K
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLR-AGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT--PLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEK 249          

HSP 12 Score: 53.5286 bits (127), Expect = 1.385e-6
Identity = 49/186 (26.34%), Postives = 81/186 (43.55%), Query Frame = 2
Query: 2558 LLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLI 3115
             L A     +E V  LL+ G +  T +   L S+H    EG+ E+  +L +      +     G T +  A       IV  L+E  A +++    G T  + AA++   + ++ LL +G +      DG  PL  A  +G+  +  +LL      EN + K      ALH+AA ++D     LL+
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVREL-IKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL------EN-DSKGKVRLPALHIAAKKDDTTAATLLL 214          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 102.064 bits (253), Expect = 2.163e-21
Identity = 105/377 (27.85%), Postives = 171/377 (45.36%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSK--NPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            Y+  L       + +V KLL + +   + R L   T LH   K      VEL+L     +  T E +G T LH+A+ +     + YLL +  NPD+     ++   L LA   +  + V++L  N A+V+       +P+H A+++          +I+ +LL+ GA+ +       SPL  A           L++  A        G + LH A+  GNLE++++LL+     D+E    N  T L  A  YNN  V  LLLE G++  A         H A+ K  ++    L Q+  +    +     PLH ++ +GH EI   LI N        + +  + +NG TA+HL   +D++ + +IL  NGA+ N
Sbjct:  359 YLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTE-SGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET--PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLG-------NTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE--GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENG-------SDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN 716          

HSP 2 Score: 100.138 bits (248), Expect = 1.024e-20
Identity = 101/385 (26.23%), Postives = 160/385 (41.56%), Query Frame = 2
Query: 2000 EITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM---NDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            ++T  Y   L  +   G+   V   + D       R  +G T LH + K   +   EL+LK     +    E+ LT LH+      I  +  LL+  AN +     G T L+LA   N    +  +      +  + R +Q P       LH A  +      +        LLL+   +     R + +PL +A      E    LL + A+      +    +H     GNLE+   L   E   P ++   N +TP+  A    N+K+   L+E  A      + G T  H AA+K   +    LL +  DP +K   G  PLH +A  G+KEI+ +L+   S   +V  K N+G TA+HL A  +  P+  +L +  ++IN
Sbjct:  354 DVTVDYLTPLHVAAHCGHVR-VAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYR-AAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTP-------LHIASRLGNTDIVI--------LLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL--LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS---DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN 716          

HSP 3 Score: 91.6633 bits (226), Expect = 4.013e-18
Identity = 99/380 (26.05%), Postives = 173/380 (45.53%), Query Frame = 2
Query:  293 LHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD-YKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA---NKNETKLLIVKFNGKSSDDLLK 1414
            LH   K+   +   L+LS    ++D+  K+  T LH A+       +  L+ +   I+ +  +  + L +A   D+ +A + L  + A V+   V+ ++P+H AA           + +  +LL   AD +   L   +PL  A   N +  ++ L++  A I +   SGL+ LH A   G + I+  LL      D+ET      T L  A   N  DVV +L+  G+ V+A+  + +   H AS  G+   + +L Q   N      D+  PLH A+ +G  E+   L+ +   K  +          G T LHL++   NLE+ ++LL+ G     P+ +     +T L +A   N ++  +L+++ NG S+    K
Sbjct:  264 LHVATKWGRTNMANLLLSRG-AIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCG-------HVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLL-------TKKGFTPLHLASKYGNLEVVRLLLERGT----PVDIEGKNQVTPLHVAAHYNNDKVAMLLLE-NGASAKAAAK 621          

HSP 4 Score: 89.3521 bits (220), Expect = 1.576e-17
Identity = 94/356 (26.40%), Postives = 159/356 (44.66%), Query Frame = 2
Query:  329 LILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-DDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI-----TNMEPKEKI--LNFINHRN-------------------SNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVS 1315
            L++  AP  +    KNG   LH+A+      + R LL     ++    D  + L +A    +    KLL + +A+ N   +NG +P+H A K       +N ++++ +LLK+ A I+       +PL  A     +  + +L+++GA    +   G + LH A      +++++L+ +  K D +  +    T L  A    N D+V LLL+ G+N NA      +  H A+ +G  +   +L  +N +   L      PLH AS  G+ E+V  L+      ++E K ++  L+   H N                    NG T LH++  K+ +EI   LLQ  ADPN   R  
Sbjct:  312 LVVQGAP--ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACK-------KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG 656          

HSP 5 Score: 88.9669 bits (219), Expect = 2.172e-17
Identity = 95/371 (25.61%), Postives = 157/371 (42.32%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-----DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
             L+A + G+ +KV +LL   TD+                                 +T   NG   LHLAS       +R L+ +   ++       ++L +A +      V +L EN A VN+  VNG +P++ AA+       EN  E++  LLKHGA+      DG      +PL  A+   +   +  L+E      SK    L  LH A    +     +LL + + + + T  +  T L  A  Y + +V +LLLE+G+NVN +     +  H A+  G      +L      +     D   PLH A+  GH+++V+ L+    P       I+ +  NG   LH++   D+++  + LL + A
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDI---------------------------------NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ-------ENHEEVVKYLLKHGANQALSTEDGF-----TPLAVALQQGHDRVVAVLLEND----SKGKVRLPALHIAAKKDDTTAATLLLQN-EHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAP-------ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRA 350          

HSP 6 Score: 84.7297 bits (208), Expect = 4.423e-16
Identity = 89/353 (25.21%), Postives = 152/353 (43.06%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDV-GDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGE------KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLS 1237
            A +      V+ L+ N   V    R+L  +T LH   +  +   +IL     LL  G       ++ Y+ LH+A+          LL  N D         + L LA  Y N E V+LL E    V+I   N V+P+H AA            ++  +LL++GA          +PL  A   N +     L++  A   +K  +G + LH +   G+ EI  +L+++   D+    +N  TA+      ++V V ++L   G+ +N++ +      H A   G L  ++ L +   ++ +    S  PLH+A+ +GHN  V +L+ N           N + + GQT L ++
Sbjct:  465 AARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVIL-----LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYN-------NDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS-DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASP-------NEQTATGQTPLSIA 795          

HSP 7 Score: 82.0333 bits (201), Expect = 2.738e-15
Identity = 103/393 (26.21%), Postives = 155/393 (39.44%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHY-SLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLA----------VIYNN-------LAALE--CMNDYITDKTRFIQ------IPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDS 3127
            L  + + G+ E+V   I    +V +   + G T LH  SL  + L   IL +    VN       T L+M       E +  LLK+ AN      +G T L +A          V+  N       L AL      D  T  T  +Q      +   SG  PLH A             +   +LLLE   ++  + R + +PL +A           LL  GA   +R    L  +H     G+ ++ + L V +    +    NGL P+  A    +    + L+   A +D V     T  H AA  G  +  +LLL    DP S+  +G  PLH A  +   ++ E+LL   +AIE   E   SG T LH+AA      +   L+ + +
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQV-DAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGH--------ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVD-LLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTE---SGLTPLHVAAFMGAINIVIYLLQQGA 449          

HSP 8 Score: 77.7962 bits (190), Expect = 6.165e-14
Identity = 98/378 (25.93%), Postives = 164/378 (43.39%), Query Frame = 2
Query: 1988 RQIIE-ITESYKDYLFASCRIGNFEIVCSFIHDGG--EVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNG--DIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVR--NDC 3094
            R  IE  TES    L  +  +G   IV   +  G   +V  +R   G+T LH + +    ++  ++++   ++  +  E   T LH+       + + LLL+  AN N    +  + L++A           + D+  DKT   +     G  PLH A    KY          + LLLE     DIE +++V  TPL +A + N+ +    LL+NGA+           +H    +  +EI + L  F+  DPN     G TP+  +    +++I   LIE  + +      G T  H  A++      ++L + G +  SK + G  PLH A + G   + + L+   +   +V EK  +  T LH AA +  N+C
Sbjct:  415 RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK----KGFTPLHLA---SKYGN-----LEVVRLLLERGTPVDIEGKNQV--TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKA-DPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA---DVGEKTRASYTPLHQAAQQGHNNC 770          

HSP 9 Score: 73.9442 bits (180), Expect = 9.650e-13
Identity = 85/334 (25.45%), Postives = 138/334 (41.32%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPE--LVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNN-LAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMEL---LLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            L  + R+GN +IV   +  G   S    +   + LH + K   +E+  ++L    +  L+ K      T LH+      +E + LLL+    V+    N  T L++A  YNN   A+  + +  + K         +G  PLH A +           K  ME+   LL+   D   + R   TPL L+    H E    L++NG++   +    L ++H    E ++ +  Q+      + N     G TP+  A       +VK L+E  A +    +   T  H+AA++G   C+  LL  G  P  +   G  PL  A   GY  + E L
Sbjct:  495 LHIASRLGNTDIVILLLQAGAN-SNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK---KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-----KNGYTPLHIAAK-----------KNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPV-AQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 10 Score: 66.6254 bits (161), Expect = 1.589e-10
Identity = 74/301 (24.58%), Postives = 127/301 (42.19%), Query Frame = 2
Query: 2192 VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI-----EICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            +N  +   L  LH+       E +  L+K  A V+     G TAL++A    +LA    +   + +    + +   +G  PL+ A      E+ KY             LL+   +         TPL +A+   H   V  LL+N +    R    L ++H    + +      L   E+ +P+VT  +G TP+  A    +E + + L+E  A ++   ++  +  H A + G      LLLS G    S+  D   PLH AA  G+ ++ ++L+   + I   + K  +G   LH+AA
Sbjct:   59 INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIA----SLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKY-------------LLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEH-NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPI---SAKTKNGLAPLHMAA 334          

HSP 11 Score: 55.0694 bits (131), Expect = 5.121e-7
Identity = 54/233 (23.18%), Postives = 106/233 (45.49%), Query Frame = 2
Query:  755 IEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-------------------MEPKEKILNFINHRNSNGQT---ALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVK 1381
            ++  A      + G +    A   G+LE +  LL     D+ T+++N   +L  A    + +VV  L++R + V+A   K   A H AS  G+  +  + V +  NVN+  +N  +  PL+ A+ + H E+V++L+ +                    +  ++++  +   +S G+    ALH++  KD+     +LLQN  +P++  +        A    ++N  +LL+ K
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLR-AGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT--PLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEK 249          

HSP 12 Score: 53.5286 bits (127), Expect = 1.385e-6
Identity = 49/186 (26.34%), Postives = 81/186 (43.55%), Query Frame = 2
Query: 2558 LLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLI 3115
             L A     +E V  LL+ G +  T +   L S+H    EG+ E+  +L +      +     G T +  A       IV  L+E  A +++    G T  + AA++   + ++ LL +G +      DG  PL  A  +G+  +  +LL      EN + K      ALH+AA ++D     LL+
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVREL-IKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL------EN-DSKGKVRLPALHIAAKKDDTTAATLLL 214          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 102.064 bits (253), Expect = 2.201e-21
Identity = 105/377 (27.85%), Postives = 171/377 (45.36%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSK--NPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            Y+  L       + +V KLL + +   + R L   T LH   K      VEL+L     +  T E +G T LH+A+ +     + YLL +  NPD+     ++   L LA   +  + V++L  N A+V+       +P+H A+++          +I+ +LL+ GA+ +       SPL  A           L++  A        G + LH A+  GNLE++++LL+     D+E    N  T L  A  YNN  V  LLLE G++  A         H A+ K  ++    L Q+  +    +     PLH ++ +GH EI   LI N        + +  + +NG TA+HL   +D++ + +IL  NGA+ N
Sbjct:  359 YLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTE-SGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGET--PLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLG-------NTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIE--GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENG-------SDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN 716          

HSP 2 Score: 99.7525 bits (247), Expect = 1.105e-20
Identity = 101/385 (26.23%), Postives = 160/385 (41.56%), Query Frame = 2
Query: 2000 EITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM---NDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            ++T  Y   L  +   G+   V   + D       R  +G T LH + K   +   EL+LK     +    E+ LT LH+      I  +  LL+  AN +     G T L+LA   N    +  +      +  + R +Q P       LH A  +      +        LLL+   +     R + +PL +A      E    LL + A+      +    +H     GNLE+   L   E   P ++   N +TP+  A    N+K+   L+E  A      + G T  H AA+K   +    LL +  DP +K   G  PLH +A  G+KEI+ +L+   S   +V  K N+G TA+HL A  +  P+  +L +  ++IN
Sbjct:  354 DVTVDYLTPLHVAAHCGHVR-VAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYR-AAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTP-------LHIASRLGNTDIVI--------LLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL--LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS---DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN 716          

HSP 3 Score: 91.2781 bits (225), Expect = 4.589e-18
Identity = 99/380 (26.05%), Postives = 173/380 (45.53%), Query Frame = 2
Query:  293 LHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD-YKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA---NKNETKLLIVKFNGKSSDDLLK 1414
            LH   K+   +   L+LS    ++D+  K+  T LH A+       +  L+ +   I+ +  +  + L +A   D+ +A + L  + A V+   V+ ++P+H AA           + +  +LL   AD +   L   +PL  A   N +  ++ L++  A I +   SGL+ LH A   G + I+  LL      D+ET      T L  A   N  DVV +L+  G+ V+A+  + +   H AS  G+   + +L Q   N      D+  PLH A+ +G  E+   L+ +   K  +          G T LHL++   NLE+ ++LL+ G     P+ +     +T L +A   N ++  +L+++ NG S+    K
Sbjct:  264 LHVATKWGRTNMANLLLSRG-AIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCG-------HVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGE--TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLL-------TKKGFTPLHLASKYGNLEVVRLLLERG----TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE-NGASAKAAAK 621          

HSP 4 Score: 89.3521 bits (220), Expect = 1.642e-17
Identity = 94/356 (26.40%), Postives = 159/356 (44.66%), Query Frame = 2
Query:  329 LILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-DDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI-----TNMEPKEKI--LNFINHRN-------------------SNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVS 1315
            L++  AP  +    KNG   LH+A+      + R LL     ++    D  + L +A    +    KLL + +A+ N   +NG +P+H A K       +N ++++ +LLK+ A I+       +PL  A     +  + +L+++GA    +   G + LH A      +++++L+ +  K D +  +    T L  A    N D+V LLL+ G+N NA      +  H A+ +G  +   +L  +N +   L      PLH AS  G+ E+V  L+      ++E K ++  L+   H N                    NG T LH++  K+ +EI   LLQ  ADPN   R  
Sbjct:  312 LVVQGAP--ISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACK-------KNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ--TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAG 656          

HSP 5 Score: 88.9669 bits (219), Expect = 2.169e-17
Identity = 94/367 (25.61%), Postives = 155/367 (42.23%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-----DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILL 1276
             L+A + G+ +KV +LL   TD+                                 +T   NG   LHLAS       +R L+ +   ++       ++L +A +      V +L EN A VN+  VNG +P++ AA+       EN  E++  LLKHGA+      DG      +PL  A+   +   +  L+E      SK    L  LH A    +     +LL + + + + T  +  T L  A  Y + +V +LLLE+G+NVN +     +  H A+  G      +L      +     D   PLH A+  GH+++V+ L+    P       I+ +  NG   LH++   D+++  + LL
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDI---------------------------------NTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQ-------ENHEEVVKYLLKHGANQALSTEDGF-----TPLAVALQQGHDRVVAVLLEND----SKGKVRLPALHIAAKKDDTTAATLLLQN-EHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAP-------ISAKTKNGLAPLHMAAQGDHVDAARTLL 346          

HSP 6 Score: 84.7297 bits (208), Expect = 4.379e-16
Identity = 89/353 (25.21%), Postives = 152/353 (43.06%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDV-GDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGE------KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLS 1237
            A +      V+ L+ N   V    R+L  +T LH   +  +   +IL     LL  G       ++ Y+ LH+A+          LL  N D         + L LA  Y N E V+LL E    V+I   N V+P+H AA            ++  +LL++GA          +PL  A   N +     L++  A   +K  +G + LH +   G+ EI  +L+++   D+    +N  TA+      ++V V ++L   G+ +N++ +      H A   G L  ++ L +   ++ +    S  PLH+A+ +GHN  V +L+ N           N + + GQT L ++
Sbjct:  465 AARANQTDVVRVLIRNGAKVDAQAREL--QTPLHIASRLGNTDIVIL-----LLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYN-------NDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGS-DVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASP-------NEQTATGQTPLSIA 795          

HSP 7 Score: 82.0333 bits (201), Expect = 3.182e-15
Identity = 103/393 (26.21%), Postives = 155/393 (39.44%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHY-SLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLA----------VIYNN-------LAALE--CMNDYITDKTRFIQ------IPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDS 3127
            L  + + G+ E+V   I    +V +   + G T LH  SL  + L   IL +    VN       T L+M       E +  LLK+ AN      +G T L +A          V+  N       L AL      D  T  T  +Q      +   SG  PLH A             +   +LLLE   ++  + R + +PL +A           LL  GA   +R    L  +H     G+ ++ + L V +    +    NGL P+  A    +    + L+   A +D V     T  H AA  G  +  +LLL    DP S+  +G  PLH A  +   ++ E+LL   +AIE   E   SG T LH+AA      +   L+ + +
Sbjct:   70 LHLASKEGHSEVVRELIKRQAQV-DAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGH--------ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVD-LLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTE---SGLTPLHVAAFMGAINIVIYLLQQGA 449          

HSP 8 Score: 77.7962 bits (190), Expect = 6.255e-14
Identity = 98/378 (25.93%), Postives = 164/378 (43.39%), Query Frame = 2
Query: 1988 RQIIE-ITESYKDYLFASCRIGNFEIVCSFIHDGG--EVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNG--DIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVR--NDC 3094
            R  IE  TES    L  +  +G   IV   +  G   +V  +R   G+T LH + +    ++  ++++   ++  +  E   T LH+       + + LLL+  AN N    +  + L++A           + D+  DKT   +     G  PLH A    KY          + LLLE     DIE +++V  TPL +A + N+ +    LL+NGA+           +H    +  +EI + L  F+  DPN     G TP+  +    +++I   LIE  + +      G T  H  A++      ++L + G +  SK + G  PLH A + G   + + L+   +   +V EK  +  T LH AA +  N+C
Sbjct:  415 RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVR---GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQ-TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK----KGFTPLHLA---SKYGN-----LEVVRLLLERGTPVDIEGKNQV--TPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKA-DPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGA---DVGEKTRASYTPLHQAAQQGHNNC 770          

HSP 9 Score: 73.9442 bits (180), Expect = 9.705e-13
Identity = 85/334 (25.45%), Postives = 138/334 (41.32%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPE--LVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNN-LAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMEL---LLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            L  + R+GN +IV   +  G   S    +   + LH + K   +E+  ++L    +  L+ K      T LH+      +E + LLL+    V+    N  T L++A  YNN   A+  + +  + K         +G  PLH A +           K  ME+   LL+   D   + R   TPL L+    H E    L++NG++   +    L ++H    E ++ +  Q+      + N     G TP+  A       +VK L+E  A +    +   T  H+AA++G   C+  LL  G  P  +   G  PL  A   GY  + E L
Sbjct:  495 LHIASRLGNTDIVILLLQAGAN-SNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK---KGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-----KNGYTPLHIAAK-----------KNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVA-QILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 10 Score: 66.6254 bits (161), Expect = 1.637e-10
Identity = 74/301 (24.58%), Postives = 127/301 (42.19%), Query Frame = 2
Query: 2192 VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI-----EICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            +N  +   L  LH+       E +  L+K  A V+     G TAL++A    +LA    +   + +    + +   +G  PL+ A      E+ KY             LL+   +         TPL +A+   H   V  LL+N +    R    L ++H    + +      L   E+ +P+VT  +G TP+  A    +E + + L+E  A ++   ++  +  H A + G      LLLS G    S+  D   PLH AA  G+ ++ ++L+   + I   + K  +G   LH+AA
Sbjct:   59 INTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIA----SLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKY-------------LLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVR----LPALHIAAKKDDTTAATLLLQNEH-NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPI---SAKTKNGLAPLHMAA 334          

HSP 11 Score: 55.0694 bits (131), Expect = 5.317e-7
Identity = 54/233 (23.18%), Postives = 106/233 (45.49%), Query Frame = 2
Query:  755 IEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-------------------MEPKEKILNFINHRNSNGQT---ALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVK 1381
            ++  A      + G +    A   G+LE +  LL     D+ T+++N   +L  A    + +VV  L++R + V+A   K   A H AS  G+  +  + V +  NVN+  +N  +  PL+ A+ + H E+V++L+ +                    +  ++++  +   +S G+    ALH++  KD+     +LLQN  +P++  +        A    ++N  +LL+ K
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLR-AGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT--PLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEK 249          

HSP 12 Score: 53.5286 bits (127), Expect = 1.487e-6
Identity = 49/186 (26.34%), Postives = 81/186 (43.55%), Query Frame = 2
Query: 2558 LLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLI 3115
             L A     +E V  LL+ G +  T +   L S+H    EG+ E+  +L +      +     G T +  A       IV  L+E  A +++    G T  + AA++   + ++ LL +G +      DG  PL  A  +G+  +  +LL      EN + K      ALH+AA ++D     LL+
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVREL-IKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLL------EN-DSKGKVRLPALHIAAKKDDTTAATLLL 214          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42534 (gene:FBgn0260487 transcript:FBtr0300898)

HSP 1 Score: 182.956 bits (463), Expect = 4.576e-46
Identity = 120/406 (29.56%), Postives = 202/406 (49.75%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVA-----PQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKV-KAXXXXXXXXXXXXXXXKHGADIDGL------------DLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
            L+ AC+ G+  +V   +    ++   RD + +  LHYC     E   +L+ + +     P+LL++ +++G+T LHLA +      +  LL+   D+N  +N+  S +  A +    E+++ +    A V   D NG +P+HYAA++  A  +   +    +   +   +I G+            D   R PL+WA  + +   +  L++ GA + S D  GL+ LH A S G+ E I  L+       +  DSN CTAL YA +  + D    LL+  ++ N +D K R   H    KG  + L++L +   NLW  N   + PLHEA+  G  E++E+L+    PK+     +N  +++G++ LH++   D  ++CK+LL  GAD N   R S G  +T LD A
Sbjct:  127 LMYACQRGDIVQVLAQMREKPELLRQRDRSHRNALHYCAAQDSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRAVLAAGASVAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLLA-QRPKQ-----VNTTSNDGRSLLHIAAANDYTDMCKLLLDYGADVNAVYRNSRGLVLTPLDGA 526          

HSP 2 Score: 171.014 bits (432), Expect = 2.232e-42
Identity = 129/445 (28.99%), Postives = 206/445 (46.29%), Query Frame = 2
Query: 1982 SKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHY-----SLKNKELFELILKKT--PELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYME------------LLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPDCKNT---LKTFGGRSAKKV 3250
            ++R++ E   S    L  +C+ G+   V + + +  E+   RD+S +  LHY     S  +K+L          PEL+   DE   T LH+ ++   +  + LLL N A+VN  D  G + ++ A +   + +L      +      +  PD +G  PLHYA ++C   K   + +                LL      ++ +D+  R PLL A +    +AV  L+K GA   + D   L ++H   S G+ E  + L        ++ D NG T + YAV+  +     RL++L A  +  D+ GRT  H    KG F+ L+LL   G + W +   G +PLHEAA  G +E+ E LL      + VN  +N G++ LH+AA  +   MC LL+   + +N +  N S    LT  D A     ++T   L+  GG+ A KV
Sbjct:  116 ARRRLAEGCTS----LMYACQRGDIVQVLAQMREKPELLRQRDRSHRNALHYCAAQDSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRA----VLAAGASVAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLLA--QRPKQVNTTSNDGRSLLHIAAANDYTDMCKLLLDYGADVNAVYRN-SRGLVLTPLDGALQRGHRSTAKFLQANGGQPANKV 549          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG42534 (gene:FBgn0260487 transcript:FBtr0309307)

HSP 1 Score: 179.874 bits (455), Expect = 4.214e-45
Identity = 115/380 (30.26%), Postives = 190/380 (50.00%), Query Frame = 2
Query:  269 RDLTDKTLLHYCFKY--ESCVELILSVA-----PQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKV-KAXXXXXXXXXXXXXXXKHGADIDGL------------DLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
            RD + +  LHYC     E   +L+ + +     P+LL++ +++G+T LHLA +      +  LL+   D+N  +N+  S +  A +    E+++ +    A V   D NG +P+HYAA++  A  +   +    +   +   +I G+            D   R PL+WA  + +   +  L++ GA + S D  GL+ LH A S G+ E I  L+       +  DSN CTAL YA +  + D    LL+  ++ N +D K R   H    KG  + L++L +   NLW  N   + PLHEA+  G  E++E+L+    PK+     +N  +++G++ LH++   D  ++CK+LL  GAD N   R S G  +T LD A
Sbjct:   28 RDRSHRNALHYCAAQDSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRAVLAAGASVAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLLA-QRPKQ-----VNTTSNDGRSLLHIAAANDYTDMCKLLLDYGADVNAVYRNSRGLVLTPLDGA 401          

HSP 2 Score: 166.007 bits (419), Expect = 7.135e-41
Identity = 121/404 (29.95%), Postives = 186/404 (46.04%), Query Frame = 2
Query: 2105 RDQSGKTLLHY-----SLKNKELFELILKKT--PELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYME------------LLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPDCKNTLKTF---GGRSAKKV 3250
            RD+S +  LHY     S  +K+L          PEL+   DE   T LH+ ++   +  + LLL N A+VN  D  G + ++ A +   + +L      +      +  PD +G  PLHYA ++C   K   + +                LL      ++ +D+  R PLL A +    +AV  L+K GA   + D   L ++H   S G+ E  + L        ++ D NG T + YAV+  +     RL++L A  +  D+ GRT  H    KG F+ L+LL   G + W +   G +PLHEAA  G +E+ E LL      + VN  +N G++ LH+AA  +   MC LL+   + +N +  N S    LT  D A     ++T K     GG+ A KV
Sbjct:   28 RDRSHRNALHYCAAQDSEGSKDLVAAASIAIAAPELLESADEDGFTPLHLAVIQGNLAMVNLLLANKADVNAVDNEGHSVVHWATVCGEVESLRA----VLAAGASVAKPDANGGTPLHYAAQMCGASKQDSKQQASSSNSSRLSLEILGILLSHPQSSVDVQDKDGRQPLLWAASAGSAKAVIALVKAGARVESSDKDGLTALHCAGSRGHTECIDTLIGLCGAPTDLIDSNGCTALHYAVTLGHADATARLLDLEADPNRQDRKGRTPAHCGCSKGQFETLKLLKERGANLWLRNAKGDLPLHEAAASGRRELLEWLL--AQRPKQVNTTSNDGRSLLHIAAANDYTDMCKLLLDYGADVNAVYRN-SRGLVLTPLDGALQRGHRSTAKFLQANGGQPANKV 424          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344222)

HSP 1 Score: 115.546 bits (288), Expect = 2.598e-25
Identity = 109/404 (26.98%), Postives = 180/404 (44.55%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKN--PDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGL--DLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            Y+  L       + +V KLL +     + R L   T LH   K      VEL+L     +  T E +G T LH+A+ +     + YLL  +  PD+     ++   L LA   +  + +++L  N A+V+       +P+H A+++         ++I+ +LL+HGA +D    D+Y  + L  A           LIE GA + +    G + LH     G++++ Q+LL   + D++    N  T L  AC YNN  V  LLLE+G++ +A         H A+ K  +     L +Y       +     PLH +S +GH EI   LI +          +NH   NG T +HL   +DN+ + +IL +NGA+ ++  +        A      N  + L+
Sbjct:  337 YLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTE-SGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGET--PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRL-------GNVDIVMLLLQHGAQVDATTKDMY--TALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQK-EADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHK-------AAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL 720          

HSP 2 Score: 96.6709 bits (239), Expect = 1.555e-19
Identity = 104/399 (26.07%), Postives = 171/399 (42.86%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLD------TGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSM-TALDLANK 1354
             +  L  A ++G++K V  LLE+     D R       LH   K +      +  A  LLD         K+G+T LH+AS          L+ K  D+N     + S L +A  +     V LL E    +     +G++P+H AA+           +++++LL+ GA I        +PL  A    ++   + L+   A +       L+ LH A   G++ + ++LL D   D      N  T L  AC  N + VVELLL  G++++A         H A+  G +  +  L Q++ +          PLH A+     +I+  L+ N          ++ R    QT LH+++   N++I  +LLQ+GA  +     +  K M TAL +A K
Sbjct:  143 GFTPLAVAMQQGHDKVVAVLLES-----DTRGKVRLPALHIAAKKDD-----VKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAAR-------SGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLL-DRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ-------VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVD-----ATTKDMYTALHIAAK 511          

HSP 3 Score: 92.8189 bits (229), Expect = 2.369e-18
Identity = 80/308 (25.97%), Postives = 141/308 (45.78%), Query Frame = 2
Query:  371 KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            ++G T LH A+       +  LL +   I+ +  +  + L +A   ++ +A ++L  + A V+   V+ ++ +H AA           + +  +LL   AD +   L   +PL  A   N L  ++ L+  GA I +   SGL+ LH A   G + I+  LL  D   D+ T      T L  A   N  D++ +LL  G+ V+A   +++   H AS  G++  + +L Q+   +     D    LH A+ +G +E+   LI N          ++     G T LHL+    ++++ ++LLQ  AD
Sbjct:  269 RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHC-------GHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENG-------AALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD 560          

HSP 4 Score: 90.1225 bits (222), Expect = 1.323e-17
Identity = 83/315 (26.35%), Postives = 143/315 (45.40%), Query Frame = 2
Query:  356 LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSG---LSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            ++T   NG   LHLAS       +  LL +   ++       ++L +A +    E VKLL E+NA VN+   NG +P++ AA  +   +    L + N   +  A  DG      +PL  A+   +   +  L+E        D+ G   L  LH A    +++   +LLD D+  D+  T  +  T L  A  Y N ++  LL+++G++VN       +  H A+  G    + +L +   N+     D   PLH A+  GH ++V+ L+    P       I+ +  NG   LH++   ++++  +ILL + A
Sbjct:   37 INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAA--QENHDAVVRLLLSNGANQSLATEDGF-----TPLAVAMQQGHDKVVAVLLE-------SDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDV--TSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAP-------ISAKTKNGLAPLHMAAQGEHVDAARILLYHRA 328          

HSP 5 Score: 90.1225 bits (222), Expect = 1.501e-17
Identity = 101/405 (24.94%), Postives = 164/405 (40.49%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFE---LILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALE---------------------------CMND--YITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANF--LTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            L  + R G+ ++V   +  G  +S  + ++G   LH + + + +     L+  + P  V++     LT LH+      +    LLL  NA+ N    NG T L++A   N L  +E                           CMN   Y+        +P   G  PLH A        +       + +LL     ++ R R  +TPL +A  + +V+ V  LL++GA     T+D+    ++H    EG  E+   L   EN    +     G TP+       + K+ + L++  A +D   + G T  H A      +   LLL  G  P +   +G  PLH AA +   +IA  LL    A+ N   K  +G T LHL++      +  LLI   + +N
Sbjct:  275 LHCAARSGHEQVVDMLLERGAPIS-AKTKNGLAPLHMAAQGEHVDAARILLYHRAP--VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLA--------ARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDM--YTALHIAAKEGQDEVAAVL--IENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEY-GALANAESK--AGFTPLHLSSQEGHAEISNLLIEHKAAVN 661          

HSP 6 Score: 89.7373 bits (221), Expect = 1.822e-17
Identity = 90/352 (25.57%), Postives = 148/352 (42.05%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            L  + R    +I+   + +G +V + R +  +T LH +  L N ++  L+L+   + V+   +   T LH+     + E   +L++N A ++     G T L+L   Y ++   + +     D    +     +G  PLH A   C Y            LLLE         +   TPL +A   N ++   TLL+ GA            +H    EG+ EI N L +      N    NGLTP+       N  + + L +  A +D+  + G T  H A+  G    +  LL  G +  +    G  PLH+ A +G+  I  +LL   +   N N +  +GQT LH+A
Sbjct:  440 LHLAARANQTDIIRILLRNGAQV-DARAREQQTPLHIASRLGNVDIVMLLLQHGAQ-VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD----VDAQGKNGVTPLHVA---CHYNNQQVAL-----LLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISN-LLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKA---NANAQTVNGQTPLHIA 773          

HSP 7 Score: 89.3521 bits (220), Expect = 2.212e-17
Identity = 87/332 (26.20%), Postives = 143/332 (43.07%), Query Frame = 2
Query: 2252 IERLPLLLKNNANVNFPDGNGRTALNLAV------IYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGAN--------FL---------------------TRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINEL 3142
            +ER+   LKNN ++N  + NG  AL+LA       + + L     + D  T K          GN  LH A        S+   +  ++LLLE N  +  + +   TPL +A   NH   V  LL NGAN        F                      TR    L ++H    + +++    L +  + +P+VT  +G TP+  A    N+ I   LI+  A ++   ++  +  H AA+ G    + LLL  G +  +K  DG  PLH AA  G++++ ++LL   + I   + K  +G   LH+AA         +L+   + ++E+
Sbjct:   24 LERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKK----------GNTALHIA--------SLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAAT-LLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI---SAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEV 333          

HSP 8 Score: 88.1965 bits (217), Expect = 4.967e-17
Identity = 89/350 (25.43%), Postives = 142/350 (40.57%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDK---TLLHYCFKY-ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLS 1237
            A + GN   V  LL++   V    D T K   T LH   K  +  V  +L      LD   K G+T LHL +        + LL K  D++ +  +  + L +A  Y+N +   LL E  A  + T  NG +P+H AA+                                         N +     L+E GA   ++  +G + LH ++  G+ EI  +L+ ++K  +     N  T +      +NV+V E+L + G+N++          H AS  G    ++ L Q   N+    +    PLH+ + +GH  IV  L+      E   N  N +  NGQT LH++
Sbjct:  476 ASRLGNVDIVMLLLQHGAQV----DATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAAR----------------------------------------KNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI-EHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLL------EHKAN-ANAQTVNGQTPLHIA 773          

HSP 9 Score: 79.337 bits (194), Expect = 2.738e-14
Identity = 103/430 (23.95%), Postives = 179/430 (41.63%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDK---TLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLS--KNPDINKRN----------------------NDSRSSLLLAVIY-----DNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD--------------------------------YKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLIT-NMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            A K+G+   V +LL      G + D   K   T LH       E  V+L+L     + +   +NG+T L++A+       +R LLS   N  +   +                      +D+R  + L  ++     D+ +A  LL +N+   ++T  +G +P+H A+             I N+L++ GAD++    +  SPL  A        +  L+EKG  I +K   GL+ LH A  +G+ +++ MLL+                                 ++  ++    +  TAL  A    +V V +LLL+R ++ NA         H A  K  LK +++L ++  ++         PLH A++ G   IV +L+  +  P    +         G+T LHL+   +  +I +ILL+NGA
Sbjct:   51 ASKDGHIHVVSELLRR----GAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASV-NVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHY-------GNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTV--------RGETPLHLAARANQTDIIRILLRNGA 460          

HSP 10 Score: 72.7886 bits (177), Expect = 2.817e-12
Identity = 81/325 (24.92%), Postives = 134/325 (41.23%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGK---TLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNV--TDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGY 2983
            L  + R+GN +IV   +  G +V    D + K   T LH + K  ++    +L +    ++   +   T LH+      I+   LLL+  A+V+    NG T L++A  YNN    + +   + +K         +G+ PLH A      +K+     T    LLE         +   TPL L+    H E    L+++ A         L  +H    E N+   N   + E    N+      G TP+  A       +V+ L++  A +D     G T  H+ A++G    + LLL +  +  ++  +G  PLH A   GY
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQV----DATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNN----QQVALLLLEKGASPHATAKNGHTPLHIA-----ARKNQMDIATT---LLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNV---NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGY 778          

HSP 11 Score: 71.2478 bits (173), Expect = 8.711e-12
Identity = 76/305 (24.92%), Postives = 119/305 (39.02%), Query Frame = 2
Query: 2213 NLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDS 3127
             L  LH+     +++   LLL N+ N +    +G T L++A  Y N    + + + +  K   +         PLH A    K+ K+       + LLLE  G+IE + R   TPL  A    H + V+ LL+ GA                                    +    NGL P+  A    +    + L+   A +D V     T  H AA  G  +  +LLL    D  ++  +G  PLH A  +   ++ E+LL   ++I    E   SG T LH+AA      +   L+  D+
Sbjct:  172 RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN----QNIANLLIQKGADVNYSAKHNISPLHVA---AKWGKT-----NMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI----------------------------------SAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTE---SGLTPLHVAAFMGCMNIVIYLLQHDA 427          

HSP 12 Score: 62.7734 bits (151), Expect = 3.139e-9
Identity = 56/217 (25.81%), Postives = 104/217 (47.93%), Query Frame = 2
Query:  815 ATSNGNLEIIQMLLDDYK--FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-------------------MEPKEKILNFINHRNSNGQT---ALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA----NKNETKLLIVK 1381
            A   GNLE +   L+  K   D+ T+++N   AL  A    ++ VV  LL RG+ V++   K   A H AS  G  + +++L ++N ++   + +   PL+ A+ + H+ +V  L++N                    +  +K++  +   ++ G+    ALH++  KD+++   +LL N  +P+    V++    T L +A    N+N   LLI K
Sbjct:   18 AARAGNLERV---LEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPD----VTSKSGFTPLHIASHYGNQNIANLLIQK 227          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 115.161 bits (287), Expect = 3.076e-25
Identity = 109/404 (26.98%), Postives = 180/404 (44.55%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLS--KNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGL--DLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            Y+  L       + +V KLL +     + R L   T LH   K      VEL+L     +  T E +G T LH+A+ +     + YLL    +PD+     ++   L LA   +  + +++L  N A+V+       +P+H A+++         ++I+ +LL+HGA +D    D+Y  + L  A           LIE GA + +    G + LH     G++++ Q+LL   + D++    N  T L  AC YNN  V  LLLE+G++ +A         H A+ K  +     L +Y       +     PLH +S +GH EI   LI +          +NH   NG T +HL   +DN+ + +IL +NGA+ ++  +        A      N  + L+
Sbjct:  337 YLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTE-SGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGET--PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRL-------GNVDIVMLLLQHGAQVDATTKDMY--TALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQK-EADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHK-------AAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL 720          

HSP 2 Score: 96.2857 bits (238), Expect = 1.817e-19
Identity = 104/399 (26.07%), Postives = 171/399 (42.86%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLD------TGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSM-TALDLANK 1354
             +  L  A ++G++K V  LLE+     D R       LH   K +      +  A  LLD         K+G+T LH+AS          L+ K  D+N     + S L +A  +     V LL E    +     +G++P+H AA+           +++++LL+ GA I        +PL  A    ++   + L+   A +       L+ LH A   G++ + ++LL D   D      N  T L  AC  N + VVELLL  G++++A         H A+  G +  +  L Q++ +          PLH A+     +I+  L+ N          ++ R    QT LH+++   N++I  +LLQ+GA  +     +  K M TAL +A K
Sbjct:  143 GFTPLAVAMQQGHDKVVAVLLES-----DTRGKVRLPALHIAAKKDD-----VKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAAR-------SGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLL-DRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNG-------AQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVD-----ATTKDMYTALHIAAK 511          

HSP 3 Score: 92.4337 bits (228), Expect = 2.440e-18
Identity = 80/308 (25.97%), Postives = 141/308 (45.78%), Query Frame = 2
Query:  371 KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            ++G T LH A+       +  LL +   I+ +  +  + L +A   ++ +A ++L  + A V+   V+ ++ +H AA           + +  +LL   AD +   L   +PL  A   N L  ++ L+  GA I +   SGL+ LH A   G + I+  LL  D   D+ T      T L  A   N  D++ +LL  G+ V+A   +++   H AS  G++  + +L Q+   +     D    LH A+ +G +E+   LI N          ++     G T LHL+    ++++ ++LLQ  AD
Sbjct:  269 RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHC-------GHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENG-------AALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD 560          

HSP 4 Score: 90.1225 bits (222), Expect = 1.352e-17
Identity = 83/315 (26.35%), Postives = 143/315 (45.40%), Query Frame = 2
Query:  356 LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSG---LSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            ++T   NG   LHLAS       +  LL +   ++       ++L +A +    E VKLL E+NA VN+   NG +P++ AA  +   +    L + N   +  A  DG      +PL  A+   +   +  L+E        D+ G   L  LH A    +++   +LLD D+  D+  T  +  T L  A  Y N ++  LL+++G++VN       +  H A+  G    + +L +   N+     D   PLH A+  GH ++V+ L+    P       I+ +  NG   LH++   ++++  +ILL + A
Sbjct:   37 INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAA--QENHDAVVRLLLSNGANQSLATEDGF-----TPLAVAMQQGHDKVVAVLLE-------SDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDV--TSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAP-------ISAKTKNGLAPLHMAAQGEHVDAARILLYHRA 328          

HSP 5 Score: 89.7373 bits (221), Expect = 1.878e-17
Identity = 101/405 (24.94%), Postives = 164/405 (40.49%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFE---LILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALE---------------------------CMND--YITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANF--LTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            L  + R G+ ++V   +  G  +S  + ++G   LH + + + +     L+  + P  V++     LT LH+      +    LLL  NA+ N    NG T L++A   N L  +E                           CMN   Y+        +P   G  PLH A        +       + +LL     ++ R R  +TPL +A  + +V+ V  LL++GA     T+D+    ++H    EG  E+   L   EN    +     G TP+       + K+ + L++  A +D   + G T  H A      +   LLL  G  P +   +G  PLH AA +   +IA  LL    A+ N   K  +G T LHL++      +  LLI   + +N
Sbjct:  275 LHCAARSGHEQVVDMLLERGAPIS-AKTKNGLAPLHMAAQGEHVDAARILLYHRAP--VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLA--------ARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDM--YTALHIAAKEGQDEVAAVL--IENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEY-GALANAESK--AGFTPLHLSSQEGHAEISNLLIEHKAAVN 661          

HSP 6 Score: 89.3521 bits (220), Expect = 2.338e-17
Identity = 90/352 (25.57%), Postives = 148/352 (42.05%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            L  + R    +I+   + +G +V + R +  +T LH +  L N ++  L+L+   + V+   +   T LH+     + E   +L++N A ++     G T L+L   Y ++   + +     D    +     +G  PLH A   C Y            LLLE         +   TPL +A   N ++   TLL+ GA            +H    EG+ EI N L +      N    NGLTP+       N  + + L +  A +D+  + G T  H A+  G    +  LL  G +  +    G  PLH+ A +G+  I  +LL   +   N N +  +GQT LH+A
Sbjct:  440 LHLAARANQTDIIRILLRNGAQV-DARAREQQTPLHIASRLGNVDIVMLLLQHGAQ-VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD----VDAQGKNGVTPLHVA---CHYNNQQVAL-----LLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISN-LLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKA---NANAQTVNGQTPLHIA 773          

HSP 7 Score: 89.3521 bits (220), Expect = 2.676e-17
Identity = 87/332 (26.20%), Postives = 143/332 (43.07%), Query Frame = 2
Query: 2252 IERLPLLLKNNANVNFPDGNGRTALNLAV------IYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGAN--------FL---------------------TRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINEL 3142
            +ER+   LKNN ++N  + NG  AL+LA       + + L     + D  T K          GN  LH A        S+   +  ++LLLE N  +  + +   TPL +A   NH   V  LL NGAN        F                      TR    L ++H    + +++    L +  + +P+VT  +G TP+  A    N+ I   LI+  A ++   ++  +  H AA+ G    + LLL  G +  +K  DG  PLH AA  G++++ ++LL   + I   + K  +G   LH+AA         +L+   + ++E+
Sbjct:   24 LERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKK----------GNTALHIA--------SLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAAT-LLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI---SAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEV 333          

HSP 8 Score: 88.1965 bits (217), Expect = 5.432e-17
Identity = 89/350 (25.43%), Postives = 142/350 (40.57%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDK---TLLHYCFKY-ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLS 1237
            A + GN   V  LL++   V    D T K   T LH   K  +  V  +L      LD   K G+T LHL +        + LL K  D++ +  +  + L +A  Y+N +   LL E  A  + T  NG +P+H AA+                                         N +     L+E GA   ++  +G + LH ++  G+ EI  +L+ ++K  +     N  T +      +NV+V E+L + G+N++          H AS  G    ++ L Q   N+    +    PLH+ + +GH  IV  L+      E   N  N +  NGQT LH++
Sbjct:  476 ASRLGNVDIVMLLLQHGAQV----DATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAAR----------------------------------------KNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI-EHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLL------EHKAN-ANAQTVNGQTPLHIA 773          

HSP 9 Score: 78.9518 bits (193), Expect = 3.235e-14
Identity = 103/430 (23.95%), Postives = 179/430 (41.63%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDK---TLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLS--KNPDINKRN----------------------NDSRSSLLLAVIY-----DNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD--------------------------------YKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLIT-NMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            A K+G+   V +LL      G + D   K   T LH       E  V+L+L     + +   +NG+T L++A+       +R LLS   N  +   +                      +D+R  + L  ++     D+ +A  LL +N+   ++T  +G +P+H A+             I N+L++ GAD++    +  SPL  A        +  L+EKG  I +K   GL+ LH A  +G+ +++ MLL+                                 ++  ++    +  TAL  A    +V V +LLL+R ++ NA         H A  K  LK +++L ++  ++         PLH A++ G   IV +L+  +  P    +         G+T LHL+   +  +I +ILL+NGA
Sbjct:   51 ASKDGHIHVVSELLRR----GAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASV-NVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHY-------GNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTV--------RGETPLHLAARANQTDIIRILLRNGA 460          

HSP 10 Score: 72.4034 bits (176), Expect = 3.304e-12
Identity = 81/328 (24.70%), Postives = 134/328 (40.85%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGK---TLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMEL---LLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNV--TDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGY 2983
            L  + R+GN +IV   +  G +V    D + K   T LH + K  ++    +L +    ++   +   T LH+      I+   LLL+  A+V+    NG T L++A  YNN    + +   + +K         +G+ PLH A             K  M++   LLE         +   TPL L+    H E    L+++ A         L  +H    E N+   N   + E    N+      G TP+  A       +V+ L++  A +D     G T  H+ A++G    + LLL +  +  ++  +G  PLH A   GY
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQV----DATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNN----QQVALLLLEKGASPHATAKNGHTPLHIAAR-----------KNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNV---NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGY 778          

HSP 11 Score: 70.8626 bits (172), Expect = 1.048e-11
Identity = 76/305 (24.92%), Postives = 119/305 (39.02%), Query Frame = 2
Query: 2213 NLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDS 3127
             L  LH+     +++   LLL N+ N +    +G T L++A  Y N    + + + +  K   +         PLH A    K+ K+       + LLLE  G+IE + R   TPL  A    H + V+ LL+ GA                                    +    NGL P+  A    +    + L+   A +D V     T  H AA  G  +  +LLL    D  ++  +G  PLH A  +   ++ E+LL   ++I    E   SG T LH+AA      +   L+  D+
Sbjct:  172 RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN----QNIANLLIQKGADVNYSAKHNISPLHVA---AKWGKT-----NMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI----------------------------------SAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTE---SGLTPLHVAAFMGCMNIVIYLLQHDA 427          

HSP 12 Score: 62.7734 bits (151), Expect = 3.305e-9
Identity = 56/217 (25.81%), Postives = 104/217 (47.93%), Query Frame = 2
Query:  815 ATSNGNLEIIQMLLDDYK--FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-------------------MEPKEKILNFINHRNSNGQT---ALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA----NKNETKLLIVK 1381
            A   GNLE +   L+  K   D+ T+++N   AL  A    ++ VV  LL RG+ V++   K   A H AS  G  + +++L ++N ++   + +   PL+ A+ + H+ +V  L++N                    +  +K++  +   ++ G+    ALH++  KD+++   +LL N  +P+    V++    T L +A    N+N   LLI K
Sbjct:   18 AARAGNLERV---LEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPD----VTSKSGFTPLHIASHYGNQNIANLLIQK 227          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303122)

HSP 1 Score: 115.161 bits (287), Expect = 3.538e-25
Identity = 109/404 (26.98%), Postives = 180/404 (44.55%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKN--PDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGL--DLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            Y+  L       + +V KLL +     + R L   T LH   K      VEL+L     +  T E +G T LH+A+ +     + YLL  +  PD+     ++   L LA   +  + +++L  N A+V+       +P+H A+++         ++I+ +LL+HGA +D    D+Y  + L  A           LIE GA + +    G + LH     G++++ Q+LL   + D++    N  T L  AC YNN  V  LLLE+G++ +A         H A+ K  +     L +Y       +     PLH +S +GH EI   LI +          +NH   NG T +HL   +DN+ + +IL +NGA+ ++  +        A      N  + L+
Sbjct:  337 YLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTE-SGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGET--PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRL-------GNVDIVMLLLQHGAQVDATTKDMY--TALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQK-EADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHK-------AAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL 720          

HSP 2 Score: 96.2857 bits (238), Expect = 2.032e-19
Identity = 104/398 (26.13%), Postives = 171/398 (42.96%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLD------TGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSM-TALDLANK 1354
            +  L  A ++G++K V  LLE+     D R       LH   K +      +  A  LLD         K+G+T LH+AS          L+ K  D+N     + S L +A  +     V LL E    +     +G++P+H AA+           +++++LL+ GA I        +PL  A    ++   + L+   A +       L+ LH A   G++ + ++LL D   D      N  T L  AC  N + VVELLL  G++++A         H A+  G +  +  L Q++ +          PLH A+     +I+  L+ N          ++ R    QT LH+++   N++I  +LLQ+GA  +     +  K M TAL +A K
Sbjct:  144 FTPLAVAMQQGHDKVVAVLLES-----DTRGKVRLPALHIAAKKDD-----VKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAAR-------SGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLL-DRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ-------VDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVD-----ATTKDMYTALHIAAK 511          

HSP 3 Score: 92.4337 bits (228), Expect = 2.774e-18
Identity = 80/308 (25.97%), Postives = 141/308 (45.78%), Query Frame = 2
Query:  371 KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            ++G T LH A+       +  LL +   I+ +  +  + L +A   ++ +A ++L  + A V+   V+ ++ +H AA           + +  +LL   AD +   L   +PL  A   N L  ++ L+  GA I +   SGL+ LH A   G + I+  LL  D   D+ T      T L  A   N  D++ +LL  G+ V+A   +++   H AS  G++  + +L Q+   +     D    LH A+ +G +E+   LI N          ++     G T LHL+    ++++ ++LLQ  AD
Sbjct:  269 RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHC-------GHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE--TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENG-------AALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD 560          

HSP 4 Score: 90.1225 bits (222), Expect = 1.497e-17
Identity = 83/315 (26.35%), Postives = 143/315 (45.40%), Query Frame = 2
Query:  356 LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSG---LSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            ++T   NG   LHLAS       +  LL +   ++       ++L +A +    E VKLL E+NA VN+   NG +P++ AA  +   +    L + N   +  A  DG      +PL  A+   +   +  L+E        D+ G   L  LH A    +++   +LLD D+  D+  T  +  T L  A  Y N ++  LL+++G++VN       +  H A+  G    + +L +   N+     D   PLH A+  GH ++V+ L+    P       I+ +  NG   LH++   ++++  +ILL + A
Sbjct:   37 INTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAA--QENHDAVVRLLLSNGANQSLATEDGF-----TPLAVAMQQGHDKVVAVLLE-------SDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDV--TSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAP-------ISAKTKNGLAPLHMAAQGEHVDAARILLYHRA 328          

HSP 5 Score: 89.7373 bits (221), Expect = 1.864e-17
Identity = 101/405 (24.94%), Postives = 164/405 (40.49%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFE---LILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALE---------------------------CMND--YITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANF--LTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            L  + R G+ ++V   +  G  +S  + ++G   LH + + + +     L+  + P  V++     LT LH+      +    LLL  NA+ N    NG T L++A   N L  +E                           CMN   Y+        +P   G  PLH A        +       + +LL     ++ R R  +TPL +A  + +V+ V  LL++GA     T+D+    ++H    EG  E+   L   EN    +     G TP+       + K+ + L++  A +D   + G T  H A      +   LLL  G  P +   +G  PLH AA +   +IA  LL    A+ N   K  +G T LHL++      +  LLI   + +N
Sbjct:  275 LHCAARSGHEQVVDMLLERGAPIS-AKTKNGLAPLHMAAQGEHVDAARILLYHRAP--VDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLA--------ARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDM--YTALHIAAKEGQDEVAAVL--IENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEY-GALANAESK--AGFTPLHLSSQEGHAEISNLLIEHKAAVN 661          

HSP 6 Score: 89.3521 bits (220), Expect = 2.133e-17
Identity = 90/352 (25.57%), Postives = 148/352 (42.05%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            L  + R    +I+   + +G +V + R +  +T LH +  L N ++  L+L+   + V+   +   T LH+     + E   +L++N A ++     G T L+L   Y ++   + +     D    +     +G  PLH A   C Y            LLLE         +   TPL +A   N ++   TLL+ GA            +H    EG+ EI N L +      N    NGLTP+       N  + + L +  A +D+  + G T  H A+  G    +  LL  G +  +    G  PLH+ A +G+  I  +LL   +   N N +  +GQT LH+A
Sbjct:  440 LHLAARANQTDIIRILLRNGAQV-DARAREQQTPLHIASRLGNVDIVMLLLQHGAQ-VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD----VDAQGKNGVTPLHVA---CHYNNQQVAL-----LLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISN-LLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKA---NANAQTVNGQTPLHIA 773          

HSP 7 Score: 89.3521 bits (220), Expect = 2.483e-17
Identity = 87/332 (26.20%), Postives = 143/332 (43.07%), Query Frame = 2
Query: 2252 IERLPLLLKNNANVNFPDGNGRTALNLAV------IYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGAN--------FL---------------------TRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINEL 3142
            +ER+   LKNN ++N  + NG  AL+LA       + + L     + D  T K          GN  LH A        S+   +  ++LLLE N  +  + +   TPL +A   NH   V  LL NGAN        F                      TR    L ++H    + +++    L +  + +P+VT  +G TP+  A    N+ I   LI+  A ++   ++  +  H AA+ G    + LLL  G +  +K  DG  PLH AA  G++++ ++LL   + I   + K  +G   LH+AA         +L+   + ++E+
Sbjct:   24 LERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKK----------GNTALHIA--------SLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAAT-LLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI---SAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEV 333          

HSP 8 Score: 88.1965 bits (217), Expect = 5.624e-17
Identity = 89/350 (25.43%), Postives = 142/350 (40.57%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDK---TLLHYCFKY-ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLS 1237
            A + GN   V  LL++   V    D T K   T LH   K  +  V  +L      LD   K G+T LHL +        + LL K  D++ +  +  + L +A  Y+N +   LL E  A  + T  NG +P+H AA+                                         N +     L+E GA   ++  +G + LH ++  G+ EI  +L+ ++K  +     N  T +      +NV+V E+L + G+N++          H AS  G    ++ L Q   N+    +    PLH+ + +GH  IV  L+      E   N  N +  NGQT LH++
Sbjct:  476 ASRLGNVDIVMLLLQHGAQV----DATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAAR----------------------------------------KNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI-EHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLL------EHKAN-ANAQTVNGQTPLHIA 773          

HSP 9 Score: 78.9518 bits (193), Expect = 3.289e-14
Identity = 103/430 (23.95%), Postives = 179/430 (41.63%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDK---TLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLS--KNPDINKRN----------------------NDSRSSLLLAVIY-----DNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD--------------------------------YKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLIT-NMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            A K+G+   V +LL      G + D   K   T LH       E  V+L+L     + +   +NG+T L++A+       +R LLS   N  +   +                      +D+R  + L  ++     D+ +A  LL +N+   ++T  +G +P+H A+             I N+L++ GAD++    +  SPL  A        +  L+EKG  I +K   GL+ LH A  +G+ +++ MLL+                                 ++  ++    +  TAL  A    +V V +LLL+R ++ NA         H A  K  LK +++L ++  ++         PLH A++ G   IV +L+  +  P    +         G+T LHL+   +  +I +ILL+NGA
Sbjct:   51 ASKDGHIHVVSELLRR----GAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASV-NVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHY-------GNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTV--------RGETPLHLAARANQTDIIRILLRNGA 460          

HSP 10 Score: 72.4034 bits (176), Expect = 3.357e-12
Identity = 81/325 (24.92%), Postives = 134/325 (41.23%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGK---TLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNV--TDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGY 2983
            L  + R+GN +IV   +  G +V    D + K   T LH + K  ++    +L +    ++   +   T LH+      I+   LLL+  A+V+    NG T L++A  YNN    + +   + +K         +G+ PLH A      +K+     T    LLE         +   TPL L+    H E    L+++ A         L  +H    E N+   N   + E    N+      G TP+  A       +V+ L++  A +D     G T  H+ A++G    + LLL +  +  ++  +G  PLH A   GY
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQV----DATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNN----QQVALLLLEKGASPHATAKNGHTPLHIA-----ARKNQMDIATT---LLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNV---NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGY 778          

HSP 11 Score: 70.8626 bits (172), Expect = 1.055e-11
Identity = 76/305 (24.92%), Postives = 119/305 (39.02%), Query Frame = 2
Query: 2213 NLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDS 3127
             L  LH+     +++   LLL N+ N +    +G T L++A  Y N    + + + +  K   +         PLH A    K+ K+       + LLLE  G+IE + R   TPL  A    H + V+ LL+ GA                                    +    NGL P+  A    +    + L+   A +D V     T  H AA  G  +  +LLL    D  ++  +G  PLH A  +   ++ E+LL   ++I    E   SG T LH+AA      +   L+  D+
Sbjct:  172 RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGN----QNIANLLIQKGADVNYSAKHNISPLHVA---AKWGKT-----NMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPI----------------------------------SAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTE---SGLTPLHVAAFMGCMNIVIYLLQHDA 427          

HSP 12 Score: 62.3882 bits (150), Expect = 3.497e-9
Identity = 56/217 (25.81%), Postives = 104/217 (47.93%), Query Frame = 2
Query:  815 ATSNGNLEIIQMLLDDYK--FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-------------------MEPKEKILNFINHRNSNGQT---ALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA----NKNETKLLIVK 1381
            A   GNLE +   L+  K   D+ T+++N   AL  A    ++ VV  LL RG+ V++   K   A H AS  G  + +++L ++N ++   + +   PL+ A+ + H+ +V  L++N                    +  +K++  +   ++ G+    ALH++  KD+++   +LL N  +P+    V++    T L +A    N+N   LLI K
Sbjct:   18 AARAGNLERV---LEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPD----VTSKSGFTPLHIASHYGNQNIANLLIQK 227          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 112.079 bits (279), Expect = 3.786e-24
Identity = 105/369 (28.46%), Postives = 172/369 (46.61%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTG------EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            A +  + +    LL+N  +  DV   T  T LH    YE+     LSVA  LL+ G       KNG T LH+AS       +R LL +   I+ +  D  + L  A    +   V++L +  A +     NG+SP+H AA+        + ++ +  LL++ A+ID + L   +PL  A    +   +K L++KGA   ++  +G + LH A    ++  + +LL  +   LE    +  T L  A    ++++V+ LL+RG++ NA + K     H A+  G  +  Q L Q N  +     D   PLH A+  GH E+V+ L   ME K       +   + G T LH++  + + +  +ILL   A
Sbjct:  183 AARNDDTRTAAVLLQNDPNP-DVLSKTGFTPLHIAAHYEN-----LSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQ-------GDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLK-HSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLL---MEHKAN----PDSATTAGHTPLHIAAREGHAQTTRILLDENA 530          

HSP 2 Score: 100.523 bits (249), Expect = 1.080e-20
Identity = 96/361 (26.59%), Postives = 169/361 (46.81%), Query Frame = 2
Query:  212 GNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            G+++ VK LL+      + R L   T LH   K  +   ++L+L  +  L    E +G T LH+A+ +     ++ LL +    N  N    + L +A    + E  + L +NNA+V+    +  +P+H AA++          E++ +L++H A+ D       +PL  A    +    + L+++ A        G + LH A   G ++++++LL+    +      N  T L  A  +NN+DVV+LL+ +G + ++       A H A+ +  L+    L QY  N    +     PLH AS +G  ++V  LI+      K  N +N  N NG T LHL   + ++ I  +L++ GA
Sbjct:  352 GHHRMVKVLLDKGAKA-NARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMG-------HKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLE-RGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLIS------KQAN-VNLGNKNGLTPLHLVAQEGHVGIADMLVKQGA 695          

HSP 3 Score: 98.2117 bits (243), Expect = 5.901e-20
Identity = 94/384 (24.48%), Postives = 159/384 (41.41%), Query Frame = 2
Query: 1991 QIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALEC-MNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKI 3133
            +I +IT  +   L  +   G+  +V   + D G  +  R  +G T LH + K   +   +L+LK +  L     E+ LT LH+      +  +  LL+  A+ N  +    T L++A       A  C +  ++      +         PLH A  +          K  ++LL+E   + +       TPL +A    H +    LL   A       +    +H  C  G +++  +L +    +PN    NGLTP+  AV + N  +VK L+          + G T  H AA++   +    LL YG +  S+   G  PLH A+  G  ++  +L+   S   NVN  N +G T LHL A      +  +L+ + + +
Sbjct:  333 EIDDITLDHLTPLHVAAHCGHHRMVKVLL-DKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASL-EAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAA-----RAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGH--------KELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVV-ELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLI---SKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 697          

HSP 4 Score: 97.4413 bits (241), Expect = 9.716e-20
Identity = 81/330 (24.55%), Postives = 157/330 (47.58%), Query Frame = 2
Query:  386 VLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
             LH+A+      +   LL  +P+ +  +    + L +A  Y+N    +LL    A VN T  NG++P+H A++          + ++ +LL  GA ID     + +PL  A  + ++  ++ L+++GA + +K  +GLS +H A    +++ ++ LL  Y  +++    ++ T L  A    +  +V++LL++G+  NA         H A  K  ++++ +L +++ +L  +      PLH A++ GH  IV+ L+             N  N   +T LH++    + E+ + LLQN A  +   +        A  + +K   KLL+
Sbjct:  179 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASR-------RGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL-QYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASP-------NASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLM 493          

HSP 5 Score: 92.8189 bits (229), Expect = 2.271e-18
Identity = 87/315 (27.62%), Postives = 144/315 (45.71%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKR--SPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVS 1315
            T LH+A+        ++LL  N  ++ +  D ++ L  A    + E VKLL E+ A  +     G +P+H AA+          L+      K         + K+  +PL  A     +  ++ L+E+GA   +   +GL+ LH A  + NL+++++L+        +T  N  TAL  A   N ++V   LL+ G+N N+E  +     H AS  G+ D+  L +  Q NVNL   N +   PLH  + +GH  I + L+     K+    +   R   G T LH++    N+++ K LLQ  A  N   R+ 
Sbjct:  442 TPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTK---------MTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGG-SPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLG--NKNGLTPLHLVAQEGHVGIADMLV-----KQGASVYAASRM--GYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLG 737          

HSP 6 Score: 86.2705 bits (212), Expect = 2.344e-16
Identity = 80/323 (24.77%), Postives = 145/323 (44.89%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELIL--SVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI 1156
            A + G+ +  + LL+N   V D +   D+T LH   +  ++  V+L++     P   D+    G+T LH+A+      + R LL +N    K      + L +A  Y   + V+LL E  A  N    NG++P+H A  V        +L +      H    +G      + L  A   N L     L++ GA   S+   G++ LH A+  G  +++ +L+   + ++   + N  T L       +V + ++L+++G++V A         H A   G++K ++ L Q   ++         PLH+A+ +GH +IV  L+
Sbjct:  447 AARAGHCEVAQFLLQNNAQV-DAKAKDDQTPLHCAARMGHKELVKLLMEHKANP---DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVA--VHHNNLDVVKLLVSKGGSPHSTARNGY-----TALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK-QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 757          

HSP 7 Score: 84.7297 bits (208), Expect = 7.977e-16
Identity = 80/312 (25.64%), Postives = 134/312 (42.95%), Query Frame = 2
Query: 2213 NLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNY----PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
              T LH+      +  + LLLK++A++     +G T L++A    +L  ++ +               N+ N     PLH A      +   C+   +   LL+ N  ++ + +  +TPL  A  + H E V+ L+++ AN  +        +H    EG+ +   ++ + EN         G TP+  A       +V+ L+E  A  +   + G T  H A        ++LL+S G  P S   +G   LH AA +   E+A  LL   +   N N ++  G T LHLA+      M  LLISK + +N
Sbjct:  374 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASP--------NASNVKVETPLHMAA-----RAGHCEVAQF---LLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQT-TRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGA---NANSESLQGITPLHLASQEGQPDMVALLISKQANVN 665          

HSP 8 Score: 83.5741 bits (205), Expect = 1.568e-15
Identity = 95/378 (25.13%), Postives = 163/378 (43.12%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS-LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYIT---------------DKTRFIQI-------PD---NSGNYPLHYAIEICKYKK-SVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            L  + + G+ ++V   +H+G ++ E   + G T LH + L  +E     L      VN   +   + L+M      +E +  LL++ AN + P  +G T L +A+   +   +  + +Y T               D TR   +       PD    +G  PLH A     Y+  SV Q      LLL    ++    +   TPL +A    +V  V  LL  GA    +    L  +H     G++ +  ++ + +         NGL+PI  A    +   V++L++ NA++D +     T  H AA  G  + +++LL  G    ++  +G  PLH A  + +    ++LL   +++E V E   SG T LH+AA
Sbjct:   52 LHLASKEGHVKMVLELLHNGIDL-ETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIA---AHYENLSVAQ------LLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVV-EILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE---SGLTPLHVAA 415          

HSP 9 Score: 82.0333 bits (201), Expect = 4.581e-15
Identity = 89/372 (23.92%), Postives = 152/372 (40.86%), Query Frame = 2
Query: 2003 ITESYKDYLFASCRIGNFEIVCSFIHDGGE--VSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAIN---------------------------------VNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILL 3007
            +TES    L  +  +G+  IV S +  G     S ++ +   T LH + +    E+ + +L+   ++  K  + + T LH        E + LL+++ AN +     G T L++A    +      + D    +T+  +     G  PLH A   CKY K        +ELLLE   +     +   TPL +A++                                  N +E   +LL+ GAN  +  +Q +  +H    EG  ++   L + +  + N+ + NGLTP+       +  I   L++  A +    + G T  H A   G  K ++ LL       SK   G  PLH+AA +G+ +I  +LL
Sbjct:  403 VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVE---TPLHMAARAGHCEVAQFLLQNNAQVDAKAKD-DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTK----KGFTPLHVA---CKYGKV-----DVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMV-ALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 757          

HSP 10 Score: 80.4925 bits (197), Expect = 1.532e-14
Identity = 97/383 (25.33%), Postives = 166/383 (43.34%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICK--YKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDN 3163
            L  + R GN  I+   + D G   + + +   T LH + +N    + E++L +   L  K  +  L+ +HM      ++ +  LL+ NA ++    +  T L++A    +      M   + DK         +G  PLH A   CK  + +S       M+LLL+ +  +E       TPL +A  + H+  V++LL+ GA+    +++    +H     G+ E+  Q  +  N   +    +  TP+  A    ++++VK L+E  A  D     G T  H AA +G  +   +LL            G  PLH A   G  ++ E+LL   +   N N    +G T LH+A   N+  +  LL+SK        H+T+ N
Sbjct:  246 LHIASRRGNV-IMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAK-TKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGH----HRMVKVLLDKGAKANARALNGFTPLHIA---CKKNHMRS-------MDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEV-AQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGA---NPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP----HSTARN 604          

HSP 11 Score: 78.5666 bits (192), Expect = 5.482e-14
Identity = 90/381 (23.62%), Postives = 164/381 (43.04%), Query Frame = 2
Query: 1868 SPDFNNEPVKLTNSKKIKDSSEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            SP+ +N  VK+     +   +  C++     +N  ++++K       +  +  L  + R+G+ E+V   + +     +    +G T LH + +  + +   ++L +  +   K  +   T LH+     +++ + LLL+  AN N    NG T L++AV +NNL  ++ +      K         +G   LH A +  + + +          LL+   +         TPL LA      + V  L+   AN    +   L  +H V  EG++ I + L V +          G TP+  A    N K+VK L++  A ++   + G T  H+AA++G    + LLL +G  P     +GT PL  A   GY  + ++L
Sbjct:  432 SPNASN--VKVETPLHMAARAGHCEVAQFLLQNNAQVDAK------AKDDQTPLHCAARMGHKELV-KLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL----VSKGGSPHSTARNGYTALHIAAKQNQLEVASS--------LLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADML-VKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 789          

HSP 12 Score: 76.2554 bits (186), Expect = 2.658e-13
Identity = 85/312 (27.24%), Postives = 134/312 (42.95%), Query Frame = 2
Query:  371 KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-----DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            +NG   LHLAS       +  LL    D+        ++L +A +    + V  L    A VN     G SP++ AA+       EN LE++  LL+HGA+      DG      +PL  A+   +   +  LI  G    +K    L  LH A  N +     +LL +   + +       T L  A  Y N+ V +LLL RG+NVN          H AS +G++  +++L      +     D   PLH A+  GH  +VE L+    P       +  +  NG + +H++   D+++  + LLQ  A+
Sbjct:   46 QNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQ-------ENHLEVVKYLLEHGANQSLPTEDGF-----TPLAVALQQGHENVVALLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDP-NPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAP-------LQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAE 333          

HSP 13 Score: 72.4034 bits (176), Expect = 4.025e-12
Identity = 72/284 (25.35%), Postives = 129/284 (45.42%), Query Frame = 2
Query:  371 KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQT 1222
            K G+T LH+A        +  LL +  + N    +  + L +AV ++N + VKLL       + T  NG + +H AAK       +N+LE+ + LL++GA+ +   L   +PL  A        +  LI K A +   + +GL+ LH     G++ I  ML+      +        T L  AC Y N+ +V+ LL++ ++VN++        H A+ +G    + +L ++     ++  +   PL  A   G+  +++ L    E    ++    HR S  +T
Sbjct:  537 KKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAK-------QNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQ-GASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRMSFPET 812          

HSP 14 Score: 70.8626 bits (172), Expect = 1.258e-11
Identity = 59/198 (29.80%), Postives = 93/198 (46.97%), Query Frame = 2
Query:  707 LMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNI 1300
             + A  S NL K    I+ G  I   + +GL+ LH A+  G+++++  LL +   DLETT     TAL  A       VV  L+  G+NVNA+  K  +  + A+ +  L+ ++ L ++  N      D   PL  A  +GH  +V  LI N   K K+             ALH++   D+     +LLQN  +P++
Sbjct:   19 FLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHN-GIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI-NYGTKGKVR----------LPALHIAARNDDTRTAAVLLQNDPNPDV 204          

HSP 15 Score: 70.0922 bits (170), Expect = 1.918e-11
Identity = 92/373 (24.66%), Postives = 160/373 (42.90%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
               + R GN E     I +G +++ I +Q+G   LH + K    K + EL L    +L     + N T LH+  ++ + + +  L+   ANVN     G + L +A   N+L  ++ + ++  +++    +P   G  PL  A++         Q    +  LL   G    + +V    L +A   +       LL+N  N           +H      NL +  QL +    + N T  NG+TP+  A    N  +V+ L++  A++D   +   T  H AA  G  + +E+LL  G    +K  +G  P+H AA   + +    LL   + I+++   +    T LH+AA      M  +L+ K +K N
Sbjct:   19 FLRAARSGNLEKALDHIKNGIDIN-IANQNGLNGLHLASKEGHVKMVLEL-LHNGIDLETTTKKGN-TALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQS----LPTEDGFTPLAVALQ---------QGHENVVALLINYG---TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSV-AQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDH---LTPLHVAAHCGHHRMVKVLLDKGAKAN 368          

HSP 16 Score: 54.299 bits (129), Expect = 1.395e-6
Identity = 47/191 (24.61%), Postives = 82/191 (42.93%), Query Frame = 2
Query: 2552 TPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKD 3124
            T  L A    ++E     +KNG +    +   L  +H    EG++++  +L +    D   T   G T +  A     EK+V  LI   A ++   Q G +  + AA++   + ++ LL +G +      DG  PL  A  +G++ +  +L+       N   K      ALH+AA  +D     +L+  D
Sbjct:   17 TSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLEL-LHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI-------NYGTKGKVRLPALHIAARNDDTRTAAVLLQND 199          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 111.694 bits (278), Expect = 4.152e-24
Identity = 105/369 (28.46%), Postives = 172/369 (46.61%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTG------EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            A +  + +    LL+N  +  DV   T  T LH    YE+     LSVA  LL+ G       KNG T LH+AS       +R LL +   I+ +  D  + L  A    +   V++L +  A +     NG+SP+H AA+        + ++ +  LL++ A+ID + L   +PL  A    +   +K L++KGA   ++  +G + LH A    ++  + +LL  +   LE    +  T L  A    ++++V+ LL+RG++ NA + K     H A+  G  +  Q L Q N  +     D   PLH A+  GH E+V+ L   ME K       +   + G T LH++  + + +  +ILL   A
Sbjct:  213 AARNDDTRTAAVLLQNDPNP-DVLSKTGFTPLHIAAHYEN-----LSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQ-------GDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLK-HSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLL---MEHKAN----PDSATTAGHTPLHIAAREGHAQTTRILLDENA 560          

HSP 2 Score: 100.138 bits (248), Expect = 1.240e-20
Identity = 94/361 (26.04%), Postives = 167/361 (46.26%), Query Frame = 2
Query:  212 GNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            G+++ VK LL+      + R L   T LH   K  +   ++L+L  +  L    E +G T LH+A+ +     ++ LL +    N  N    + L +A    + E  + L +NNA+V+    +  +P+H AA++          E++ +L++H A+ D       +PL  A    +    + L+++ A        G + LH A   G ++++++LL+    +      N  T L  A  +NN+DVV+LL+ +G + ++       A H A+ +  L+    L QY  N    +     PLH AS +G  ++V  LI+           +N  N NG T LHL   + ++ I  +L++ GA
Sbjct:  382 GHHRMVKVLLDKGAKA-NARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMG-------HKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLE-RGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQA-------NVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGA 725          

HSP 3 Score: 97.8265 bits (242), Expect = 7.287e-20
Identity = 94/384 (24.48%), Postives = 159/384 (41.41%), Query Frame = 2
Query: 1991 QIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALEC-MNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKI 3133
            +I +IT  +   L  +   G+  +V   + D G  +  R  +G T LH + K   +   +L+LK +  L     E+ LT LH+      +  +  LL+  A+ N  +    T L++A       A  C +  ++      +         PLH A  +          K  ++LL+E   + +       TPL +A    H +    LL   A       +    +H  C  G +++  +L +    +PN    NGLTP+  AV + N  +VK L+          + G T  H AA++   +    LL YG +  S+   G  PLH A+  G  ++  +L+   S   NVN  N +G T LHL A      +  +L+ + + +
Sbjct:  363 EIDDITLDHLTPLHVAAHCGHHRMVKVLL-DKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASL-EAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAA-----RAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGH--------KELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVV-ELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLI---SKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 727          

HSP 4 Score: 96.6709 bits (239), Expect = 1.523e-19
Identity = 96/403 (23.82%), Postives = 184/403 (45.66%), Query Frame = 2
Query:  170 SMGSYVELLKACKEGNNKKVKKLLENCTDVG-DVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            S   +  L  A +E + + VK LLE+  +      D      +     +E+ V L+++       T  K     LH+A+      +   LL  +P+ +  +    + L +A  Y+N    +LL    A VN T  NG++P+H A++          + ++ +LL  GA ID     + +PL  A  + ++  ++ L+++GA + +K  +GLS +H A    +++ ++ LL  Y  +++    ++ T L  A    +  +V++LL++G+  NA         H A  K  ++++ +L +++ +L  +      PLH A++ GH  IV+ L+             N  N   +T LH++    + E+ + LLQN A  +   +        A  + +K   KLL+
Sbjct:  141 SQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYG-----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASR-------RGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL-QYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASP-------NASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLM 523          

HSP 5 Score: 95.5153 bits (236), Expect = 3.769e-19
Identity = 89/315 (28.25%), Postives = 145/315 (46.03%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKR--SPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVS 1315
            T LH+A+        ++LL  N  ++ +  D ++ L  A    + E VKLL E+ A  +     G +P+H AA+          L+      K         + K+  +PL  A     +  ++ L+E+GA   +   +GL+ LH A  + NL+++++L+        +T  N  TAL  A   N ++V   LL+ G+N N+E  +     H AS  G+ D+  L +  Q NVNL   N +   PLH  + +GH  I + L+     K+    +   R   G T LH++    N+++ K LLQ  A  N   RVS
Sbjct:  472 TPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTK---------MTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP-HSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLG--NKNGLTPLHLVAQEGHVGIADMLV-----KQGASVYAASRM--GYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVS 767          

HSP 6 Score: 83.9593 bits (206), Expect = 1.244e-15
Identity = 80/312 (25.64%), Postives = 134/312 (42.95%), Query Frame = 2
Query: 2213 NLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNY----PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
              T LH+      +  + LLLK++A++     +G T L++A    +L  ++ +               N+ N     PLH A      +   C+   +   LL+ N  ++ + +  +TPL  A  + H E V+ L+++ AN  +        +H    EG+ +   ++ + EN         G TP+  A       +V+ L+E  A  +   + G T  H A        ++LL+S G  P S   +G   LH AA +   E+A  LL   +   N N ++  G T LHLA+      M  LLISK + +N
Sbjct:  404 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASP--------NASNVKVETPLHMA-----ARAGHCEVAQF---LLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQT-TRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGA---NANSESLQGITPLHLASQEGQPDMVALLISKQANVN 695          

HSP 7 Score: 82.8037 bits (203), Expect = 2.598e-15
Identity = 99/398 (24.87%), Postives = 168/398 (42.21%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS-LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYIT---------------DKTRFIQI-------PD---NSGNYPLHYAIEICKYKK-SVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            L  + + G+ ++V   +H+G ++ E   + G T LH + L  +E     L      VN   +   + L+M      +E +  LL++ AN + P  +G T L +A+   +   +  + +Y T               D TR   +       PD    +G  PLH A     Y+  SV Q      LLL    ++    +   TPL +A    +V  V  LL  GA    +    L  +H     G++ +   L   +   P      NGL+PI  A    +   V++L++ NA++D +     T  H AA  G  + +++LL  G    ++  +G  PLH A  + +    ++LL   +++E V E   SG T LH+AA      +   L+ + +  N
Sbjct:   82 LHLASKEGHVKMVLELLHNGIDL-ETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIA---AHYENLSVAQ------LLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEIL--LDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE---SGLTPLHVAAFMGHLNIVKSLLQRGASPN 464          

HSP 8 Score: 79.7221 bits (195), Expect = 2.573e-14
Identity = 97/383 (25.33%), Postives = 166/383 (43.34%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICK--YKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDN 3163
            L  + R GN  I+   + D G   + + +   T LH + +N    + E++L +   L  K  +  L+ +HM      ++ +  LL+ NA ++    +  T L++A    +      M   + DK         +G  PLH A   CK  + +S       M+LLL+ +  +E       TPL +A  + H+  V++LL+ GA+    +++    +H     G+ E+  Q  +  N   +    +  TP+  A    ++++VK L+E  A  D     G T  H AA +G  +   +LL            G  PLH A   G  ++ E+LL   +   N N    +G T LH+A   N+  +  LL+SK        H+T+ N
Sbjct:  276 LHIASRRGNV-IMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAK-TKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGH----HRMVKVLLDKGAKANARALNGFTPLHIA---CKKNHMRS-------MDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEV-AQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGA---NPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP----HSTARN 634          

HSP 9 Score: 75.8702 bits (185), Expect = 3.603e-13
Identity = 85/312 (27.24%), Postives = 134/312 (42.95%), Query Frame = 2
Query:  371 KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-----DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            +NG   LHLAS       +  LL    D+        ++L +A +    + V  L    A VN     G SP++ AA+       EN LE++  LL+HGA+      DG      +PL  A+   +   +  LI  G    +K    L  LH A  N +     +LL +   + +       T L  A  Y N+ V +LLL RG+NVN          H AS +G++  +++L      +     D   PLH A+  GH  +VE L+    P       +  +  NG + +H++   D+++  + LLQ  A+
Sbjct:   76 QNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQ-------ENHLEVVKYLLEHGANQSLPTEDGF-----TPLAVALQQGHENVVALLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDP-NPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAP-------LQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAE 363          

HSP 10 Score: 73.9442 bits (180), Expect = 1.360e-12
Identity = 86/327 (26.30%), Postives = 148/327 (45.26%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRR------NATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI 1156
            A + G+ + VK L+E+  +  D       T LH   +  +     ++L    Q      K G+T LH+A        +  LL +  + N    +  + L +AV ++N + VKLL       + T  NG + +H AAK       +N+LE+ + LL++GA+ +   L   +PL  A        +  LI K A +   + +GL+ LH     G++ I  ML+      +        T L  AC Y N+ +V+ LL++ ++VN   SK R      +A++       +  L+    ++ +L  L      PLH+A+ +GH +IV  L+
Sbjct:  510 AARMGHKELVKLLMEHKANP-DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM-TKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAK-------QNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQ-GASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVN---SKTRVSVLLLDASYTGLFSVSVCTLRTF-AFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLL 822          

HSP 11 Score: 70.8626 bits (172), Expect = 1.185e-11
Identity = 59/198 (29.80%), Postives = 93/198 (46.97%), Query Frame = 2
Query:  707 LMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNI 1300
             + A  S NL K    I+ G  I   + +GL+ LH A+  G+++++  LL +   DLETT     TAL  A       VV  L+  G+NVNA+  K  +  + A+ +  L+ ++ L ++  N      D   PL  A  +GH  +V  LI N   K K+             ALH++   D+     +LLQN  +P++
Sbjct:   49 FLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHN-GIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI-NYGTKGKVR----------LPALHIAARNDDTRTAAVLLQNDPNPDV 234          

HSP 12 Score: 69.3218 bits (168), Expect = 3.805e-11
Identity = 92/373 (24.66%), Postives = 160/373 (42.90%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
               + R GN E     I +G +++ I +Q+G   LH + K    K + EL L    +L     + N T LH+  ++ + + +  L+   ANVN     G + L +A   N+L  ++ + ++  +++    +P   G  PL  A++         Q    +  LL   G    + +V    L +A   +       LL+N  N           +H      NL +  QL +    + N T  NG+TP+  A    N  +V+ L++  A++D   +   T  H AA  G  + +E+LL  G    +K  +G  P+H AA   + +    LL   + I+++   +    T LH+AA      M  +L+ K +K N
Sbjct:   49 FLRAARSGNLEKALDHIKNGIDIN-IANQNGLNGLHLASKEGHVKMVLEL-LHNGIDLETTTKKGN-TALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQS----LPTEDGFTPLAVALQ---------QGHENVVALLINYG---TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSV-AQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDH---LTPLHVAAHCGHHRMVKVLLDKGAKAN 398          

HSP 13 Score: 68.1662 bits (165), Expect = 7.676e-11
Identity = 90/415 (21.69%), Postives = 167/415 (40.24%), Query Frame = 2
Query: 1868 SPDFNNEPVKLTNSKKIKDSSEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM------------NDY----ITDKTRFIQIPDN-------------SGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIF-----NQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            SP+ +N  VK+     +   +  C++     +N  ++++K       +  +  L  + R+G+ E+V   + +     +    +G T LH + +  + +   ++L +  +   K  +   T LH+     +++ + LLL+  AN N    NG T L++AV +NNL  ++ +            N Y    I  K   +++  +              G  PLH A +  +           + LL+    ++   ++   TPL L     HV   + L+K GA+           +H  C  GN+++       Q  V      +V   +      ++VS C      R    +  L  + Q G T  H+AA++G    + LLL +G  P     +GT PL  A   GY  + ++L
Sbjct:  462 SPNASN--VKVETPLHMAARAGHCEVAQFLLQNNAQVDAK------AKDDQTPLHCAARMGHKELV-KLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQ--------PDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCT----LRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 854          

HSP 14 Score: 57.7658 bits (138), Expect = 1.250e-7
Identity = 69/267 (25.84%), Postives = 115/267 (43.07%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES--CVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYA-TSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGS 970
             +  L  ACK G    V+ LLE   +  +       T LH    + +   V+L++S       T  +NGYT LH+A+          LL    + N  +    + L LA     P+ V LL    A VN+ + NG++P+H  A+       E  + I ++L+K GA +        +PL  A    N+  +K L+++ A + SK    + +L  + T   ++ +  +    + F L        T L  A    + D+V LLL+ G+
Sbjct:  569 GFTPLHVACKYGKVDVVELLLERGANP-NAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTA-RNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQ-------EGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGA 826          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 111.694 bits (278), Expect = 4.423e-24
Identity = 99/393 (25.19%), Postives = 173/393 (44.02%), Query Frame = 2
Query: 1976 INSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM--NDYITD-KTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINE 3139
            +  K  + ++T  Y   L  +   G++  V   + D       R  +G T LH + K    ++ EL++K     +    E+ LT +H+      +  + LLL+N A+ +  +  G TAL++A     +  + C+  N  + D + R  Q P       LH A  + K +         ++LLL+     +       TPL +A    H++    LL+ GA       +    +H     G+LE+  +L +     P+    NGLTP+  A    N+K+   L++  A      + G T  H AA+K   +    LL YG +   +   G MP+H A+  G+ E+A +LL   +    VN    SG T+LHLAA  +   +  +L+ + + +++
Sbjct:  333 LQHKAPVDDVTLDYLTALHVAAHCGHYR-VTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYG-AFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTP-------LHIASRLGKTE--------IVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEV-AKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGA---QVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQ 704          

HSP 2 Score: 108.612 bits (270), Expect = 4.447e-23
Identity = 101/375 (26.93%), Postives = 171/375 (45.60%), Query Frame = 2
Query:  170 SMGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLL--DTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            S   +  L  A +E +   V+ LLEN    G+    T+          +     ++S+   LL  DT  K     LH+A+      S   LL  + + + ++    + L +A  Y N     LL    A V+ T  NG++P+H A+K            ++++LL  GA ID       +PL  A  S + T ++ L+E+GA + ++  +GLS LH A    ++E ++ LL  +K  ++    +  TAL  A    +  V +LLL++ +N NA         H A  K  +K +++L +Y   +  +      P+H A++ GH  IV  L+ N    +         N  G+TALH++     +E+ + LL+NGA
Sbjct:  116 SQNGFTPLYMASQENHLDVVRYLLENG---GNQSIATEDGFTPLAIALQQGHNQVVSI---LLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASK-------RGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDV-------SNIRGETALHMAARAGQMEVVRCLLRNGA 469          

HSP 3 Score: 101.679 bits (252), Expect = 4.644e-21
Identity = 99/386 (25.65%), Postives = 181/386 (46.89%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESC-VELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANK 1354
            A ++ + K    LL+N  +  DV+  +  T LH    Y +  V  +L      +D   +NG T LH+AS       +  LL +   I+ +  D  + L  A    +  AV+LL E  A +     NG+SP+H AA+        + +E +  LL+H A +D + L   + L  A    +    K L++K A   ++  +G + LH A     ++++++L+    F    T+S   T +  A    ++++V LLL+ G++ +  + +   A H A+  G ++ ++ L +    +     +   PLH AS  G  EIV+ L+ +M   +          +NG T LH++  + +L++  +LL+ GA  ++  +    K  T L +A+K
Sbjct:  188 AARKDDTKSAALLLQNDHNA-DVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQ-------GDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITES-GLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAA-------TANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATK----KGFTPLHVASK 553          

HSP 4 Score: 93.5893 bits (231), Expect = 1.428e-18
Identity = 96/373 (25.74%), Postives = 164/373 (43.97%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHY-CFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLL--SKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            Y+  L       + +V KLL +     + R L   T LH  C K    V  +L      +    ++G T +H+A+ +     +  LL    +PD++  N    ++L +A      E V+ L  N A V+       +P+H A+++        + EI+ +LL+H A  D       +PL  A    +L     L+E GA        G + LH A+  G+LE+ ++LL   +   ++   N  T L  A  Y+N  V  LLL++G++ +A         H A+ K  ++    L QY             P+H AS +GH+E+   L+            +N    +G T+LHL+  +D + + +IL++ GA+
Sbjct:  346 YLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVS--NIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLG-------KTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQ-RRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQ-------VNVTTKSGLTSLHLAAQEDKVGVGEILVKQGAN 701          

HSP 5 Score: 83.9593 bits (206), Expect = 1.156e-15
Identity = 84/340 (24.71%), Postives = 143/340 (42.06%), Query Frame = 2
Query:  359 DTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAK--------------VKAXXXXXXXXXXXXXXXKHGA-DIDGLDLYKRSPLMWAVCSNNLTKM---KH---------LIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            D     G T LH+A+       +R LL     ++ R  + ++ L +A      E V+LL ++ A  +    NG +P+H AA+                  L  +     +++  K+G+ ++  L L +R+P   A   N LT +    H         L++KGA  ++   +G + LH A     +EI   LL  Y  +           +  A    + ++  LLL+RG+ VN        + H A+ +  +   ++L +   NL +       PL  A + G+ ++V FL+       K    +N +  NG T LH +  + N  I  +LLQ GA PN
Sbjct:  439 DVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSA-GKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQ-YGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLL-------KSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPN 769          

HSP 6 Score: 82.4185 bits (202), Expect = 4.277e-15
Identity = 95/358 (26.54%), Postives = 148/358 (41.34%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGN---YPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLN---TPSAIENVNEKNNSGQTALHLA 3076
            L  + R G  E+V   + +G  V + R +  +T LH +  L   E+ +L+L+      +       T LH+      ++   +LL+  A  +     G T L++A  Y +L   + +             PD++G     PLH A      K ++        LLL+         +   TPL +A   N +E   TLL+ GA    +  Q +  +H    EG+ E+   L +      NVT  +GLT +  A       + + L++  A LD   + G T    A   G  K +  LL  G     K  +G  PLH+AA +G   I  +LL     P+AI  VN     G TAL +A
Sbjct:  449 LHMAARAGQMEVVRCLLRNGAMV-DARAREDQTPLHIASRLGKTEIVQLLLQHMAH-PDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAP-------PDSAGKNGLTPLHVAAHYDNQKVAL--------LLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEM-AALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAI-TVN-----GNTALAIA 782          

HSP 7 Score: 82.0333 bits (201), Expect = 5.651e-15
Identity = 87/365 (23.84%), Postives = 153/365 (41.92%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLI 3115
            L+ + +  + ++V   + +GG  S I  + G T L  +L+  + ++  ++L+      +   +  L  LH+     + +   LLL+N+ N +    +G T L++A  Y N+     +   + ++   +     +G  PLH A        S       + LLL+    I+ + R   TPL  A    H  AVE LL+ GA  L R                                    NGL+P+  A    + + VK L++  A +D V     T  H AA  G ++  +LLL    +P ++  +G  PLH A  +   ++ E+L+   + I+ + E   SG T +H+AA      +  LL+
Sbjct:  123 LYMASQENHLDVVRYLLENGGNQS-IATEDGFTPLAIALQQGHNQVVSILLEN-----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNV----NVATLLLNRGAAVDFTARNGITPLHVA--------SKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLART----------------------------------KNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITE---SGLTPIHVAAFMGHLNIVLLLL 432          

HSP 8 Score: 81.6481 bits (200), Expect = 7.404e-15
Identity = 89/371 (23.99%), Postives = 149/371 (40.16%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-DDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            S    L+A + GN  KV + L+   D+G                                 T  +NG   LHLA+       ++ LL +   ++       ++L +A +    + VK+L +  A +N    NG +P++ A++            + N   +  A  DG      +PL  A+   +   +  L+E      +K    L  LH A    + +   +LL +D+  D+++   +  T L  A  Y NV+V  LLL RG+ V+          H AS +G+   + +L      +     D   PLH A+  GH+  VE L+    P       +  R  NG + LH++   D++E  K LLQ+ A
Sbjct:   20 SNTSFLRAARAGNIDKVLEYLKGGVDIG---------------------------------TSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQ--ENHLDVVRYLLENGGNQSIATEDGF-----TPLAIALQQGHNQVVSILLEND----TKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQS--KSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAP-------MLARTKNGLSPLHMAAQGDHVECVKHLLQHKA 337          

HSP 9 Score: 78.1814 bits (191), Expect = 6.992e-14
Identity = 86/353 (24.36%), Postives = 153/353 (43.34%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
               + R GN + V  ++  G ++    +Q+G   LH + K    +L + +L +   + +   + N T LH+  ++ + + + +L K  AN+N    NG T L +A   N+L  +     Y+ +      I    G  PL  A++    +         + +LLE     + + +V    L +A   +  ++   LL+N  N   +       +H     GN+ +   L +      + T  NG+TP+  A    N  +V  L++  A++D   + G T  H AA  G    +ELLL  G    ++  +G  PLH AA   + E  + LL   + +++V        TALH+AA
Sbjct:   24 FLRAARAGNIDKVLEYLKGGVDIG-TSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGN-TALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVR----YLLENGGNQSIATEDGFTPLAIALQQGHNQ--------VVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVAT-LLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDY---LTALHVAA 354          

HSP 10 Score: 77.411 bits (189), Expect = 1.200e-13
Identity = 90/352 (25.57%), Postives = 147/352 (41.76%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESC--VELILS--------------------------VAPQLLDTGE------KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFL 1153
            A + G  + V+ LL N   V D R   D+T LH   +      V+L+L                           V   LL+ G       K G+T LH+AS        + LL +    +    +  + L +A  YDN +   LL +  A  + T  NG +P+H AAK       +N++EI   LL++GA+ +        P+  A    +      L+++GA +     SGL+ LH A     + + ++L+     +L+       T L+ AC Y N  +V  LL+ G++VN +        H A+ +G+   + VL QY      +  + N  L  A   G+  +V+ L
Sbjct:  452 AARAGQMEVVRCLLRNGAMV-DARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAK-------KNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQ-GANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTL 794          

HSP 11 Score: 60.077 bits (144), Expect = 2.661e-8
Identity = 51/191 (26.70%), Postives = 93/191 (48.69%), Query Frame = 2
Query:  782 KDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-------------------MEPKEKILNFINHRNSNGQT---ALHLSTVKDNLEICKILLQN 1282
            K  S  S L  A + GN++ +   L     D+ T++ N   AL  A    +VD+V+ LL RGS+V++   K   A H AS  G+GD+  +++L +   N+   + +   PL+ AS + H ++V +L+ N                    +   ++++ +   ++ G+    ALH++  KD+ +   +LLQN
Sbjct:   17 KSDSNTSFLRAARA-GNIDKVLEYLKG-GVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDV--VKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQN 203          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 111.309 bits (277), Expect = 4.675e-24
Identity = 105/369 (28.46%), Postives = 172/369 (46.61%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTG------EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            A +  + +    LL+N  +  DV   T  T LH    YE+     LSVA  LL+ G       KNG T LH+AS       +R LL +   I+ +  D  + L  A    +   V++L +  A +     NG+SP+H AA+        + ++ +  LL++ A+ID + L   +PL  A    +   +K L++KGA   ++  +G + LH A    ++  + +LL  +   LE    +  T L  A    ++++V+ LL+RG++ NA + K     H A+  G  +  Q L Q N  +     D   PLH A+  GH E+V+ L   ME K       +   + G T LH++  + + +  +ILL   A
Sbjct:  121 AARNDDTRTAAVLLQNDPNP-DVLSKTGFTPLHIAAHYEN-----LSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQ-------GDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLK-HSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLL---MEHKAN----PDSATTAGHTPLHIAAREGHAQTTRILLDENA 468          

HSP 2 Score: 100.138 bits (248), Expect = 1.449e-20
Identity = 94/361 (26.04%), Postives = 167/361 (46.26%), Query Frame = 2
Query:  212 GNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            G+++ VK LL+      + R L   T LH   K  +   ++L+L  +  L    E +G T LH+A+ +     ++ LL +    N  N    + L +A    + E  + L +NNA+V+    +  +P+H AA++          E++ +L++H A+ D       +PL  A    +    + L+++ A        G + LH A   G ++++++LL+    +      N  T L  A  +NN+DVV+LL+ +G + ++       A H A+ +  L+    L QY  N    +     PLH AS +G  ++V  LI+           +N  N NG T LHL   + ++ I  +L++ GA
Sbjct:  290 GHHRMVKVLLDKGAKA-NARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMG-------HKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLE-RGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQA-------NVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGA 633          

HSP 3 Score: 97.4413 bits (241), Expect = 7.641e-20
Identity = 94/384 (24.48%), Postives = 159/384 (41.41%), Query Frame = 2
Query: 1991 QIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALEC-MNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKI 3133
            +I +IT  +   L  +   G+  +V   + D G  +  R  +G T LH + K   +   +L+LK +  L     E+ LT LH+      +  +  LL+  A+ N  +    T L++A       A  C +  ++      +         PLH A  +          K  ++LL+E   + +       TPL +A    H +    LL   A       +    +H  C  G +++  +L +    +PN    NGLTP+  AV + N  +VK L+          + G T  H AA++   +    LL YG +  S+   G  PLH A+  G  ++  +L+   S   NVN  N +G T LHL A      +  +L+ + + +
Sbjct:  271 EIDDITLDHLTPLHVAAHCGHHRMVKVLL-DKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASL-EAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAA-----RAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGH--------KELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVV-ELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLI---SKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASV 635          

HSP 4 Score: 96.2857 bits (238), Expect = 1.894e-19
Identity = 91/374 (24.33%), Postives = 174/374 (46.52%), Query Frame = 2
Query:  170 SMGSYVELLKACKEGNNKKVKKLLENCTDVG-DVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            S   +  L  A +E + + VK LLE+  +      D      +     +E+ V L+++       T  K     LH+A+      +   LL  +P+ +  +    + L +A  Y+N    +LL    A VN T  NG++P+H A++          + ++ +LL  GA ID     + +PL  A  + ++  ++ L+++GA + +K  +GLS +H A    +++ ++ LL  Y  +++    ++ T L  A    +  +V++LL++G+  NA         H A  K  ++++ +L +++ +L  +      PLH A++ GH  IV+ L+             N  N   +T LH++    + E+ + LLQN A
Sbjct:   49 SQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYG-----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASR-------RGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL-QYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASP-------NASNVKVETPLHMAARAGHCEVAQFLLQNNA 402          

HSP 5 Score: 92.4337 bits (228), Expect = 3.135e-18
Identity = 87/315 (27.62%), Postives = 144/315 (45.71%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKR--SPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVS 1315
            T LH+A+        ++LL  N  ++ +  D ++ L  A    + E VKLL E+ A  +     G +P+H AA+          L+      K         + K+  +PL  A     +  ++ L+E+GA   +   +GL+ LH A  + NL+++++L+        +T  N  TAL  A   N ++V   LL+ G+N N+E  +     H AS  G+ D+  L +  Q NVNL   N +   PLH  + +GH  I + L+     K+    +   R   G T LH++    N+++ K LLQ  A  N   R+ 
Sbjct:  380 TPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTK---------MTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP-HSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLG--NKNGLTPLHLVAQEGHVGIADMLV-----KQGASVYAASRM--GYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLG 675          

HSP 6 Score: 85.8853 bits (211), Expect = 2.849e-16
Identity = 80/323 (24.77%), Postives = 145/323 (44.89%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELIL--SVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI 1156
            A + G+ +  + LL+N   V D +   D+T LH   +  ++  V+L++     P   D+    G+T LH+A+      + R LL +N    K      + L +A  Y   + V+LL E  A  N    NG++P+H A  V        +L +      H    +G      + L  A   N L     L++ GA   S+   G++ LH A+  G  +++ +L+   + ++   + N  T L       +V + ++L+++G++V A         H A   G++K ++ L Q   ++         PLH+A+ +GH +IV  L+
Sbjct:  385 AARAGHCEVAQFLLQNNAQV-DAKAKDDQTPLHCAARMGHKELVKLLMEHKANP---DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVA--VHHNNLDVVKLLVSKGGSPHSTARNGY-----TALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK-QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 695          

HSP 7 Score: 83.5741 bits (205), Expect = 1.538e-15
Identity = 80/312 (25.64%), Postives = 134/312 (42.95%), Query Frame = 2
Query: 2213 NLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNY----PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
              T LH+      +  + LLLK++A++     +G T L++A    +L  ++ +               N+ N     PLH A      +   C+   +   LL+ N  ++ + +  +TPL  A  + H E V+ L+++ AN  +        +H    EG+ +   ++ + EN         G TP+  A       +V+ L+E  A  +   + G T  H A        ++LL+S G  P S   +G   LH AA +   E+A  LL   +   N N ++  G T LHLA+      M  LLISK + +N
Sbjct:  312 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASP--------NASNVKVETPLHMA-----ARAGHCEVAQF---LLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQT-TRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGA---NANSESLQGITPLHLASQEGQPDMVALLISKQANVN 603          

HSP 8 Score: 81.6481 bits (200), Expect = 5.209e-15
Identity = 89/372 (23.92%), Postives = 152/372 (40.86%), Query Frame = 2
Query: 2003 ITESYKDYLFASCRIGNFEIVCSFIHDGGE--VSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAIN---------------------------------VNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILL 3007
            +TES    L  +  +G+  IV S +  G     S ++ +   T LH + +    E+ + +L+   ++  K  + + T LH        E + LL+++ AN +     G T L++A    +      + D    +T+  +     G  PLH A   CKY K        +ELLLE   +     +   TPL +A++                                  N +E   +LL+ GAN  +  +Q +  +H    EG  ++   L + +  + N+ + NGLTP+       +  I   L++  A +    + G T  H A   G  K ++ LL       SK   G  PLH+AA +G+ +I  +LL
Sbjct:  341 VTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVE---TPLHMAARAGHCEVAQFLLQNNAQVDAKAKD-DQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTK----KGFTPLHVA---CKYGKV-----DVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMV-ALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 695          

HSP 9 Score: 79.337 bits (194), Expect = 3.218e-14
Identity = 95/368 (25.82%), Postives = 156/368 (42.39%), Query Frame = 2
Query: 2060 IVCSFIHDGGEVSEIRDQSGKTLLHYS-LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYIT---------------DKTRFIQI-------PD---NSGNYPLHYAIEICKYKK-SVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            +V   +H+G ++ E   + G T LH + L  +E     L      VN   +   + L+M      +E +  LL++ AN + P  +G T L +A+   +   +  + +Y T               D TR   +       PD    +G  PLH A     Y+  SV Q      LLL    ++    +   TPL +A    +V  V  LL  GA    +    L  +H     G++ +   L   +   P      NGL+PI  A    +   V++L++ NA++D +     T  H AA  G  + +++LL  G    ++  +G  PLH A  + +    ++LL   +++E V E   SG T LH+AA
Sbjct:    1 MVLELLHNGIDL-ETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIA---AHYENLSVAQ------LLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEIL--LDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE---SGLTPLHVAA 353          

HSP 10 Score: 79.337 bits (194), Expect = 3.301e-14
Identity = 97/383 (25.33%), Postives = 166/383 (43.34%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICK--YKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDN 3163
            L  + R GN  I+   + D G   + + +   T LH + +N    + E++L +   L  K  +  L+ +HM      ++ +  LL+ NA ++    +  T L++A    +      M   + DK         +G  PLH A   CK  + +S       M+LLL+ +  +E       TPL +A  + H+  V++LL+ GA+    +++    +H     G+ E+  Q  +  N   +    +  TP+  A    ++++VK L+E  A  D     G T  H AA +G  +   +LL            G  PLH A   G  ++ E+LL   +   N N    +G T LH+A   N+  +  LL+SK        H+T+ N
Sbjct:  184 LHIASRRGNV-IMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAK-TKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGH----HRMVKVLLDKGAKANARALNGFTPLHIA---CKKNHMRS-------MDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEV-AQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGA---NPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP----HSTARN 542          

HSP 11 Score: 78.5666 bits (192), Expect = 5.349e-14
Identity = 90/381 (23.62%), Postives = 164/381 (43.04%), Query Frame = 2
Query: 1868 SPDFNNEPVKLTNSKKIKDSSEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            SP+ +N  VK+     +   +  C++     +N  ++++K       +  +  L  + R+G+ E+V   + +     +    +G T LH + +  + +   ++L +  +   K  +   T LH+     +++ + LLL+  AN N    NG T L++AV +NNL  ++ +      K         +G   LH A +  + + +          LL+   +         TPL LA      + V  L+   AN    +   L  +H V  EG++ I + L V +          G TP+  A    N K+VK L++  A ++   + G T  H+AA++G    + LLL +G  P     +GT PL  A   GY  + ++L
Sbjct:  370 SPNASN--VKVETPLHMAARAGHCEVAQFLLQNNAQVDAK------AKDDQTPLHCAARMGHKELV-KLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQ-QTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL----VSKGGSPHSTARNGYTALHIAAKQNQLEVASS--------LLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADML-VKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 12 Score: 72.4034 bits (176), Expect = 3.566e-12
Identity = 86/361 (23.82%), Postives = 159/361 (44.04%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILL 1276
            A + G+ + VK L+E+  +  D       T LH   +  +     ++L    Q      K G+T LH+A        +  LL +  + N    +  + L +AV ++N + VKLL       + T  NG + +H AAK       +N+LE+ + LL++GA+ +   L   +PL  A        +  LI K A +   + +GL+ LH     G++ I  ML+      +        T L  AC Y N+ +V+ LL++ ++VN++        H A+ +G    + +L ++     ++  +   PL  A   G+  +++ L    E    ++    HR S  +T   +  V ++  + ++ L
Sbjct:  418 AARMGHKELVKLLMEHKANP-DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM-TKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAK-------QNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQ-GASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRMSFPETVDEILDVSEDEGVAQLTL 768          

HSP 13 Score: 71.633 bits (174), Expect = 7.260e-12
Identity = 61/238 (25.63%), Postives = 100/238 (42.02%), Query Frame = 2
Query:  662 HGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-------------------DDYKFD--LETTDSN-------NCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            +GA+++       SPL  A   N+L  +K+L+E GA        G + L  A   G+  ++ +L+                   DD +    L   D N         T L  A  Y N+ V +LLL RG+NVN          H AS +G++  +++L      +     D   PLH A+  GH  +VE L+    P       +  +  NG + +H++   D+++  + LLQ  A+
Sbjct:   41 YGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAP-------LQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAE 271          

HSP 14 Score: 55.4546 bits (132), Expect = 6.402e-7
Identity = 43/144 (29.86%), Postives = 65/144 (45.14%), Query Frame = 2
Query:  869 FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNI 1300
             DLETT     TAL  A       VV  L+  G+NVNA+  K  +  + A+ +  L+ ++ L ++  N      D   PL  A  +GH  +V  LI N   K K+             ALH++   D+     +LLQN  +P++
Sbjct:   10 IDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI-NYGTKGKVR----------LPALHIAARNDDTRTAAVLLQNDPNPDV 142          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: espnlb (espin like b [Source:ZFIN;Acc:ZDB-GENE-070912-481])

HSP 1 Score: 108.612 bits (270), Expect = 2.645e-23
Identity = 88/328 (26.83%), Postives = 150/328 (45.73%), Query Frame = 2
Query: 2036 SCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNA-NVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGD-IECRDRVSRTPLLLAINVNHVEAVETLLKN-GANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            + R G+ E + +    G     I D  G + +H++ +N +L   E ++ +     N   +   T  H    +  I  L  LLK     +   DG G TAL+LA  + +  A++    ++  +    +   + G  P+HYA        +     T +++L+  +   ++C+     TPL LA    H+  VE L+K+ GAN   +    +  +H     G+  +   LA F + D +  D NG T + +A S  + +IV+RL+ +  K+ + D +G T  H AAE G  +C  +LL+  + P  +  DG   LH A Y GY + A  L
Sbjct:    9 AAREGDVEALRALHVSGCLSPTITDAQGASPVHHAARNGQLDCLEFLVHEGYFQCNTRTKNGATAAHDAAATGHIRELQWLLKQETCGIEDRDGEGATALHLAARFGHAEAVQ----WLLFEGGNTEAETDCGARPVHYA--------AASGDLTSLKMLMSSSPRCVDCQTGTGATPLYLACQEGHLHVVEYLVKDCGANVHVQAKDGMSVLHAAAHMGHYALVVWLASFTDLDLSCQDKNGATALHFAASEGHHRIVERLLLMGVKV-LKDHWGGTPLHDAAENGELECCRVLLNNHISPLERDSDGFTALHLAEYNGYHDCANFL 323          

HSP 2 Score: 73.559 bits (179), Expect = 1.692e-12
Identity = 86/367 (23.43%), Postives = 156/367 (42.51%), Query Frame = 2
Query:  194 LKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES--CVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNP-DINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEK-GACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKD-----NLEICK 1267
            ++A +EG+ + ++ L  +      + D    + +H+  +     C+E ++       +T  KNG T  H A+       L++LL +    I  R+ +  ++L LA  + + EAV+ L             G  P+HYAA        +  +            +D       +PL  A    +L  +++L++  GA ++ +   G+S+LH A   G+  ++  L      DL   D N  TAL +A S  +  +VE LL  G  V  +D       H A+  G+L+  +VL   +++  + ++D    LH A Y G+++   FL      +   +  I    +   TA     ++D      +EICK
Sbjct:    7 IQAAREGDVEALRALHVSGCLSPTITDAQGASPVHHAARNGQLDCLEFLVHEGYFQCNTRTKNGATAAHDAAATGHIRELQWLLKQETCGIEDRDGEGATALHLAARFGHAEAVQWLLFEGGNTEAETDCGARPVHYAAASGDLTSLKMLMSSSPRC------VDCQTGTGATPLYLACQEGHLHVVEYLVKDCGANVHVQAKDGMSVLHAAAHMGHYALVVWLASFTDLDLSCQDKNGATALHFAASEGHHRIVERLLLMGVKV-LKDHWGGTPLHDAAENGELECCRVLLNNHISPLERDSDGFTALHLAEYNGYHDCANFLRDAGAQQSPDIVLIEEERTLFSTADPYQDIEDLKHKSKMEICK 366          

HSP 3 Score: 62.003 bits (149), Expect = 5.365e-9
Identity = 55/207 (26.57%), Postives = 98/207 (47.34%), Query Frame = 2
Query:  743 MKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLER-GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQY-NVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKN 1357
            ++ L+ +G    ++   G   +HYA ++G+L  ++ML+      ++       T L  AC   ++ VVE L++  G+NV+ +     +  H A+  G    +  L  + +++L   + +    LH A+ +GH+ IVE L+        ++     ++  G T LH +     LE C++LL N   P    R S+G   TAL LA  N
Sbjct:  120 VQWLLFEGGNTEAETDCGARPVHYAAASGDLTSLKMLMSSSPRCVDCQTGTGATPLYLACQEGHLHVVEYLVKDCGANVHVQAKDGMSVLHAAAHMGHYALVVWLASFTDLDLSCQDKNGATALHFAASEGHHRIVERLL--------LMGVKVLKDHWGGTPLHDAAENGELECCRVLLNNHISP--LERDSDG--FTALHLAEYN 314          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: fbxo9 (F-box protein 9 [Source:Xenbase;Acc:XB-GENE-1002447])

HSP 1 Score: 115.931 bits (289), Expect = 1.375e-26
Identity = 96/343 (27.99%), Postives = 169/343 (49.27%), Query Frame = 2
Query:  377 GYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF---INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETK--LLIVKFNG 1390
            G+++LH A+       ++YLL K   +N R+  S + L  A    + E    L +  A  +I +  G +P+H AA           L  + IL+++ A ID  D  K +PL W   ++ +  +++L+  GA +  K ++G+++LH +   GNL++I  LL+    D+   D N  TAL  A    +  +++ LL++G+ VN  D       H A+G+G  + + +L +    +  ++  +  PLH A+YKG N+    L          L F   I+ ++  G+T LHL+  + + ++ K L + GADP +  + +     TA D+A ++  K  L IV   G
Sbjct:   93 GWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPLHLAA-------ANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNT-NVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQNLTPLHHAAYKGQNDTSSIL----------LQFGADIDSKDWLGKTPLHLAVERGHFDVVKTLKEWGADPWVKTKWNE----TATDMALQSNRKDILSIVDMRG 413          

HSP 2 Score: 87.8113 bits (216), Expect = 2.431e-17
Identity = 82/315 (26.03%), Postives = 137/315 (43.49%), Query Frame = 2
Query: 2009 ESYKDY--LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELILK--KTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSK 2935
            + Y+ +  L ++   G+  +V   +  G  V+ +RD    T LH +    + EL + +L+    P++VN   ET L   H+   +  +  + +L++N A+++  D N  T L    I + +  LE    Y+      ++    +G   LH +        ++      +  LL  N DI  +D    T L LA    H + ++ LLK GA     DI +L  +H     G  EI   L + +    N  D   LTP+ +A           L++  A +D  D  G+T  H A E+G F  ++ L  +G DPW K
Sbjct:   89 QDYRGWSLLHSAAFCGDLALVKYLLQKGASVN-LRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPL---HLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLE----YLVSLGASLEEKSTTGMTLLHLS--------ALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAGRGYTEIVT-LLLKQKAAVNNMDIQNLTPLHHAAYKGQNDTSSILLQFGADIDSKDWLGKTPLHLAVERGHFDVVKTLKEWGADPWVK 386          

HSP 3 Score: 82.4185 bits (202), Expect = 1.342e-15
Identity = 98/363 (27.00%), Postives = 159/363 (43.80%), Query Frame = 2
Query: 2009 ESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRND 3091
            E+ K  L  + R G+ + V + ++ G  V+  +D  G +LLH +    +  L + +L+K    VN  D  + T LH    +   E    LL+  A  +  +  G T L+LA    +L    C+   I +K   I I DN+   PL +    C     +      +E L+ +   +E +     T L L+    +++ +  LL    +   +DI  L ++H     G+ +I   L + +    N+TD N LTP+  A      +IV  L++  A ++ +D    T  H AA KG      +LL +G D  SK   G  PLH A  RG+ ++ +  L    A   V  K N   T + L + R D
Sbjct:   58 ENKKTSLHEAVRRGDMDQVNTLLNFGIAVN-CQDYRGWSLLHSAAFCGDLALVKYLLQKGAS-VNLRDVRSYTPLHRAAWTGHAELTDYLLQCGALPDIVNYCGETPLHLAAANGHLL---CVKILIQNKAS-IDIKDNNKWTPLQW----CSINDQI----DVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCL-LKKGAIVNITDINHLTPLHRAAGRGYTEIVTLLLKQKAAVNNMDIQNLTPLHHAAYKGQNDTSSILLQFGADIDSKDWLGKTPLHLAVERGHFDVVKT-LKEWGADPWVKTKWNETATDMALQSNRKD 404          

HSP 4 Score: 77.411 bits (189), Expect = 5.016e-14
Identity = 75/261 (28.74%), Postives = 129/261 (49.43%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES--CVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNV 976
            A   G+   VK L++N   + D++D    T L +C   +    +E ++S+   L +     G T+LHL+++      + YLL+ N DIN ++ +  ++L LA    + + +K L +  A VNITD+N ++P+H AA            EI+ +LLK  A ++ +D+   +PL  A           L++ GA I SKD  G + LH A   G+ ++++  L ++  D       N TA   A   N  D++ ++  RG N+
Sbjct:  166 AAANGHLLCVKILIQNKASI-DIKDNNKWTPLQWCSINDQIDVLEYLVSLGASL-EEKSTTGMTLLHLSALAGNLQVINYLLNTNVDINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVNITDINHLTPLHRAAG-------RGYTEIVTLLLKQKAAVNNMDIQNLTPLHHAAYKGQNDTSSILLQFGADIDSKDWLGKTPLHLAVERGHFDVVKT-LKEWGADPWVKTKWNETATDMALQSNRKDILSIVDMRGMNL 416          

HSP 5 Score: 65.0846 bits (157), Expect = 4.160e-10
Identity = 60/211 (28.44%), Postives = 95/211 (45.02%), Query Frame = 2
Query: 2504 LLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            LL     + C+D    + L  A     +  V+ LL+ GA+   RD+++   +H     G+ E+ + L       P++ +  G TP+  A +N +   VK LI+  A +DI D    T     +       LE L+S G     K   G   LH +A  G  ++   LLNT     ++N K+ +G TALHLAA      +   L+ K + +N
Sbjct:   79 LLNFGIAVNCQDYRGWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLLQCGAL-PDIVNYCGETPLHLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLLNTNV---DINVKDINGLTALHLAAENGHSKIIKCLLKKGAIVN 285          

HSP 6 Score: 56.9954 bits (136), Expect = 1.676e-7
Identity = 43/136 (31.62%), Postives = 68/136 (50.00%), Query Frame = 2
Query:  893 NNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNI 1300
            N  T+L  A    ++D V  LL  G  VN +D +  +  H A+  GDL  ++ L Q   ++   +  S  PLH A++ GH E+ ++L+        I+N+       G+T LHL+    +L   KIL+QN A  +I
Sbjct:   59 NKKTSLHEAVRRGDMDQVNTLLNFGIAVNCQDYRGWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAELTDYLL-QCGALPDIVNYC------GETPLHLAAANGHLLCVKILIQNKASIDI 187          

HSP 7 Score: 51.2174 bits (121), Expect = 8.850e-6
Identity = 53/214 (24.77%), Postives = 94/214 (43.93%), Query Frame = 2
Query:  806 LHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNY----PLHEASYKGHNEIVEFLITN-----------------------MEPKEKILNF---INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKN 1357
            LH A   G+++ +  LL+ +   +   D    + L  A    ++ +V+ LL++G++VN  D +     H A+  G  +    L  Y +    L +  NY    PLH A+  GH   V+ LI N                       ++  E +++    +  +++ G T LHLS +  NL++   LL    + N+ + V +   +TAL LA +N
Sbjct:   64 LHEAVRRGDMDQVNTLLN-FGIAVNCQDYRGWSLLHSAAFCGDLALVKYLLQKGASVNLRDVRSYTPLHRAAWTGHAE----LTDYLLQCGALPDIVNYCGETPLHLAAANGHLLCVKILIQNKASIDIKDNNKWTPLQWCSINDQIDVLEYLVSLGASLEEKSTTGMTLLHLSALAGNLQVINYLL----NTNVDINVKDINGLTALHLAAEN 268          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 117.857 bits (294), Expect = 5.507e-26
Identity = 108/369 (29.27%), Postives = 169/369 (45.80%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIE----RLPL-----LLKNNANVNFPDGNGRTALNLAVIYNNLAALECMN-DYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNE-KNNSGQTALHLA 3076
            L A+   GN E +   +  G + ++ +D+ G+T LHY+  N   + LF L+   +   VN  DE   + LH    S   E      PL     LL+N+AN    D +G  A++ A  Y +   LE ++ D + D      I       PLH A+               +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D +     +H     G+ E    L    N D     ++ D NG TP+  +V N + + V  L+   A +D  D++GRT  H+ A  G  +C+E LL +  +   +   G  P+H AA  G+  +   LL T  +++ V    +N G T LH A
Sbjct:  401 LHAAAAGGNLECLNLLLSTGADFNK-KDKFGRTPLHYAAANCNYQCLFALV--GSGASVNDLDERGCSPLHYAATSDTDEDCGTTFPLQCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELVSTDMLNDAETRAPIS------PLHLAVSTFS-----------LEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLL--IGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWA 747          

HSP 2 Score: 85.8853 bits (211), Expect = 3.500e-16
Identity = 98/360 (27.22%), Postives = 150/360 (41.67%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVF---------ENFDP---------------------NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEK--GAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            ++D   +T LH +  L + E+ EL++      VN  D   LT LH  + S   + + +LLK++A+VN  D N +T                                     PLH    I    K+V +C    E L+ +  ++   DR  RT L  A    HVE V  LL  GAN    D ++  ++H+    G++E+   L            +++ P                     N ++  G TP+  A  N  + +V  LI+  A ++ V++ G T  H AA    GA  CLELL+  G D   K  DG  PLH  A  G    ++I++   + I+   +KN  G T LH+AA
Sbjct:   19 VQDNEKRTPLHAAAYLGDAEIIELLILSGAR-VNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQT-------------------------------------PLH----IAAANKAV-KCA---EALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGAL-CLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEID-CEDKN--GNTPLHIAA 328          

HSP 3 Score: 83.5741 bits (205), Expect = 1.994e-15
Identity = 87/362 (24.03%), Postives = 149/362 (41.16%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAX--------------------------XXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNG 1285
            T LH A+ +     +  L+     +N +++   + L  AV   + +AV++L +++A+VN  D N  +P+H AA  KA                                 +E++++LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +I+ LLD     +  +++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q++ Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G
Sbjct:   26 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLD---LGMNESNAYGNTPLHVAC-YNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSK-------RGIHGMFPLHLAALSGFSDCCRKLLSSG 376          

HSP 4 Score: 82.0333 bits (201), Expect = 5.428e-15
Identity = 94/379 (24.80%), Postives = 160/379 (42.22%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI---------EICKYKKSVCQ-------------CKTYMELLLEM---NG-DIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAV----SNCNEKI------VKRLIELNA-KLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRN---DCPMCFLL 3112
            + D++G+T LH++    + E+  L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++ + D   +++      +  GN PLH A          E+     +V Q               T+  L LE+   NG D+  + +  +TPL +          + +++NGA     D      +H     G+  + N L +    D +    +G+ P+  A     S+C  K+      +K    L    +D  D +GRT  H AA  G  +CL LLLS G D   K   G  PLH AA     +    L+ + +++ +++E+   G + LH AA  +   DC   F L
Sbjct:  118 VSDRAGRTALHHAAFSGHVEMVSLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGMNES------NAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL-ITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGCSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDER---GCSPLHYAATSDTDEDCGTTFPL 485          

HSP 5 Score: 82.0333 bits (201), Expect = 6.432e-15
Identity = 97/415 (23.37%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLD---LYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF----INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    +   V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       +  LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA              +  ++K+  D+ G++    Y  +PL  A  +     +  LI+ GA +   +  G + LH+A ++ +  +   LL     D+     +  T L     +      +++++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++    +   +     I+  +  G+T LH +    NLE   +LL  GAD N   +   G++      AN N   L  +  +G S +DL
Sbjct:   61 LHRAVASCSEDAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVKCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAAS-----------SGMISVIKYLLDL-GMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGCSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKF--GRTPLHYAAANCNYQCLFALVGSGASVNDL 459          

HSP 6 Score: 81.2629 bits (199), Expect = 9.584e-15
Identity = 92/402 (22.89%), Postives = 159/402 (39.55%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM---------NDYITDKTRF------------------------IQIPDNSGNYPLHYAI----EICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFN---QLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE--------------------------LNAKLD-----------IVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            IRD+ G   +HY+        L L  T  L +      ++ LH+ + +  +E   +L+++  +++  +  GRT L+LA    ++  ++ +          DY+  +T                          + I D +G  PL  ++      C Y             LL    +++ +D+  RT L       H E VE LL++ ANFL RD +    +H   + G++ + +   Q A+  +  P + D +G TP+ +A  N ++  V+ L+E                          +N+ L            I      T  H AA     +CL+LLLS+     +    G  PL  AA  G     E+L+++  A   + +KN +  TALHLA
Sbjct:  500 IRDKHGYNAVHYAAAYGHRLCLELVSTDMLNDAETRAPISPLHLAVSTFSLE---VLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYS------------LLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVYVLHNNKINSDLVATVENDYHLLLIFAFSSVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKN--TALHLA 884          

HSP 7 Score: 76.6406 bits (187), Expect = 2.598e-13
Identity = 66/253 (26.09%), Postives = 124/253 (49.01%), Query Frame = 2
Query:  665 GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFL-----------------ITNMEPKEKILNF-------INHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            GA ++  D    +PL  AV S +   ++ L++  A + ++D +  + LH A +N  ++  + L+     ++  +D    TAL +A    +V++V LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   ++++L                 +     ++ ++N        +N  N  G T LH +    +  +C ++L+ NGAD NI  +  +GK+   MTA+
Sbjct:   47 GARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLS-NVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNI--KSKDGKTPLHMTAI 296          

HSP 8 Score: 69.3218 bits (168), Expect = 5.199e-11
Identity = 60/231 (25.97%), Postives = 104/231 (45.02%), Query Frame = 2
Query: 2384 TDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            T+ +  + + DN    PLH A  +   +         +ELL+     +  +D    TPL  A+     +AV+ LLK+ A+   RD      +H   +   ++    L    + + NV+D  G T + +A  + + ++V  L+   A ++  D+  R   H AA  G  + ++LL+++G +   K      PLH AA  G   + + LL+       +NE N  G T LH+A
Sbjct:   11 TEVSVLMLVQDNEKRTPLHAAAYLGDAE--------IIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLS-NVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDL-----GMNESNAYGNTPLHVA 227          

HSP 9 Score: 67.781 bits (164), Expect = 1.401e-10
Identity = 83/339 (24.48%), Postives = 145/339 (42.77%), Query Frame = 2
Query:  194 LKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK---YESCVELILSVAPQLLDTGEKNGYTVLHLASM---------IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCE---NNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKD-SSGLSILHYATSNGNLEIIQMLLD--DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI 1156
            L A   G N +   LL +     + +D   +T LHY      Y+ C+  ++     + D  E+ G + LH A+            P   L YLL  + +   R+    +++  A  Y +   ++L+     N+AE        +SP+H A    +       L           D+D  +   R+PL  A    ++  +  LI +GA I  KD     + +H A  NG+ E +++L+   D +  ++  D N  T LM +    + + V  LL +G+NV+A+D   R A H  +  G  + ++ L Q+N N    +     P+H A+  GH  ++  L+
Sbjct:  401 LHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQ-CLFALVGSGASVNDLDER-GCSPLHYAATSDTDEDCGTTFPLQCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELVSTDMLNDAETRAP----ISPLHLAVSTFSLEVLVQSLL----------DLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALL 723          

HSP 10 Score: 64.3142 bits (155), Expect = 1.636e-9
Identity = 78/341 (22.87%), Postives = 138/341 (40.47%), Query Frame = 2
Query:  341 VAPQLLDTGE------KNGYTVLHLASM-IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNE---------IVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDN---LEICKILLQNGADPNIPL 1306
            V  +L+D G       + G+T LH A+        L  L+    D+N ++ D ++ L +  I+      +++ +N AE++  D NG +P+H AA+    L     +       K G       ++   PL  A  S      + L+          SSG SI  + +  G             FD++T D    T L  A +  N++ + LLL  G++ N +D   R   H+A+   + + L  L     ++  L+     PLH A+    +E          +E+L+ N +    I      R+ +G  A+H +    +   LE+    + N A+   P+
Sbjct:  235 VVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRG-------IHGMFPLHLAALSGFSDCCRKLL----------SSGCSIKLFFSLEG-------------FDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDEDCGTTFPLQCLEYLLRN-DANPGI------RDKHGYNAVHYAAAYGHRLCLELVSTDMLNDAETRAPI 538          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 117.857 bits (294), Expect = 6.073e-26
Identity = 106/365 (29.04%), Postives = 168/365 (46.03%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM-----NDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNE-KNNSGQTALHLA 3076
            L A+   GN E +   +  G + ++ +D+ G+T LHY+  N   + LF L+   +   VN  DE   + LH    S    + L  LL+N+AN    D +G  A++ A  Y +   LE +      D + D      I       PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D +     +H     G+ E    L    N D     ++ D NG TP+  +V N + + V  L+   A +D  D++GRT  H+ A  G  +C+E LL +  +   +   G  P+H AA  G+  +   LL T  +++ V    +N G T LH A
Sbjct:  425 LHAAAAGGNLECLNLLLSTGADFNK-KDKFGRTPLHYAAANCNYQCLFALV--GSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELLMETSGTDMLNDAETRAPIS------PLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLL--IGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWA 770          

HSP 2 Score: 94.3597 bits (233), Expect = 1.124e-18
Identity = 96/355 (27.04%), Postives = 157/355 (44.23%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN--KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEK--GAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            L A+  +G+ EI+   I  G  V+  +D    T LH ++ +  ++  +++LK + + VN  D+   T LH+   +K ++    L+   +NVN  D  GRTAL+ A                            SG+  +                   + LLL    +I   D+  R  +  A  + H+E V+ L+ +GA  + +D ++   +H   S G + +   L      D N ++  G TP+  A  N  + +V  LI+  A ++ V++ G T  H AA    GA  CLELL+  G D   K  DG  PLH  A  G    ++I++   + I+   +KN  G T LH+AA
Sbjct:   47 LHAAAYLGDAEIIELLILSGARVNA-KDSKWLTPLHRAVASCSEDAVQVLLKHSAD-VNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAF--------------------------SGHVEM-------------------VSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDL-GVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGAL-CLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEID-CEDKN--GNTPLHIAA 349          

HSP 3 Score: 92.8189 bits (229), Expect = 2.959e-18
Identity = 92/340 (27.06%), Postives = 156/340 (45.88%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN---NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANF----LTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIEL--NAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            ++R+ +G+T L  +    + E  ++++ +   ++ K      T +H   ++   E L LL+ N    A V+  DGNG+T L L+V+  +    EC+   + +K   +   D  G   LH        + +V   +  +E LL+ N +   RD   RTP+ LA    H+  +  LL+   +        D      +H+ C  G+   +E+  +  VF+  + N       +P+  AV N NE   + LI+    + ++ VD  GRT  H AA     +CL+LLLS+     +    G  PL  AA  G     E+L+++  A   + +KN +  TALHLA
Sbjct:  584 DVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHT---ECVYSLL-NKGANVDAKDKWGRTALH--------RGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGN-----SFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKN--TALHLA 904          

HSP 4 Score: 88.5817 bits (218), Expect = 6.185e-17
Identity = 99/415 (23.86%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-------INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    +   V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       +  LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +   +  G + LH+A ++ +  +   LL     D+     +  T L     +      +++++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++   +  I  F       I+  +  G+T LH +    NLE   +LL  GAD N   +   G++      AN N   L  +  +G S +DL
Sbjct:   80 LHRAVASCSEDAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVKCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDL-------GVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGCIRSSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKF--GRTPLHYAAANCNYQCLFALVGSGASVNDL 483          

HSP 5 Score: 86.2705 bits (212), Expect = 3.265e-16
Identity = 82/332 (24.70%), Postives = 159/332 (47.89%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEI-VEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            T LH A+ +     +  L+     +N +++   + L  AV   + +AV++L +++A+VN  D N  +P+H AA  KA    E  + ++       ++++  D   R+ L  A  S ++  +  L+ +GA I + D      +H+A   G++E++++L+  +  ++   D  + T L  A S   + V++ LL+ G ++N  ++      H A   G    +  L     N+ ++N     PLH A+   H  + +E L+ N          +N ++ +G+T LH++ +       +I++QNGA+  I     NG   T L +A +   +LLI
Sbjct:   45 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLL-------SNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLV-THGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGAD-------VNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAE--IDCEDKNGN--TPLHIAARYGHELLI 357          

HSP 6 Score: 85.5001 bits (210), Expect = 5.433e-16
Identity = 78/302 (25.83%), Postives = 132/302 (43.71%), Query Frame = 2
Query: 2234 VIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF-LLISKDSKIN 3136
             I + + + +  L+    +VNF D   RT L+ A    +   +E +   I    R +   D+    PLH A+  C         +  +++LL+ + D+  RD+  +TPL +A     V+  E L+   +N    D     ++H+    G++E+ + L +    + N  D      I +A    + ++VK L+   A++   D+   T  H AA  G    ++ LL  GVD       G  PLH A Y G   +   L++  +   NVN+ N  G T LH AA      +C  LL+   + +N
Sbjct:   17 AIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELL---ILSGAR-VNAKDSKWLTPLHRAVASCS--------EDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLL-LSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGA---NVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVN 302          

HSP 7 Score: 82.0333 bits (201), Expect = 6.753e-15
Identity = 80/332 (24.10%), Postives = 152/332 (45.78%), Query Frame = 2
Query:  488 LLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFL-------------------ITNMEPKEKILNF-------INHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSD 1402
            L+ A+   +P+ V+ L     +VN  D    +P+H AA +      E  +         GA ++  D    +PL  AV S +   ++ L++  A + ++D +  + LH A +N  ++  + L+     ++  +D    TAL +A    +V++V LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   ++++L                   +     ++ ++N        +N  N  G T LH +    +  +C ++L+ NGAD NI  +  +GK+   +   +   ++  I+  NG   D
Sbjct:   14 LVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILS-------GARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLS-NVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNI--KSKDGKTPLHMTAIHGRFSRSQIIIQNGAEID 335          

HSP 8 Score: 81.6481 bits (200), Expect = 8.349e-15
Identity = 91/377 (24.14%), Postives = 153/377 (40.58%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI---------EICKYKKSVCQ-------------CKTYMELLLEM---NG-DIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAV-------------SNCNEKIVKRLIELNA-KLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+  L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +   +  GN PLH A          E+     +V Q               T+  L LE+   NG D+  + +  +TPL +          + +++NGA     D      +H     G+  + N L +    D +    +G+ P+  A              S C    +K    L    +D  D +GRT  H AA  G  +CL LLLS G D   K   G  PLH AA     +    L+ + +++ +++E+   G + LH AA  +    C 
Sbjct:  137 VSDRAGRTALHHAAFSGHVEMVSLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIK----YLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL-ITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGCIRSSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDER---GCSPLHYAATSDTDGKCL 504          

HSP 9 Score: 81.2629 bits (199), Expect = 9.322e-15
Identity = 88/363 (24.24%), Postives = 152/363 (41.87%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKNKELFELILKKTPEL--VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA-----IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTP---SAIE--------NVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINE 3139
            RD++ +T LH +  NK + +      P L  VN  D    T LH    S  +E + LLL   AN+N  D   R A++ A    ++  ++ +  +  +    +   D     PLH A     I + KY             LL++  D+   +    TPL +A        V  L+  GAN    + +    +H+  +  +  +  +L V    D N+   +G TP+     +      + +I+  A++D  D+ G T  H AA  G    +  L++   D   +   G  PLH AA  G+ +    LL++    S+I+        +++  ++ G+T LH AA   +     LL+S  +  N+
Sbjct:  105 RDKNWQTPLHIAAANKAV-KCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAE----VMCKDKKSYTPLHAAASSGMISVIKY-------------LLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGCIRSSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNK 449          

HSP 10 Score: 78.1814 bits (191), Expect = 9.937e-14
Identity = 94/384 (24.48%), Postives = 165/384 (42.97%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNA--------------NVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENF-DPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHD-GTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G F      I +G E+ +  D++G T LH + +   EL    L  +    +K     +  LH+  +S   +    LL +                +++  D  GRT L+ A    NL   EC+N  ++    F +  D  G  PLHYA   C Y     QC   +  L+     +   D    +PL  A   +   + +E LL+N AN   RD     +VHY  + G+   LE+  + +  +   D     P  ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K +     P+H AA  G+ E   +L+        V+  + +GQT L L+ +       + L++K + ++
Sbjct:  319 GRFSRSQIIIQNGAEI-DCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGCIRSSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNL---ECLNLLLSTGADFNK-KDKFGRTPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELLMETSGTDMLNDAETRAP--ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVD 687          

HSP 11 Score: 77.7962 bits (190), Expect = 1.228e-13
Identity = 85/343 (24.78%), Postives = 144/343 (41.98%), Query Frame = 2
Query:  272 DLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDL--ETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVL-HQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            D   K L   C +  S ++L  S+    +DT +  G T LH A+       L  LLS   D NK++   R+ L  A    N + +  L  + A VN  D  G SP+HYAA                      +D DG                    +++L+   A    +D  G + +HYA + G+   +++L++    D+  +       + L  A  + +   +E+L++   +++  +S  R     A+ KG ++ + VL +Q    L K       P+H A+  GH+E +  LI N + +      ++  + NGQT L LS +  + E    LL  GA+
Sbjct:  388 DCCRKLLSSGCIR--SSIKLFFSLEGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAAT---------------------SDTDG------------------KCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAA----VDIHDGNGQTPLMLSVLNGHTECVYSLLNKGAN 685          

HSP 12 Score: 72.7886 bits (177), Expect = 4.006e-12
Identity = 111/476 (23.32%), Postives = 191/476 (40.13%), Query Frame = 2
Query:  194 LKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK---YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKP-PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNG---VSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKD-SSGLSILHYATSNGNLEIIQMLLD--DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWK-------------------------------------LNNDSNYPLHEASYKGHNEIVEFL---------------------ITNMEPKEKIL------NFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSS 1399
            L A   G N +   LL +     + +D   +T LHY      Y+ C+  ++     + D  E+ G + LH A+        L YLL  + +   R+    +++  A  Y +   ++LL E +    + D      +SP+H AA            + + +L++   D+D  +   R+PL  A    ++  +  LI +GA I  KD     + +H A  NG+ E +++L+   D +  ++  D N  T LM +    + + V  LL +G+NV+A+D   R A H  +  G  + ++ L Q+N N                                         +N    PLH A Y GH+  VE L                     I + E   ++L      + +N  +S G+T LH +   D++E  ++LL + A  N            A+D   K  T L++   NG++S
Sbjct:  425 LHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQ-CLFALVGSGASVNDLDER-GCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELLMETSGTDMLNDAETRAPISPLHLAA-------YHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVN------------AVDSTGK--TPLMMAAENGQTS 877          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 116.701 bits (291), Expect = 1.389e-25
Identity = 107/372 (28.76%), Postives = 170/372 (45.70%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGN------------YPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNE-KNNSGQTALHLA 3076
            L A+   GN E +   +  G + ++ +D+ G+T LHY+  N   + LF L+   +   VN  DE   + LH    S    + L  LL+N+AN    D +G  A++ A  Y +   LE     I  +T    + + SG              PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D +     +H     G+ E    L    N D     ++ D NG TP+  +V N + + V  L+   A +D  D++GRT  H+ A  G  +C+E LL +  +   +   G  P+H AA  G+  +   LL T  +++ V    +N G T LH A
Sbjct:  436 LHAAAAGGNLECLNLLLSTGADFNK-KDKFGRTPLHYAAANCNYQCLFALV--GSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLE----LIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLL--IGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWA 790          

HSP 2 Score: 101.293 bits (251), Expect = 7.145e-21
Identity = 102/416 (24.52%), Postives = 173/416 (41.59%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGE------KNGYTVLHLASM-IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGA--------------------------DIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYN-NVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQ-------YNVNLWKLNNDSNY-----PLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            SY  L  A   G    +K LL+   D+ +     +  L   C+  +  V        +L+D G       + G+T LH A+        L  L+    D+N ++ D ++ L +  I+      +++ +N AE++  D NG +P+H AA+    L     +       K G                           DID  D + R+ L  A    NL  +  L+  GA    KD  G + LHYA +N N + +  L+      +   D   C+ L YA + + +   +E LL   +N    D    NA H+A+  G    L+++ +          +   + ND+       PLH A+Y GH++ +E L+      + +L+ ++ RNS G+T L L+  K ++E   +L+  GA
Sbjct:  233 SYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVV------VNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGS-GASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLV------QSLLD-LDVRNSTGRTPLDLAAFKGHVECVDVLINQGA 634          

HSP 3 Score: 92.4337 bits (228), Expect = 3.498e-18
Identity = 92/385 (23.90%), Postives = 167/385 (43.38%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSLK--NKELFELILKKTP----------ELVNKFD-ETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM---------NDYITDKTRF------------------------IQIPDNSGNYPLHYAI----EICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFN---QLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE--LNAKLDIVDQYGRTLC-----HKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            IRD+ G   +HY+    ++   ELI ++TP          +++N  +    ++ LH+       + L +L+++  +++  +  GRT L+LA    ++  ++ +          DY+  +T                          + I D +G  PL  ++      C Y             LL    +++ +D+  RT L       H E VE LL++ ANFL RD +    +H   + G++ + +   Q A+  +  P + D +G TP+ +A  N ++  V+ L+E  +  K++  + +    C     H AA     +CL+LLLS+     +    G  PL  AA  G     E+L+++  A   + +KN +  TALHLA
Sbjct:  527 IRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYS------------LLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKME-GNSFSPLHCAVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKN--TALHLA 896          

HSP 4 Score: 89.3521 bits (220), Expect = 3.262e-17
Identity = 99/343 (28.86%), Postives = 145/343 (42.27%), Query Frame = 2
Query: 2153 ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFE--------------------------------NFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEK--GAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            E+  LI KK  E VN  D    T LH      + E + LL+ + A VN  D    T L+ AV   +  A++ +  +  D    +   D +   PLH    I    K+V +C    E L+ +  ++   DR  RT L  A    HVE V  LL  GAN    D ++  ++H+    G++E+   L                                      D N ++  G TP+  A  N  + +V  LI+  A ++ V++ G T  H AA    GA  CLELL+  G D   K  DG  PLH  A  G    ++I++   + I+   +KN  G T LH+AA
Sbjct:   50 EVRALIFKK--EDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSAD----VNARDKNWQTPLH----IAAANKAV-KCA---EALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGAL-CLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEID-CEDKN--GNTPLHIAA 374          

HSP 5 Score: 87.4261 bits (215), Expect = 1.405e-16
Identity = 89/364 (24.45%), Postives = 151/364 (41.48%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAX--------------------------XXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            T LH A+ +     +  L+     +N +++   + L  AV   + +AV++L +++A+VN  D N  +P+H AA  KA                                 +E++++LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +I+ LL D   D+  +++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q++ Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G D
Sbjct:   70 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLL-DLGVDMNESNAYGNTPLHVAC-YNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFD 424          

HSP 6 Score: 87.0409 bits (214), Expect = 1.781e-16
Identity = 98/409 (23.96%), Postives = 173/409 (42.30%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    +   V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       +  LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +   +  G + LH+A ++ +  +   LL     D+     +  T L     +      +++++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++         F I+  +  G+T LH +    NLE   +LL  GAD N   +   G++      AN N   L  +  +G S +DL
Sbjct:  105 LHRAVASCSEDAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVKCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDL-------GVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSS--------GFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKF--GRTPLHYAAANCNYQCLFALVGSGASVNDL 494          

HSP 7 Score: 86.2705 bits (212), Expect = 2.677e-16
Identity = 88/363 (24.24%), Postives = 153/363 (42.15%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI---------EICKYKKSVCQ-------------CKTYMELLLEM---NG-DIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+  L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +   +  GN PLH A          E+     +V Q               T+  L LE+   NG D+  + +  +TPL +          + +++NGA     D      +H     G+  + N L +    D +    +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLLS G D   K   G  PLH AA     +    L+ + +++ +++E+   G + LH AA  +    C 
Sbjct:  162 VSDRAGRTALHHAAFSGHVEMVSLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIK----YLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL-ITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDER---GCSPLHYAATSDTDGKCL 515          

HSP 8 Score: 83.1889 bits (204), Expect = 2.410e-15
Identity = 94/379 (24.80%), Postives = 164/379 (43.27%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENF----------DPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHD-GTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G F      I +G E+ +  D++G T LH + +   EL    L  +    +K     +  LH+  +S   +    LL +  +++  D  GRT L+ A    NL   EC+N  ++    F +  D  G  PLHYA   C Y     QC   +  L+     +   D    +PL  A   +   + +E LL+N AN   RD     +VHY  + G+   LE+  +    +            D     P  ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K +     P+H AA  G+ E   +L+        V+  + +GQT L L+ +       + L++K + ++
Sbjct:  344 GRFSRSQIIIQNGAEI-DCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNL---ECLNLLLSTGADFNK-KDKFGRTPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAP--ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVD 707          

HSP 9 Score: 82.4185 bits (202), Expect = 4.292e-15
Identity = 80/332 (24.10%), Postives = 152/332 (45.78%), Query Frame = 2
Query:  488 LLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFL-------------------ITNMEPKEKILNF-------INHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSD 1402
            L+ A+   +P+ V+ L     +VN  D    +P+H AA +      E  +         GA ++  D    +PL  AV S +   ++ L++  A + ++D +  + LH A +N  ++  + L+     ++  +D    TAL +A    +V++V LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   ++++L                   +     ++ ++N        +N  N  G T LH +    +  +C ++L+ NGAD NI  +  +GK+   +   +   ++  I+  NG   D
Sbjct:   39 LVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILS-------GARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLS-NVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNI--KSKDGKTPLHMTAIHGRFSRSQIIIQNGAEID 360          

HSP 10 Score: 72.7886 bits (177), Expect = 4.606e-12
Identity = 106/456 (23.25%), Postives = 189/456 (41.45%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES--CVELILSVAP-----------QLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITD-VNGVSPMHYAA-------------------KVKAXXXXXXXXXXXXXXXKH----------GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD-YKFDL--ETTDSNNCTALMYACSYNNVDV-VELLLERGSNVNAEDSKRR------NATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A  + + K ++ LL N  + G +RD      +HY   Y    C+ELI    P            L D   +   + LHLA+      +L  L+    D++ RN+  R+ L LA    + E V +L    A + + D V   +P+H AA                    V           ++++L  H          GA++D  D + R+ L     + +   ++ L++  A    +D  G + +H A + G++ ++  LL      D+     D++  T L +AC YN  D  VELLLE+      E +            H A+    ++ LQ+L  +N  +  +++    PL  A+  G    VE L+++ +    +      ++ N  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  506 ATSDTDGKCLEYLLRNDANPG-IRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWAC-YNGHDACVELLLEQEVFQKMEGNSFSPLHCAVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTL------QDKNKNTALHLACSKGHETSALLILEQITDRNL-INATNSALQTPLHVAARNGLTVVVQELLGKGASVL 952          

HSP 11 Score: 67.3958 bits (163), Expect = 2.016e-10
Identity = 81/310 (26.13%), Postives = 127/310 (40.97%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA------------IEICKYKK------SVCQCKTY-------------MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNG-ANFLTRDIQNLCSVHYVCSEGN----LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            +I D +G+T L  S+ N   E    +L K    V+  D+   T LH   ++   E +  LL++NAN    D  GRT ++LA    ++  L  +            I DN G  PLH+A            +E   ++K      S   C                ++LLL  N  +   D   +TPL++A       AVE L+ +  A+   +D     ++H  CS+G+    L I  Q  + +    N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  674 DIHDGNGQTPLMLSVLNGHTECVYSLLNKGAN-VDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQ--ITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 980          

HSP 12 Score: 65.855 bits (159), Expect = 5.120e-10
Identity = 81/340 (23.82%), Postives = 149/340 (43.82%), Query Frame = 2
Query:  194 LKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK---YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKP-PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNG------------VSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKD-SSGLSILHYATSNGNLEIIQMLLD--DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI 1156
            L A   G N +   LL +     + +D   +T LHY      Y+ C+  ++     + D  E+ G + LH A+        L YLL  + +   R+    +++  A  Y +   ++L+        + + +G            +SP+H AA            + + +L++   D+D  +   R+PL  A    ++  +  LI +GA I  KD     + +H A  NG+ E +++L+   D +  ++  D N  T LM +    + + V  LL +G+NV+A+D   R A H  +  G  + ++ L Q+N N    +     P+H A+  GH  ++  L+
Sbjct:  436 LHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQ-CLFALVGSGASVNDLDER-GCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAA-------YHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALL 766          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: rev1 (REV1, DNA directed polymerase [Source:Xenbase;Acc:XB-GENE-968197])

HSP 1 Score: 116.701 bits (291), Expect = 1.450e-25
Identity = 107/372 (28.76%), Postives = 170/372 (45.70%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGN------------YPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNE-KNNSGQTALHLA 3076
            L A+   GN E +   +  G + ++ +D+ G+T LHY+  N   + LF L+   +   VN  DE   + LH    S    + L  LL+N+AN    D +G  A++ A  Y +   LE     I  +T    + + SG              PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D +     +H     G+ E    L    N D     ++ D NG TP+  +V N + + V  L+   A +D  D++GRT  H+ A  G  +C+E LL +  +   +   G  P+H AA  G+  +   LL T  +++ V    +N G T LH A
Sbjct:  409 LHAAAAGGNLECLNLLLSTGADFNK-KDKFGRTPLHYAAANCNYQCLFALV--GSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLE----LIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLL--IGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWA 763          

HSP 2 Score: 93.5893 bits (231), Expect = 1.789e-18
Identity = 95/412 (23.06%), Postives = 168/412 (40.78%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSLK--NKELFELILKKTP----------ELVNKFD-ETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM---------NDYITDKTRF------------------------IQIPDNSGNYPLHYAI----EICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFN---QLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIEL----------------------------------NAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            IRD+ G   +HY+    ++   ELI ++TP          +++N  +    ++ LH+       + L +L+++  +++  +  GRT L+LA    ++  ++ +          DY+  +T                          + I D +G  PL  ++      C Y             LL    +++ +D+  RT L       H E VE LL++ ANFL RD +    +H   + G++ + +   Q A+  +  P + D +G TP+ +A  N ++  V+ L+E                                    + ++ VD  GRT  H AA     +CL+LLLS+     +    G  PL  AA  G     E+L+++  A   + +KN +  TALHLA
Sbjct:  500 IRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYS------------LLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKN--TALHLA 897          

HSP 3 Score: 89.7373 bits (221), Expect = 2.948e-17
Identity = 99/343 (28.86%), Postives = 145/343 (42.27%), Query Frame = 2
Query: 2153 ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFE--------------------------------NFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEK--GAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            E+  LI KK  E VN  D    T LH      + E + LL+ + A VN  D    T L+ AV   +  A++ +  +  D    +   D +   PLH    I    K+V +C    E L+ +  ++   DR  RT L  A    HVE V  LL  GAN    D ++  ++H+    G++E+   L                                      D N ++  G TP+  A  N  + +V  LI+  A ++ V++ G T  H AA    GA  CLELL+  G D   K  DG  PLH  A  G    ++I++   + I+   +KN  G T LH+AA
Sbjct:   23 EVRALIFKK--EDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSAD----VNARDKNWQTPLH----IAAANKAV-KCA---EALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGAL-CLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEID-CEDKN--GNTPLHIAA 347          

HSP 4 Score: 87.0409 bits (214), Expect = 1.782e-16
Identity = 89/364 (24.45%), Postives = 151/364 (41.48%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAX--------------------------XXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            T LH A+ +     +  L+     +N +++   + L  AV   + +AV++L +++A+VN  D N  +P+H AA  KA                                 +E++++LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +I+ LL D   D+  +++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q++ Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G D
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLL-DLGVDMNESNAYGNTPLHVAC-YNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFD 397          

HSP 5 Score: 86.6557 bits (213), Expect = 2.204e-16
Identity = 88/363 (24.24%), Postives = 153/363 (42.15%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI---------EICKYKKSVCQ-------------CKTYMELLLEM---NG-DIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+  L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +   +  GN PLH A          E+     +V Q               T+  L LE+   NG D+  + +  +TPL +          + +++NGA     D      +H     G+  + N L +    D +    +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLLS G D   K   G  PLH AA     +    L+ + +++ +++E+   G + LH AA  +    C 
Sbjct:  135 VSDRAGRTALHHAAFSGHVEMVSLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIK----YLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTL-ITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDER---GCSPLHYAATSDTDGKCL 488          

HSP 6 Score: 86.6557 bits (213), Expect = 2.589e-16
Identity = 98/409 (23.96%), Postives = 173/409 (42.30%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    +   V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       +  LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +   +  G + LH+A ++ +  +   LL     D+     +  T L     +      +++++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++         F I+  +  G+T LH +    NLE   +LL  GAD N   +   G++      AN N   L  +  +G S +DL
Sbjct:   78 LHRAVASCSEDAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVKCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDL-------GVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSS--------GFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKF--GRTPLHYAAANCNYQCLFALVGSGASVNDL 467          

HSP 7 Score: 83.5741 bits (205), Expect = 1.902e-15
Identity = 99/415 (23.86%), Postives = 193/415 (46.51%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC-FK-YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINK----RNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACI----YSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLER--GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A   G+++ ++ L+++  D+ DVR+ T +T L    FK +  CV+++++    +L        T +H A++      LR L+  N D+       + + ++ L+L+V+  + E V  L    A V+  D  G + +H  A            E +  LL+H A+    D   R+P+  A    ++  +  L++    +       D+ G + LH+A  NG+   +++LL+   F  +  + N+ + L  A   +N    E+L++    S VN+ DSK R   H A+    ++ LQ+L  +N  +  +++    PL  A+  G    VE L+++ +    +      ++ N  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  557 AAYHGHHQALEVLVQSLLDL-DVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIG-NADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGA-------VTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVF--QKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTL------QDKNKNTALHLACSKGHETSALLILEQITDRNL-INATNSALQTPLHVAARNGLTVVVQELLGKGASVL 953          

HSP 8 Score: 83.1889 bits (204), Expect = 2.453e-15
Identity = 94/379 (24.80%), Postives = 164/379 (43.27%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENF----------DPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHD-GTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G F      I +G E+ +  D++G T LH + +   EL    L  +    +K     +  LH+  +S   +    LL +  +++  D  GRT L+ A    NL   EC+N  ++    F +  D  G  PLHYA   C Y     QC   +  L+     +   D    +PL  A   +   + +E LL+N AN   RD     +VHY  + G+   LE+  +    +            D     P  ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K +     P+H AA  G+ E   +L+        V+  + +GQT L L+ +       + L++K + ++
Sbjct:  317 GRFSRSQIIIQNGAEI-DCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNL---ECLNLLLSTGADFNK-KDKFGRTPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAP--ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVD 680          

HSP 9 Score: 81.6481 bits (200), Expect = 7.023e-15
Identity = 79/314 (25.16%), Postives = 147/314 (46.82%), Query Frame = 2
Query:  488 LLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFL-------------------ITNMEPKEKILNF-------INHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            L+ A+   +P+ V+ L     +VN  D    +P+H AA +      E  +         GA ++  D    +PL  AV S +   ++ L++  A + ++D +  + LH A +N  ++  + L+     ++  +D    TAL +A    +V++V LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   ++++L                   +     ++ ++N        +N  N  G T LH +    +  +C ++L+ NGAD NI  +  +GK+   MTA+
Sbjct:   12 LVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILS-------GARVNAKDSKWLTPLHRAVASCSEDAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLS-NVNVSDRAGRTALHHAAFSGHVEMVSLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVMCKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAASTHGALCLELLVCNGADVNI--KSKDGKTPLHMTAI 315          

HSP 10 Score: 67.0106 bits (162), Expect = 2.410e-10
Identity = 109/485 (22.47%), Postives = 191/485 (39.38%), Query Frame = 2
Query:  194 LKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK---YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKP-PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNG------------VSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKD-SSGLSILHYATSNGNLEIIQMLLD--DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWK-------------------------------------LNNDSNYPLHEASYKGHNEIVEFL---------------------ITNMEPKEKIL------NFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSS 1399
            L A   G N +   LL +     + +D   +T LHY      Y+ C+  ++     + D  E+ G + LH A+        L YLL  + +   R+    +++  A  Y +   ++L+        + + +G            +SP+H AA            + + +L++   D+D  +   R+PL  A    ++  +  LI +GA I  KD     + +H A  NG+ E +++L+   D +  ++  D N  T LM +    + + V  LL +G+NV+A+D   R A H  +  G  + ++ L Q+N N                                         +N    PLH A Y GH+  VE L                     I + E   ++L      + +N  +S G+T LH +   D++E  ++LL + A  N            A+D   K  T L++   NG++S
Sbjct:  409 LHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQ-CLFALVGSGASVNDLDER-GCSPLHYAATSDTDGKCLEYLLRNDANPGIRDKHGYNAVHYAAAYGHRLCLELIARETPLDVLMETSGTDMLNDAETRAPISPLHLAA-------YHGHHQALEVLVQSLLDLDVRNSTGRTPLDLAAFKGHVECVDVLINQGASILVKDYVVKRTPIHSAAINGHSECLRLLIGNADVQAAVDIHDGNGQTPLMLSVLNGHTECVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKGRTPLHAAAFTDHIECLQLLLSHNAQVN------------AVDSTGK--TPLMMAAENGQTS 870          

HSP 11 Score: 65.855 bits (159), Expect = 5.481e-10
Identity = 80/359 (22.28%), Postives = 151/359 (42.06%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYK--------------------------------FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLH-EASYKGHNEIVEFLITN 1162
            L  A   G+ + V  LL    ++ +  D  D+  +H+     +   V+L+++   +++   +K  YT LH A+     + ++YLL    D+N+ N    + L +A        V  L +  A VN  +  G +P+H+AA         +    + +L+ +GAD++      ++PL         ++ + +I+ GA I  +D +G + LH A   G+  +I  L+                                    FD++T D    T L  A +  N++ + LLL  G++ N +D   R   H+A+   + + L  L     ++  L+     PLH  A+     + +E+L+ N
Sbjct:  144 LHHAAFSGHVEMVSLLLSRGANI-NAFDKKDRRAIHWAAYMGHIEVVKLLVTHGAEVM-CKDKKSYTPLHAAASSGMISVIKYLLDLGVDMNESNAYGNTPLHVACYNGQDVVVNELIDCGANVNQVNERGFTPLHFAAA------STHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQIIIQNGAEIDCEDKNGNTPLHIAARYGHELLINTLITSRADTSKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTHDDFGRTCLHAAAAGGNLECLNLLLSTGADFNKKDKFGRTPLHYAAANCNYQCLFALVGSGASVNDLDERGCSPLHYAATSDTDGKCLEYLLRN 494          

HSP 12 Score: 60.4622 bits (145), Expect = 2.435e-8
Identity = 82/332 (24.70%), Postives = 135/332 (40.66%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFP------------------------------------DGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNG-ANFLTRDIQNLCSVHYVCSEGN----LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            G+ E V S ++ G  V + +D+ G+T LH      ++E  E +L+     + + D    T +H+      I  L  LL+   +V+                                      +GN  + L+ AVI +N  A E + D  T  T  +   D+ G  PLH A     +   + +C   ++LLL  N  +   D   +TPL++A       AVE L+ +  A+   +D     ++H  CS+G+    L I  Q  + +    N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  664 GHTECVYSLLNKGANV-DAKDKWGRTALHRGAVTGHEECVEALLQHNANFLLR-DCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEVFQKMEGNSFSPLHCAVINDNEGAAEMLID--TLGTSIVNSVDSKGRTPLHAA----AFTDHI-EC---LQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQ--ITDRNLINATNSALQTPLHVAARNGLTVVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 981          

HSP 13 Score: 55.0694 bits (131), Expect = 9.680e-7
Identity = 74/289 (25.61%), Postives = 124/289 (42.91%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLH--YCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINK----RNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSN---VNAEDSKRRNATHFASGKG 1030
            L+ +   G+ + V  LL    +V D +D   +T LH      +E CVE +L      L   +  G T +HLA+       L  LL     ++      +N   + L  A    +   V+LL E        + N  SP+H A         E  ++ +   + +  D  G     R+PL  A  ++++  ++ L+   A + + DS+G + L  A  NG    +++L+   K DL   D N  TAL  ACS  +     L+LE+ ++   +NA +S  +   H A+  G
Sbjct:  657 LMLSVLNGHTECVYSLLNKGANV-DAKDKWGRTALHRGAVTGHEECVEALLQHNANFL-LRDCRGRTPIHLAAACGHIGVLSALLQTAISVDVVPAIADNHGYTPLHWACYNGHDACVELLLEQEV-FQKMEGNSFSPLHCAVINDNEGAAEMLIDTLGTSIVNSVDSKG-----RTPLHAAAFTDHIECLQLLLSHNAQVNAVDSTGKTPLMMAAENGQTSAVEVLVSSAKADLTLQDKNKNTALHLACSKGHETSALLILEQITDRNLINATNSALQTPLHVAARNG 937          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 118.242 bits (295), Expect = 2.922e-26
Identity = 104/358 (29.05%), Postives = 166/358 (46.37%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNN-----LAALECMNDYI--TDKTRFIQIPDNSGNY-PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE-NVNEKNNSGQTALHLAAVRNDCPMCFLLISKD 3124
            +D+ G++ LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ +  Y +     L A E   D +  T  T  +   DN     PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D +     +H   + G+ E    L    N +P    ++ D NG TP+  +V N +   V  L+   A +D  D++GRT  H+ A  G  +C++ LL +G     +   G  P+H +A  G+  +   LL + ++++ N    +N G TALH A          LL+ +D
Sbjct:  280 KDKFGRSPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLL--IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQD 625          

HSP 2 Score: 91.2781 bits (225), Expect = 6.060e-18
Identity = 98/356 (27.53%), Postives = 161/356 (45.22%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN----NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNG----ANFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE-LNAKL-DIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            ++R+ SG+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    NA V+  DGNG+T L L+V+  +    +C+   + +K   +   D  G   LH        + +V   +  ++ LL+       RD   RTP+ L+    H+  +  LL++     AN    D     ++H+ C  G+   +E+  +  VF+  D N       +P+  AV N NE   + LI+ L A + +  D  GRT  H AA     +CL+LLLS      S    G  PL  AA  G     E+L+++ SA   + +K  S  TALHLA  +       L++ K
Sbjct:  423 DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNA-VDIQDGNGQTPLMLSVLNGHT---DCVYSLL-NKGANVDAKDKWGRTALH--------RGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNA-----FSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDK--SKNTALHLACGKGHETSALLILEK 758          

HSP 3 Score: 84.7297 bits (208), Expect = 5.908e-16
Identity = 102/362 (28.18%), Postives = 172/362 (47.51%), Query Frame = 2
Query:  260 GDVRDLTDK---TLLHYCFKYESCVELILSVAPQLLDTGEK--NGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTK-MKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFD--LET------TDSNN---CTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVL-HQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            G V D  DK   T LH   +Y   + LI ++     DT ++  +G   LHLA++       R LLS   DI+  ++  R+ L  A    N E + LL    A+ N  D  G SP+HYAA            + +  L+  GA ++ LD    +PL +A  S+   K +++L+   A    +D  G + +HY+ + G+   +Q++  +   D  +ET      +DS+N    + L  A  + +   +E+L++   +++  +S  R     A+ KG ++ + VL +Q    L K       P+H A+  GH+E +  LI N EP+    N ++ ++ NGQT L LS +  + +    LL  GA+
Sbjct:  175 GAVIDCEDKNGNTPLHIAARYGHEL-LINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAA-------NCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQ----NAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGAN 524          

HSP 4 Score: 80.4925 bits (197), Expect = 1.263e-14
Identity = 109/483 (22.57%), Postives = 194/483 (40.17%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHY--CFKYESCVELILSVAP-----------QLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITD-VNGVSPMHYAA-------------------KVKAXXXXXXXXXXXXXXXKH----------GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD---YKFDLETTDSNNCTALMYACSYNNVDVVELLLER----------------------------------GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A  + + K ++ LL N  + G +RD      +HY   + +  C++LI S  P            L D+  +   + LHLA+      +L  L+    D++ RN+  R+ L LA    + E V +L    A + + D V   +P+H AA                    V           ++++L  H          GA++D  D + R+ L     + +   +  L++ GA    +DS G + +H + + G++ ++  LL        +    D++  TAL +AC   +   VELLLE+                                   S VNA DSK R   H A+    ++ LQ+L   N  +   ++    PL  A+  G    VE L+++      +      ++ +  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  325 ATSDTDGKCLEYLLRNDANPG-IRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTL------QDKSKNTALHLACGKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVL 799          

HSP 5 Score: 77.7962 bits (190), Expect = 9.391e-14
Identity = 93/370 (25.14%), Postives = 161/370 (43.51%), Query Frame = 2
Query: 2087 GEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLA---VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTM---PLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G V +  D++G T LH + +   EL    L  +     K     +  LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  +     D  G  PLHYA   C Y     QC   +  L+     +   D    TPL  A   +   + +E LL+N AN   RD Q   +VHY            + SE  L++  + +   +  + D   T    ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K  D  +   P+H AA  G+ E   +L+        V+ ++ +GQT L L+ +       + L++K + ++
Sbjct:  175 GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK----KDKFGRSPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRAT----ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVK--DYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVD 526          

HSP 6 Score: 77.411 bits (189), Expect = 1.113e-13
Identity = 60/197 (30.46%), Postives = 95/197 (48.22%), Query Frame = 2
Query: 2495 MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEK--GAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            ++LLL    +I   D+  R  +  A  + H+E V+ L+ +GA    +D ++   +H   S G + +   L      D N  +  G TP+  A  N  + +V  LI+  A ++  ++ G T  H AA    GA  CLELL+  G D   K  DG  PLH  A  G    ++ ++ + + I+   +KN  G T LH+AA
Sbjct:    2 VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGAL-CLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVID-CEDKN--GNTPLHIAA 193          

HSP 7 Score: 72.4034 bits (176), Expect = 3.537e-12
Identity = 83/335 (24.78%), Postives = 149/335 (44.48%), Query Frame = 2
Query: 2108 DQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            D+  +  +H++  + + E+ +L++    E+  K D+ + T LH    S  I  +  LL    ++N P+  G T L++A  YN    +  +N+ I D    +   +  G  PLH+A        ++C     +ELL+    D+  + +  +TPL +          +T++++GA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:   16 DKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCK-DKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVAC-YNGQDVV--VNELI-DCGANVNQKNEKGFTPLHFAAA--STHGALC-----LELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL-ITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAATSDTDGKCL 334          

HSP 8 Score: 71.2478 bits (173), Expect = 9.554e-12
Identity = 89/350 (25.43%), Postives = 142/350 (40.57%), Query Frame = 2
Query: 2156 LFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNH-VEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPD 3202
            + +L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +  P+  GN PLH A   C   + V      +  L++   ++  ++    TPL  A    H    +E L+ NGA+   +       +H     G     +Q  +      +  D NG TP+  A    +E ++  LI   A       +G    H AA  G   C   LLS G D  +    G   LH AA  G  E   +LLNT +   + N+K+  G++ LH AA   +    F L+   + +N+L     D    T    A T D
Sbjct:    1 MVKLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVK----YLLDLGVDMNEPNAYGNTPLHVA---CYNGQDV-----VVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFS-RSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGA---DFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDL-----DERGCTPLHYAATSD 328          

HSP 9 Score: 65.855 bits (159), Expect = 3.808e-10
Identity = 79/328 (24.09%), Postives = 138/328 (42.07%), Query Frame = 2
Query:  425 LRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            ++ LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +  K+  G + LH+A ++ +  +   LL     D+     +  T L     +      + +++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++    +   +F       G+T LH +    NLE   +LL  GAD N   +   G+S      AN N   L  +  +G S +DL
Sbjct:    2 VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDF-------GRTCLHAAAAGGNLECLNLLLNTGADFNKKDKF--GRSPLHYAAANCNYQCLFALVGSGASVNDL 313          

HSP 10 Score: 65.855 bits (159), Expect = 3.906e-10
Identity = 86/361 (23.82%), Postives = 154/361 (42.66%), Query Frame = 2
Query:  227 VKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNI 1300
            VK LL    ++ +  D  D+  +H+     +   V+L++S   ++    +K  YT LH A+     + ++YLL    D+N+ N    + L +A        V  L +  A VN  +  G +P+H+AA         +    + +L+ +GAD++      ++PL         ++ + +I+ GA I  +D +G + LH A   G+  +I  L+     D      +    L  A      D    LL  G +++  D   R   H A+  G+L+ L +L     +  K +     PLH A+   + + +  L+ +          +N  +  G T LH +   D    C + LL+N A+P I
Sbjct:    2 VKLLLSRGANI-NAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEV-TCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAA------STHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITS-GADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGAS-------VNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGI 346          

HSP 11 Score: 63.5438 bits (153), Expect = 2.097e-9
Identity = 79/299 (26.42%), Postives = 125/299 (41.81%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKE---LFELILKKTPELVNK--FDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT-RDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            G+ E V + +  G +   +RD  G+T +H S        L  L+   T    N    D    T LH    +     + LLL+ +      DGN  + L+ AVI +N  A E + D +      +   D+ G  PLH A     +   V +C   ++LLL  N  +   D   +TPL++A        VE L+ + +  LT +D     ++H  C +G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  543 GHEECVDALLQHGAKC-LLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKI-DGNAFSPLHCAVINDNEGAAEMLIDSL--GASIVNATDSKGRTPLHAA----AFTDHV-EC---LQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHET--SALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 827          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 118.242 bits (295), Expect = 3.194e-26
Identity = 104/358 (29.05%), Postives = 166/358 (46.37%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNN-----LAALECMNDYI--TDKTRFIQIPDNSGNY-PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE-NVNEKNNSGQTALHLAAVRNDCPMCFLLISKD 3124
            +D+ G++ LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ +  Y +     L A E   D +  T  T  +   DN     PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D +     +H   + G+ E    L    N +P    ++ D NG TP+  +V N +   V  L+   A +D  D++GRT  H+ A  G  +C++ LL +G     +   G  P+H +A  G+  +   LL + ++++ N    +N G TALH A          LL+ +D
Sbjct:  434 KDKFGRSPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLL--IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQD 779          

HSP 2 Score: 91.2781 bits (225), Expect = 6.464e-18
Identity = 97/356 (27.25%), Postives = 162/356 (45.51%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN----NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNG----ANFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE-LNAKL-DIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            ++R+ SG+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    NA V+  DGNG+T L L+V+  +    +C+   + +K   +   D  G   LH        + +V   +  ++ LL+       RD   RTP+ L+    H+  +  LL++     AN    D     ++H+ C  G+   +E+  +  VF+  D N       +P+  AV N NE   + LI+ L A + +  D  GRT  H AA     +CL+LLLS      S    G  PL  AA  G     E+L+++ SA  ++  ++ S  TALHLA  +       L++ K
Sbjct:  577 DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNA-VDIQDGNGQTPLMLSVLNGHT---DCVYSLL-NKGANVDAKDKWGRTALH--------RGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNA-----FSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASA--DLTLQDKSKNTALHLACGKGHETSALLILEK 912          

HSP 3 Score: 89.7373 bits (221), Expect = 2.140e-17
Identity = 85/325 (26.15%), Postives = 138/325 (42.46%), Query Frame = 2
Query: 2165 LILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF-LLISKDSKIN 3136
            L L+  P LV      +   +  +I  KE            +VNF D   RT L+ A    +   +E +   I    R +   D+    PLH A+  C  +         +++LL+ + D+  RD+  +TPL +A     V+  E+L+   +N    D     ++H+    G+ E+  +L +    + N  D      I +A    + ++VK L+   A++   D+   T  H AA  G    ++ LL  GVD       G  PLH A Y G   +   L++  +   NVN+KN  G T LH AA      +C  LL+   + +N
Sbjct:    4 LKLRDQPSLVQAIFNGDPDEVRALIFKKE------------DVNFQDNEKRTPLHAAAYLGDAEIIELL---ILSGAR-VNAKDSKWLTPLHRAVASCSEEA--------VQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMV-KLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGA---NVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN 300          

HSP 4 Score: 89.3521 bits (220), Expect = 2.980e-17
Identity = 88/338 (26.04%), Postives = 154/338 (45.56%), Query Frame = 2
Query:  416 PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNM-EP---------------KEKILNF-------INHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            P  +R L+ K  D+N ++N+ R+ L  A    + E ++LL  + A VN  D   ++P+H A             E + ILLKH AD++  D   ++PL  A  +  +   + L+   + +   D +G + LH+A  +G+ E+                                  V+LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   +V++L+    +M EP               ++ ++N        +N +N  G T LH +    +  +C ++L+ NGAD N  ++  +GK+   MTAL
Sbjct:   21 PDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVA-------SCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEM----------------------------------VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN--MKSKDGKTPLHMTAL 315          

HSP 5 Score: 88.1965 bits (217), Expect = 5.307e-17
Identity = 90/368 (24.46%), Postives = 149/368 (40.49%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAX--------------------------XXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIP 1303
            T LH A+ +     +  L+     +N +++   + L  AV   + EAV++L +++A+VN  D N  +P+H AA  KA                                  E++ +LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +++ LL D   D+   ++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q + Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G D + P
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLL-DLGVDMNEPNAYGNTPLHVAC-YNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTP 401          

HSP 6 Score: 85.1149 bits (209), Expect = 4.660e-16
Identity = 95/390 (24.36%), Postives = 160/390 (41.03%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI-----EICKY--------------KKSVCQCKTYM------ELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPN--GLTPIFYAVSN-----CNEKIV-----------------------------KRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
             +D   +T LH +  L + E+ EL++      VN  D   LT LH  + S   E + +LLK++A+VN  D N +T L++A     +   E +   +++    + + D +G   LH+A      E+ K                +       YM      +LL+    ++ C+D+ S TPL  A +   +  V+ LL  G +    +      +H  C  G   + N+L    +   NV   N  G TP+ +A ++     C E +V                             + +I+  A +D  D+ G T  H AA  G    +  L++ G D   +   G  PLH AA  G+ +    LL   S+  +++  ++ G+T LH AA 
Sbjct:   36 FQDNEKRTPLHAAAYLGDAEIIELLILSGAR-VNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSN----VNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELI---DCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLL---SSGFDIDTPDDFGRTCLHAAAA 414          

HSP 7 Score: 80.8777 bits (198), Expect = 1.013e-14
Identity = 109/483 (22.57%), Postives = 194/483 (40.17%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHY--CFKYESCVELILSVAP-----------QLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITD-VNGVSPMHYAA-------------------KVKAXXXXXXXXXXXXXXXKH----------GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD---YKFDLETTDSNNCTALMYACSYNNVDVVELLLER----------------------------------GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A  + + K ++ LL N  + G +RD      +HY   + +  C++LI S  P            L D+  +   + LHLA+      +L  L+    D++ RN+  R+ L LA    + E V +L    A + + D V   +P+H AA                    V           ++++L  H          GA++D  D + R+ L     + +   +  L++ GA    +DS G + +H + + G++ ++  LL        +    D++  TAL +AC   +   VELLLE+                                   S VNA DSK R   H A+    ++ LQ+L   N  +   ++    PL  A+  G    VE L+++      +      ++ +  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  479 ATSDTDGKCLEYLLRNDANPG-IRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTL------QDKSKNTALHLACGKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVL 953          

HSP 8 Score: 80.1073 bits (196), Expect = 1.588e-14
Identity = 103/411 (25.06%), Postives = 176/411 (42.82%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQL--LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    + + V+ LL++  DV + RD   +T LH     K   C E   S+ P L  ++  ++ G T LH A+       ++ LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +  K+  G + LH+A ++ +  +   LL     D+     +  T L     +      + +++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++         F I+  +  G+T LH +    NLE   +LL  GAD N   +   G+S      AN N   L  +  +G S +DL
Sbjct:   78 LHRAVASCSEEAVQILLKHSADV-NARDKNWQTPLHIAAANKAVKCAE---SLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSS--------GFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKF--GRSPLHYAAANCNYQCLFALVGSGASVNDL 467          

HSP 9 Score: 78.5666 bits (192), Expect = 4.743e-14
Identity = 83/363 (22.87%), Postives = 149/363 (41.05%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA--------------------------IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+ +L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +  P+  GN PLH A                               +  +       +ELL+    D+  + +  +TPL +          +T++++GA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:  135 VSDRAGRTALHHAAFSGHGEMVKLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVK----YLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL-ITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAATSDTDGKCL 488          

HSP 10 Score: 77.7962 bits (190), Expect = 9.919e-14
Identity = 93/370 (25.14%), Postives = 161/370 (43.51%), Query Frame = 2
Query: 2087 GEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLA---VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTM---PLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G V +  D++G T LH + +   EL    L  +     K     +  LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  +     D  G  PLHYA   C Y     QC   +  L+     +   D    TPL  A   +   + +E LL+N AN   RD Q   +VHY            + SE  L++  + +   +  + D   T    ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K  D  +   P+H AA  G+ E   +L+        V+ ++ +GQT L L+ +       + L++K + ++
Sbjct:  329 GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK----KDKFGRSPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRAT----ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVK--DYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVD 680          

HSP 11 Score: 63.5438 bits (153), Expect = 1.972e-9
Identity = 79/299 (26.42%), Postives = 125/299 (41.81%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKE---LFELILKKTPELVNK--FDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT-RDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            G+ E V + +  G +   +RD  G+T +H S        L  L+   T    N    D    T LH    +     + LLL+ +      DGN  + L+ AVI +N  A E + D +      +   D+ G  PLH A     +   V +C   ++LLL  N  +   D   +TPL++A        VE L+ + +  LT +D     ++H  C +G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  697 GHEECVDALLQHGAKC-LLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKI-DGNAFSPLHCAVINDNEGAAEMLIDSL--GASIVNATDSKGRTPLHAA----AFTDHV-EC---LQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHET--SALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 981          

HSP 12 Score: 60.8474 bits (146), Expect = 1.480e-8
Identity = 90/386 (23.32%), Postives = 163/386 (42.23%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL----DDYK----------------------------FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLH-EASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTV 1243
            L  A   G+ + VK LL    ++ +  D  D+  +H+     +   V+L++S   ++    +K  YT LH A+     + ++YLL    D+N+ N    + L +A        V  L +  A VN  +  G +P+H+AA         +    + +L+ +GAD++      ++PL         ++ + +I+ GA I  +D +G + LH A   G+  +I  L+    D  K                            FD++T D    T L  A +  N++ + LLL  G++ N +D   R+  H+A+   + + L  L     ++  L+     PLH  A+     + +E+L+ N +    I      R+  G  A+H S  
Sbjct:  144 LHHAAFSGHGEMVKLLLSRGANI-NAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEV-TCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAA------STHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRN-DANPGI------RDKQGYNAVHYSAA 514          

HSP 13 Score: 60.8474 bits (146), Expect = 1.480e-8
Identity = 81/359 (22.56%), Postives = 160/359 (44.57%), Query Frame = 2
Query:  269 RDLTDKTLLHYCFK---YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTS-LRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNG------------VSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSS-GLSILHYATSNGNLEIIQMLLDDYKFD--LETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQ 1279
            +D   ++ LHY      Y+ C+  ++     + D  E+ G T LH A+        L YLL  + +   R+    +++  +  Y +   ++L+        + + +G            +SP+H AA            + + +L++   D+D  +   R+PL  A    ++  +  LI +GA I  KD     + +H A +NG+ E +++L+ + +    ++  D N  T LM +    + D V  LL +G+NV+A+D   R A H  +  G  + +  L Q+       ++    P+H ++  GH  ++  L+   T+++    +++  NH    G TALH +    +    ++LL+
Sbjct:  434 KDKFGRSPLHYAAANCNYQ-CLFALVGSGASVNDLDER-GCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAA-------YHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVD--NH----GYTALHWACYNGHETCVELLLE 777          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 118.242 bits (295), Expect = 4.094e-26
Identity = 101/342 (29.53%), Postives = 161/342 (47.08%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNN-----LAALECMNDYI--TDKTRFIQIPDNSGNY-PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE-NVNEKNNSGQTALHLA 3076
            +D+ G++ LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ +  Y +     L A E   D +  T  T  +   DN     PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D +     +H   + G+ E    L    N +P    ++ D NG TP+  +V N +   V  L+   A +D  D++GRT  H+ A  G  +C++ LL +G     +   G  P+H +A  G+  +   LL + ++++ N    +N G TALH A
Sbjct:  464 KDKFGRSPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLL--IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWA 793          

HSP 2 Score: 90.8929 bits (224), Expect = 7.919e-18
Identity = 97/356 (27.25%), Postives = 162/356 (45.51%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN----NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNG----ANFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE-LNAKL-DIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            ++R+ SG+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    NA V+  DGNG+T L L+V+  +    +C+   + +K   +   D  G   LH        + +V   +  ++ LL+       RD   RTP+ L+    H+  +  LL++     AN    D     ++H+ C  G+   +E+  +  VF+  D N       +P+  AV N NE   + LI+ L A + +  D  GRT  H AA     +CL+LLLS      S    G  PL  AA  G     E+L+++ SA  ++  ++ S  TALHLA  +       L++ K
Sbjct:  607 DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNA-VDIQDGNGQTPLMLSVLNGHT---DCVYSLL-NKGANVDAKDKWGRTALH--------RGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNA-----FSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASA--DLTLQDKSKNTALHLACGKGHETSALLILEK 942          

HSP 3 Score: 89.7373 bits (221), Expect = 2.249e-17
Identity = 81/308 (26.30%), Postives = 135/308 (43.83%), Query Frame = 2
Query: 2216 LTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF-LLISKDSKIN 3136
            L  L   I + + + +  L+    +VNF D   RT L+ A    +   +E +   I    R +   D+    PLH A+  C  +         +++LL+ + D+  RD+  +TPL +A     V+  E+L+   +N    D     ++H+    G+ E+  +L +    + N  D      I +A    + ++VK L+   A++   D+   T  H AA  G    ++ LL  GVD       G  PLH A Y G   +   L++  +   NVN+KN  G T LH AA      +C  LL+   + +N
Sbjct:   39 LPSLVQAIFNGDPDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELL---ILSGAR-VNAKDSKWLTPLHRAVASCSEEA--------VQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMV-KLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGA---NVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN 330          

HSP 4 Score: 89.3521 bits (220), Expect = 2.852e-17
Identity = 88/338 (26.04%), Postives = 154/338 (45.56%), Query Frame = 2
Query:  416 PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNM-EP---------------KEKILNF-------INHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            P  +R L+ K  D+N ++N+ R+ L  A    + E ++LL  + A VN  D   ++P+H A             E + ILLKH AD++  D   ++PL  A  +  +   + L+   + +   D +G + LH+A  +G+ E+                                  V+LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   +V++L+    +M EP               ++ ++N        +N +N  G T LH +    +  +C ++L+ NGAD N  ++  +GK+   MTAL
Sbjct:   51 PDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVA-------SCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEM----------------------------------VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN--MKSKDGKTPLHMTAL 345          

HSP 5 Score: 88.5817 bits (218), Expect = 4.665e-17
Identity = 90/368 (24.46%), Postives = 149/368 (40.49%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAX--------------------------XXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIP 1303
            T LH A+ +     +  L+     +N +++   + L  AV   + EAV++L +++A+VN  D N  +P+H AA  KA                                  E++ +LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +++ LL D   D+   ++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q + Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G D + P
Sbjct:   73 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLL-DLGVDMNEPNAYGNTPLHVAC-YNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTP 431          

HSP 6 Score: 85.1149 bits (209), Expect = 5.146e-16
Identity = 95/390 (24.36%), Postives = 160/390 (41.03%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI-----EICKY--------------KKSVCQCKTYM------ELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPN--GLTPIFYAVSN-----CNEKIV-----------------------------KRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
             +D   +T LH +  L + E+ EL++      VN  D   LT LH  + S   E + +LLK++A+VN  D N +T L++A     +   E +   +++    + + D +G   LH+A      E+ K                +       YM      +LL+    ++ C+D+ S TPL  A +   +  V+ LL  G +    +      +H  C  G   + N+L    +   NV   N  G TP+ +A ++     C E +V                             + +I+  A +D  D+ G T  H AA  G    +  L++ G D   +   G  PLH AA  G+ +    LL   S+  +++  ++ G+T LH AA 
Sbjct:   66 FQDNEKRTPLHAAAYLGDAEIIELLILSGAR-VNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSN----VNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELI---DCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLL---SSGFDIDTPDDFGRTCLHAAAA 444          

HSP 7 Score: 81.2629 bits (199), Expect = 7.829e-15
Identity = 109/483 (22.57%), Postives = 194/483 (40.17%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHY--CFKYESCVELILSVAP-----------QLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITD-VNGVSPMHYAA-------------------KVKAXXXXXXXXXXXXXXXKH----------GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD---YKFDLETTDSNNCTALMYACSYNNVDVVELLLER----------------------------------GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A  + + K ++ LL N  + G +RD      +HY   + +  C++LI S  P            L D+  +   + LHLA+      +L  L+    D++ RN+  R+ L LA    + E V +L    A + + D V   +P+H AA                    V           ++++L  H          GA++D  D + R+ L     + +   +  L++ GA    +DS G + +H + + G++ ++  LL        +    D++  TAL +AC   +   VELLLE+                                   S VNA DSK R   H A+    ++ LQ+L   N  +   ++    PL  A+  G    VE L+++      +      ++ +  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  509 ATSDTDGKCLEYLLRNDANPG-IRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTL------QDKSKNTALHLACGKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVL 983          

HSP 8 Score: 80.4925 bits (197), Expect = 1.302e-14
Identity = 103/411 (25.06%), Postives = 176/411 (42.82%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQL--LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    + + V+ LL++  DV + RD   +T LH     K   C E   S+ P L  ++  ++ G T LH A+       ++ LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +  K+  G + LH+A ++ +  +   LL     D+     +  T L     +      + +++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++         F I+  +  G+T LH +    NLE   +LL  GAD N   +   G+S      AN N   L  +  +G S +DL
Sbjct:  108 LHRAVASCSEEAVQILLKHSADV-NARDKNWQTPLHIAAANKAVKCAE---SLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSS--------GFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKF--GRSPLHYAAANCNYQCLFALVGSGASVNDL 497          

HSP 9 Score: 78.5666 bits (192), Expect = 5.888e-14
Identity = 83/363 (22.87%), Postives = 149/363 (41.05%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA--------------------------IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+ +L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +  P+  GN PLH A                               +  +       +ELL+    D+  + +  +TPL +          +T++++GA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:  165 VSDRAGRTALHHAAFSGHGEMVKLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVK----YLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL-ITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAATSDTDGKCL 518          

HSP 10 Score: 77.411 bits (189), Expect = 1.150e-13
Identity = 93/370 (25.14%), Postives = 161/370 (43.51%), Query Frame = 2
Query: 2087 GEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLA---VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTM---PLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G V +  D++G T LH + +   EL    L  +     K     +  LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  +     D  G  PLHYA   C Y     QC   +  L+     +   D    TPL  A   +   + +E LL+N AN   RD Q   +VHY            + SE  L++  + +   +  + D   T    ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K  D  +   P+H AA  G+ E   +L+        V+ ++ +GQT L L+ +       + L++K + ++
Sbjct:  359 GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK----KDKFGRSPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRAT----ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVK--DYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVD 710          

HSP 11 Score: 63.5438 bits (153), Expect = 1.908e-9
Identity = 79/299 (26.42%), Postives = 125/299 (41.81%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKE---LFELILKKTPELVNK--FDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT-RDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            G+ E V + +  G +   +RD  G+T +H S        L  L+   T    N    D    T LH    +     + LLL+ +      DGN  + L+ AVI +N  A E + D +      +   D+ G  PLH A     +   V +C   ++LLL  N  +   D   +TPL++A        VE L+ + +  LT +D     ++H  C +G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  727 GHEECVDALLQHGAKC-LLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKI-DGNAFSPLHCAVINDNEGAAEMLIDSL--GASIVNATDSKGRTPLHAA----AFTDHV-EC---LQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHET--SALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 1011          

HSP 12 Score: 60.8474 bits (146), Expect = 1.395e-8
Identity = 90/386 (23.32%), Postives = 163/386 (42.23%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL----DDYK----------------------------FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLH-EASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTV 1243
            L  A   G+ + VK LL    ++ +  D  D+  +H+     +   V+L++S   ++    +K  YT LH A+     + ++YLL    D+N+ N    + L +A        V  L +  A VN  +  G +P+H+AA         +    + +L+ +GAD++      ++PL         ++ + +I+ GA I  +D +G + LH A   G+  +I  L+    D  K                            FD++T D    T L  A +  N++ + LLL  G++ N +D   R+  H+A+   + + L  L     ++  L+     PLH  A+     + +E+L+ N +    I      R+  G  A+H S  
Sbjct:  174 LHHAAFSGHGEMVKLLLSRGANI-NAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEV-TCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAA------STHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRN-DANPGI------RDKQGYNAVHYSAA 544          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ehmt2 (euchromatic histone lysine N-methyltransferase 2 [Source:MGI Symbol;Acc:MGI:2148922])

HSP 1 Score: 112.849 bits (281), Expect = 1.621e-24
Identity = 62/198 (31.31%), Postives = 110/198 (55.56%), Query Frame = 2
Query:  665 GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKG-HNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNL 1255
            GA+I+ +D  +R+PLM AV +N+L   +++++ G C+YSK+  G + LH+A   GNLE++ +LL   + D+   DS   T +++A  + ++DV+ +LL RG++V   D++     H+AS  G     +VL     +L  +N   + PLH A+ +  H+ ++ FL     P+         RN  G TA  L+  + ++
Sbjct:  670 GANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPE--------LRNKEGDTAWDLTPERSDV 859          

HSP 2 Score: 78.9518 bits (193), Expect = 4.447e-14
Identity = 63/225 (28.00%), Postives = 100/225 (44.44%), Query Frame = 2
Query: 2417 NSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRND 3091
             S   PLH A +    K SV  C     +LL+   +I   D+  RTPL+ A+  NH+E    +++ G    +++      +H+    GNLE+ + L      D N  D  G TPI +A  + +  +++ L+   A + + D       H A+  G+    E+LL+   D  +  + G  PLH AA   Y +   + L   S   N   +N  G TA  L   R+D
Sbjct:  645 QSKRTPLHAAAQ----KGSVEIC----HVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVLLFL---SRGANPELRNKEGDTAWDLTPERSD 858          

HSP 3 Score: 58.151 bits (139), Expect = 1.040e-7
Identity = 40/163 (24.54%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  806 LHYATSNGNLE-IIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            L+ +   G L+ +I MLLD+   + ++   +  T L  A    +V++  +LL+ G+N+NA D ++R     A     L+  + + Q    ++    D +  LH A+  G+ E+V  L++  +        +N ++S G T +  +    ++++ ++LL  GAD
Sbjct:  616 LYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVD------VNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGAD 772          

HSP 4 Score: 54.6842 bits (130), Expect = 1.198e-6
Identity = 48/202 (23.76%), Postives = 92/202 (45.54%), Query Frame = 2
Query:  368 EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSN 973
            +++  T LH A+          LL    +IN  +   R+ L+ AV+ ++ E  + + +    V   + +G + +H+AAK+         L           D++  D    +P++WA    ++  ++ L+ +GA +   D+     LH+A+  G+  I ++LL + + DL   + +  T L  A   +  D V L L RG+N
Sbjct:  644 QQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQ------VDVNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLL-NAQCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGAN 838          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ehmt2 (euchromatic histone lysine N-methyltransferase 2 [Source:MGI Symbol;Acc:MGI:2148922])

HSP 1 Score: 112.849 bits (281), Expect = 1.726e-24
Identity = 62/198 (31.31%), Postives = 110/198 (55.56%), Query Frame = 2
Query:  665 GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKG-HNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNL 1255
            GA+I+ +D  +R+PLM AV +N+L   +++++ G C+YSK+  G + LH+A   GNLE++ +LL   + D+   DS   T +++A  + ++DV+ +LL RG++V   D++     H+AS  G     +VL     +L  +N   + PLH A+ +  H+ ++ FL     P+         RN  G TA  L+  + ++
Sbjct:  704 GANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPE--------LRNKEGDTAWDLTPERSDV 893          

HSP 2 Score: 78.9518 bits (193), Expect = 4.574e-14
Identity = 62/220 (28.18%), Postives = 99/220 (45.00%), Query Frame = 2
Query: 2432 PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRND 3091
            PLH A +    K SV  C     +LL+   +I   D+  RTPL+ A+  NH+E    +++ G    +++      +H+    GNLE+ + L      D N  D  G TPI +A  + +  +++ L+   A + + D       H A+  G+    E+LL+   D  +  + G  PLH AA   Y +   + L   S   N   +N  G TA  L   R+D
Sbjct:  684 PLHAAAQ----KGSVEIC----HVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVLLFL---SRGANPELRNKEGDTAWDLTPERSD 892          

HSP 3 Score: 57.7658 bits (138), Expect = 1.179e-7
Identity = 40/163 (24.54%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  806 LHYATSNGNLE-IIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            L+ +   G L+ +I MLLD+   + ++   +  T L  A    +V++  +LL+ G+N+NA D ++R     A     L+  + + Q    ++    D +  LH A+  G+ E+V  L++  +        +N ++S G T +  +    ++++ ++LL  GAD
Sbjct:  650 LYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVD------VNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGAD 806          

HSP 4 Score: 54.299 bits (129), Expect = 1.416e-6
Identity = 48/202 (23.76%), Postives = 92/202 (45.54%), Query Frame = 2
Query:  368 EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSN 973
            +++  T LH A+          LL    +IN  +   R+ L+ AV+ ++ E  + + +    V   + +G + +H+AAK+         L           D++  D    +P++WA    ++  ++ L+ +GA +   D+     LH+A+  G+  I ++LL + + DL   + +  T L  A   +  D V L L RG+N
Sbjct:  678 QQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQ------VDVNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLL-NAQCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGAN 872          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9XZC0|LCTA_LATTR (Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus OX=6925 PE=2 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 4.325e-28
Identity = 119/426 (27.93%), Postives = 203/426 (47.65%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDK-TLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNP-DINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEV--NITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKR-SPLMWAVCSNNLTKMKHLIE-KGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKF-DLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---------TNMEPK-----------EKILNF-------INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
             Y  L  A +  NN  VK LLE   DV +VR   ++ T LH   +  +   V+ ++      ++  E+ G+T LHL S+     + R L+++ P  IN ++N   + L LAV+ +N  A K+L ++N +V  N  D NG++P+HYA+ +       N   +     + G D++     K  +PL  A+        + L++ +   I ++    ++ LH A + GN +I++ +L+     D ET  +N  TAL  A    N +  + L+ +G+N+NA+ +      HFA+  G     Q+L     N+   N  +  P+HEA   GH  IV+ LI          NM  +           + + N+       +N +N++G T LHL ++   +E+ + L+QNGAD     R+ N +  +  DLA
Sbjct:  529 GYTPLHIASERKNNDFVKFLLEKGADV-NVRTFANELTPLHLAARQDFTIIVKTLMEKRGIDVNAKERAGFTPLHL-SITSNSRAARTLINETPAGINIKSNSGLTPLHLAVLQNNLSAAKVLVKSNKKVKLNEMDNNGMTPLHYASML------GNLEFVKYFTSEQGIDVNAKTKVKNWTPLHLAILFKKFDVAQSLLQVRNIDISTRADQAITPLHLAAATGNSQIVKTILNSGAVVDQET--ANGFTALHLAIMNPNTETPQFLIAKGANINAKTNDGSTPLHFAAALGKTNIFQLLMDKGANIKAENLINQMPIHEAVVNGHLAIVKMLIEQDSSLMNAKNMRDEYPFYLAAEKRYKDVFNYLESKGADVNEKNNDGNTLLHLFSINGEVEVVQFLIQNGAD----FRLRNKERKSFFDLA 940          

HSP 2 Score: 96.2857 bits (238), Expect = 1.706e-18
Identity = 103/377 (27.32%), Postives = 158/377 (41.91%), Query Frame = 2
Query: 2123 TLLHYSLKNKELFELILKKTPEL----VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA-----IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSR-TPLLLAINVNHVEAVETLLK-NGANFLTRDIQNLCSVHYVCSEGNLEI----FNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIEN-------------------------------VNEKNNSGQTALHLAAVRNDCPMCFLLI 3115
            T LH  L  ++ F +I+K   E     VN  +    T LH+ I S       L+ +  A +N    +G T L+LAV+ NNL+A + +    ++K   +   DN+G  PLHYA     +E  KY  S            E   D+  + +V   TPL LAI     +  ++LL+    +  TR  Q +  +H   + GN +I     N  AV +         NG T +  A+ N N +  + LI   A ++     G T  H AA  G     +LL+  G +  ++     MP+HEA   G+  I ++L+   S++ N                               VNEKNN G T LHL ++  +  +   LI
Sbjct:  565 TPLH--LAARQDFTIIVKTLMEKRGIDVNAKERAGFTPLHLSITSNSRAARTLINETPAGINIKSNSGLTPLHLAVLQNNLSAAKVLVK--SNKKVKLNEMDNNGMTPLHYASMLGNLEFVKYFTS------------EQGIDVNAKTKVKNWTPLHLAILFKKFDVAQSLLQVRNIDISTRADQAITPLHLAAATGNSQIVKTILNSGAVVDQ-----ETANGFTALHLAIMNPNTETPQFLIAKGANINAKTNDGSTPLHFAAALGKTNIFQLLMDKGANIKAENLINQMPIHEAVVNGHLAIVKMLIEQDSSLMNAKNMRDEYPFYLAAEKRYKDVFNYLESKGADVNEKNNDGNTLLHLFSINGEVEVVQFLI 920          

HSP 3 Score: 94.7449 bits (234), Expect = 4.749e-18
Identity = 98/363 (27.00%), Postives = 169/363 (46.56%), Query Frame = 2
Query:  230 KKLLENCTDVGDVRDLTDKTL-LHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNI-TDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-DDYKFDLETTDSNNCTALMYACSYNNVDVVELLL-ERGSNVNAEDSKRRNAT--HFASGKGDLKNLQVLHQY-NVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            +KL+++   VG   ++  K++        +    L+L+    LL+  +KNGYT LH+AS                   ++NND                VK L E  A+VN+ T  N ++P+H AA+       +  + +  ++ K G D++  +    +PL  ++ SN+      + E  A I  K +SGL+ LH A    NL   ++L+  + K  L   D+N  T L YA    N++ V+    E+G +VNA+ +K +N T  H A         Q L Q  N+++    + +  PLH A+  G+++IV+ ++ +          ++   +NG TALHL+ +  N E  + L+  GA+ N
Sbjct:  479 RKLIDSGAQVGASFEMGRKSIHASATAGNDDVARLLLAKNNGLLNVPDKNGYTPLHIAS------------------ERKNND---------------FVKFLLEKGADVNVRTFANELTPLHLAAR------QDFTIIVKTLMEKRGIDVNAKERAGFTPLHLSITSNSRAARTLINETPAGINIKSNSGLTPLHLAVLQNNLSAAKVLVKSNKKVKLNEMDNNGMTPLHYASMLGNLEFVKYFTSEQGIDVNAK-TKVKNWTPLHLAILFKKFDVAQSLLQVRNIDISTRADQAITPLHLAAATGNSQIVKTILNSGA-------VVDQETANGFTALHLAIMNPNTETPQFLIAKGANIN 794          

HSP 4 Score: 84.7297 bits (208), Expect = 5.836e-15
Identity = 115/467 (24.63%), Postives = 200/467 (42.83%), Query Frame = 2
Query: 1976 INSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSK-EIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIEC--RDRVSRTPLLLAINVNHVEAVETLLKNGA---NFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATT---PDCKNTLKTFGGRSAKKVINCSNSELDYSTQYNAEVELVPQV--NGYDI 3337
            I+S  Q+    E  +  + AS   GN ++    +     +  + D++G T LH +   KN +  + +L+K  ++  +     LT LH+       I    L+ K   +VN  +  G T L+L++  N+ AA   +N+        I I  NSG  PLH A+     + ++   K    +L++ N  ++    D    TPL  A  + ++E V+          N  T+ ++N   +H        ++   L    N D +      +TP+  A +  N +IVK ++   A +D     G T  H A      +  + L++ G +  +K +DG+ PLH AA  G   I ++L++  +   N+  +N   Q  +H A V     +  +LI +DS     L N  +  +   + LA      D  N L++ G    +K  N   + L +    N EVE+V  +  NG D 
Sbjct:  482 IDSGAQVGASFEMGRKSIHASATAGNDDVARLLLAKNNGLLNVPDKNGYTPLHIASERKNNDFVKFLLEKGADVNVRTFANELTPLHLAARQDFTIIVKTLMEKRGIDVNAKERAGFTPLHLSITSNSRAARTLINETPAG----INIKSNSGLTPLHLAV----LQNNLSAAK----VLVKSNKKVKLNEMDNNGMTPLHYASMLGNLEFVKYFTSEQGIDVNAKTK-VKNWTPLHLAILFKKFDVAQSLLQVRNIDISTRADQAITPLHLAAATGNSQIVKTILNSGAVVDQETANGFTALHLAIMNPNTETPQFLIAKGANINAKTNDGSTPLHFAAALGKTNIFQLLMDKGA---NIKAENLINQMPIHEAVVNGHLAIVKMLIEQDSS----LMNAKNMRDEYPFYLAAEKRYKDVFNYLESKGADVNEK--NNDGNTLLHLFSINGEVEVVQFLIQNGADF 926          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O15084|ANR28_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5)

HSP 1 Score: 119.398 bits (298), Expect = 1.083e-25
Identity = 102/342 (29.82%), Postives = 161/342 (47.08%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNN-----LAALECMNDYI--TDKTRFIQIPDNSGNY-PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE-NVNEKNNSGQTALHLA 3076
            +D+ G++ LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ +  Y +     L A E   D +  T  T  +   DN     PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D I     +H   + G+ E    L    N +P    ++ D NG TP+  +V N +   V  L+   A +D  D++GRT  H+ A  G  +C++ LL +G     +   G  P+H +A  G+  +   LL + ++++ N    +N G TALH A
Sbjct:  434 KDKFGRSPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLL--IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWA 763          

HSP 2 Score: 95.5153 bits (236), Expect = 2.585e-18
Identity = 99/356 (27.81%), Postives = 165/356 (46.35%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN----NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGA----NFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE-LNAKL-DIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            ++R+ SG+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    NA V+  DGNG+T L L+V+  +    +C+   + +K   +   D  G   LH        + +V   +  ++ LL+       RD   RTP+ L+    H+  +  LL++ A    N  T D     ++H+ C  G+   +E+  +  VF+      T+ N  +P+  AV N NE   + LI+ L A + +  D  GRT  H AA     +CL+LLLS+     S    G  PL  AA  G     E+L+++ SA   +  ++NS  TALHLA  +       L++ K
Sbjct:  577 DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNA-VDIQDGNGQTPLMLSVLNGHT---DCVYSLL-NKGANVDAKDKWGRTALH--------RGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVFQK-----TEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASA--ELTLQDNSKNTALHLACSKGHETSALLILEK 912          

HSP 3 Score: 92.0485 bits (227), Expect = 2.763e-17
Identity = 100/410 (24.39%), Postives = 172/410 (41.95%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASM-IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGA--------------------------DIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYN-NVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQ-------YNVNLWKLNNDSN-----YPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            SY  L  A   G    VK LL+   D+ +     +  L   C+  +  V   L     +++   + G+T LH A+        L  L+    D+N ++ D ++ L +  ++      + + ++ A ++  D NG +P+H AA+    L     +       K G                           DID  D + R+ L  A    NL  +  L+  GA    KD  G S LHYA +N N + +  L+      +   D   CT L YA + + +   +E LL   +N    D +  NA H+++  G    LQ++            +   + +DS+      PLH A+Y GH++ +E L+      + +L+ ++ RNS+G+T L L+  K ++E   +L+  GA
Sbjct:  206 SYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGS-GASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLV------QSLLD-LDVRNSSGRTPLDLAAFKGHVECVDVLINQGA 607          

HSP 4 Score: 90.5077 bits (223), Expect = 7.399e-17
Identity = 87/338 (25.74%), Postives = 154/338 (45.56%), Query Frame = 2
Query:  416 PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNM-EP---------------KEKILN-------FINHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            P  +R L+ K  D+N ++N+ R+ L  A    + E ++LL  + A VN  D   ++P+H A             E + +LLKH AD++  D   ++PL  A  +  +   + L+   + +   D +G + LH+A  +G+ E+                                  V+LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   +V++L+    +M EP               ++ ++N        +N +N  G T LH +    +  +C ++L+ NGAD N  ++  +GK+   MTAL
Sbjct:   21 PDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVA-------SCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEM----------------------------------VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN--MKSKDGKTPLHMTAL 315          

HSP 5 Score: 88.1965 bits (217), Expect = 4.629e-16
Identity = 90/368 (24.46%), Postives = 149/368 (40.49%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAX--------------------------XXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIP 1303
            T LH A+ +     +  L+     +N +++   + L  AV   + EAV++L +++A+VN  D N  +P+H AA  KA                                  E++ +LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +++ LL D   D+   ++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q + Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G D + P
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLL-DLGVDMNEPNAYGNTPLHVAC-YNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTP 401          

HSP 6 Score: 86.2705 bits (212), Expect = 1.754e-15
Identity = 98/414 (23.67%), Postives = 197/414 (47.58%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC-FK-YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLS-KNPD--INKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACI----YSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLER--GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A   G+++ ++ L+++  D+ DVR+ + +T L    FK +  CV+++++    +L        T +H A+       LR L+    P   ++ ++ + ++ L+L+V+  + + V  L    A V+  D  G + +H  A            E ++ LL+HGA     D   R+P+  +    ++  +  L++  A +     + D+ G + LH+A  NG+   +++LL+   F  + T+ N  + L  A   +N    E+L++    S VNA DSK R   H A+    ++ LQ+L  +N  +  +++    PL  A+  G    VE L+++   +  +      ++++  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  557 AAYHGHHQALEVLVQSLLDL-DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGA-------VTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEVF--QKTEGNAFSPLHCAVINDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTL------QDNSKNTALHLACSKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVL 953          

HSP 7 Score: 83.5741 bits (205), Expect = 1.007e-14
Identity = 93/388 (23.97%), Postives = 159/388 (40.98%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI-----EICKY--------------KKSVCQCKTYM------ELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSN-----CNEKIV-----------------------------KRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
             +D   +T LH +  L + E+ EL++      VN  D   LT LH  + S   E + +LLK++A+VN  D N +T L++A     +   E +   +++    + + D +G   LH+A      E+ K                +       YM      +LL+    ++ C+D+ S TPL  A +   +  V+ LL  G +    +      +H  C  G   + N+L +      N  +  G TP+ +A ++     C E +V                             + +I+  A +D  D+ G T  H AA  G    +  L++ G D   +   G  PLH AA  G+ +    LL   S+  +++  ++ G+T LH AA 
Sbjct:   36 FQDNEKRTPLHAAAYLGDAEIIELLILSGAR-VNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSN----VNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNEL-IDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLL---SSGFDIDTPDDFGRTCLHAAAA 414          

HSP 8 Score: 80.8777 bits (198), Expect = 6.969e-14
Identity = 100/409 (24.45%), Postives = 175/409 (42.79%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    + + V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       ++ LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +  K+  G + LH+A ++ +  +   LL     D+     +  T L     +      + +++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++         F I+  +  G+T LH +    NLE   +LL  GAD N   +   G+S      AN N   L  +  +G S +DL
Sbjct:   78 LHRAVASCSEEAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVKCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSS--------GFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKF--GRSPLHYAAANCNYQCLFALVGSGASVNDL 467          

HSP 9 Score: 78.5666 bits (192), Expect = 3.898e-13
Identity = 83/363 (22.87%), Postives = 149/363 (41.05%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA--------------------------IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+ +L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +  P+  GN PLH A                               +  +       +ELL+    D+  + +  +TPL +          +T++++GA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:  135 VSDRAGRTALHHAAFSGHGEMVKLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVK----YLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL-ITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAATSDTDGKCL 488          

HSP 10 Score: 77.0258 bits (188), Expect = 1.034e-12
Identity = 92/368 (25.00%), Postives = 160/368 (43.48%), Query Frame = 2
Query: 2087 GEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLA---VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHD-GTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G V +  D++G T LH + +   EL    L  +     K     +  LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  +     D  G  PLHYA   C Y     QC   +  L+     +   D    TPL  A   +   + +E LL+N AN   RD Q   +VHY            + SE  L++  + +   +  + D   T    ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K +     P+H AA  G+ E   +L+        V+ ++ +GQT L L+ +       + L++K + ++
Sbjct:  329 GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK----KDKFGRSPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRAT----ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYILKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVD 680          

HSP 11 Score: 60.8474 bits (146), Expect = 9.432e-8
Identity = 78/299 (26.09%), Postives = 126/299 (42.14%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFEL--ILKKTPEL---VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT-RDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            G+ E V + +  G +   +RD  G+T +H S     +  L  +L+    +       D    T LH    +     + LLL+        +GN  + L+ AVI +N  A E + D  T     +   D+ G  PLH A     +   V +C   ++LLL  N  +   D   +TPL++A        VE L+ + +  LT +D     ++H  CS+G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  697 GHEECVDALLQHGAKCL-LRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAVINDNEGAAEMLID--TLGASIVNATDSKGRTPLHAA----AFTDHV-EC---LQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHET--SALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 981          

HSP 12 Score: 55.4546 bits (132), Expect = 3.978e-6
Identity = 81/331 (24.47%), Postives = 143/331 (43.20%), Query Frame = 2
Query:  212 GNNKKVKKLLENCTDVGDVRDLTDKTLLH--YCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINK----RNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSN---VNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYP-LHEASYKGHNEIVEFLITNMEP 1171
            G+   V  LL    +V D +D   +T LH      +E CV+ +L    + L   +  G T +HL++       L  LL     ++      +N   ++L  A    +   V+LL E       T+ N  SP+H A         +NE     ++   GA I +  D   R+PL  A  ++++  ++ L+   A + S DS+G + L  A  NG    ++ML+     +L   D++  TAL  ACS  +     L+LE+ ++   +NA ++  +   H A+  G    +Q L     ++  ++ +   P L  A  K   + +  ++  M P
Sbjct:  664 GHTDCVYSLLNKGANV-DAKDKWGRTALHRGAVTGHEECVDALLQHGAKCL-LRDSRGRTPIHLSAACGHIGVLGALLQSAASMDANPATADNHGYTALHWACYNGHETCVELLLEQEV-FQKTEGNAFSPLHCAV------INDNEGAAEMLIDTLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSHNAQVNSVDSTGKTPLMMAAENGQTNTVEMLVSSASAELTLQDNSKNTALHLACSKGHETSALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILATMMP 985          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q505D1|ANR28_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus OX=10090 GN=Ankrd28 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.234e-25
Identity = 104/358 (29.05%), Postives = 166/358 (46.37%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNN-----LAALECMNDYI--TDKTRFIQIPDNSGNY-PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRD-IQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE-NVNEKNNSGQTALHLAAVRNDCPMCFLLISKD 3124
            +D+ G++ LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ +  Y +     L A E   D +  T  T  +   DN     PLH A     ++         +E+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D +     +H   + G+ E    L    N +P    ++ D NG TP+  +V N +   V  L+   A +D  D++GRT  H+ A  G  +C++ LL +G     +   G  P+H +A  G+  +   LL + ++++ N    +N G TALH A          LL+ +D
Sbjct:  434 KDKFGRSPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQA--------LEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLL--IGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQD 779          

HSP 2 Score: 91.2781 bits (225), Expect = 4.522e-17
Identity = 97/356 (27.25%), Postives = 162/356 (45.51%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN----NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNG----ANFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE-LNAKL-DIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            ++R+ SG+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    NA V+  DGNG+T L L+V+  +    +C+   + +K   +   D  G   LH        + +V   +  ++ LL+       RD   RTP+ L+    H+  +  LL++     AN    D     ++H+ C  G+   +E+  +  VF+  D N       +P+  AV N NE   + LI+ L A + +  D  GRT  H AA     +CL+LLLS      S    G  PL  AA  G     E+L+++ SA  ++  ++ S  TALHLA  +       L++ K
Sbjct:  577 DVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNA-VDIQDGNGQTPLMLSVLNGHT---DCVYSLL-NKGANVDAKDKWGRTALH--------RGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNA-----FSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASA--DLTLQDKSKNTALHLACGKGHETSALLILEK 912          

HSP 3 Score: 89.7373 bits (221), Expect = 1.497e-16
Identity = 85/325 (26.15%), Postives = 138/325 (42.46%), Query Frame = 2
Query: 2165 LILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF-LLISKDSKIN 3136
            L L+  P LV      +   +  +I  KE            +VNF D   RT L+ A    +   +E +   I    R +   D+    PLH A+  C  +         +++LL+ + D+  RD+  +TPL +A     V+  E+L+   +N    D     ++H+    G+ E+  +L +    + N  D      I +A    + ++VK L+   A++   D+   T  H AA  G    ++ LL  GVD       G  PLH A Y G   +   L++  +   NVN+KN  G T LH AA      +C  LL+   + +N
Sbjct:    4 LKLRDQPSLVQAIFNGDPDEVRALIFKKE------------DVNFQDNEKRTPLHAAAYLGDAEIIELL---ILSGAR-VNAKDSKWLTPLHRAVASCSEEA--------VQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMV-KLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGA---NVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN 300          

HSP 4 Score: 89.3521 bits (220), Expect = 2.084e-16
Identity = 88/338 (26.04%), Postives = 154/338 (45.56%), Query Frame = 2
Query:  416 PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNM-EP---------------KEKILNF-------INHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            P  +R L+ K  D+N ++N+ R+ L  A    + E ++LL  + A VN  D   ++P+H A             E + ILLKH AD++  D   ++PL  A  +  +   + L+   + +   D +G + LH+A  +G+ E+                                  V+LLL RG+N+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   +V++L+    +M EP               ++ ++N        +N +N  G T LH +    +  +C ++L+ NGAD N  ++  +GK+   MTAL
Sbjct:   21 PDEVRALIFKKEDVNFQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVA-------SCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEM----------------------------------VKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN--MKSKDGKTPLHMTAL 315          

HSP 5 Score: 88.1965 bits (217), Expect = 3.712e-16
Identity = 90/368 (24.46%), Postives = 149/368 (40.49%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAX--------------------------XXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV-----------------------------------ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIP 1303
            T LH A+ +     +  L+     +N +++   + L  AV   + EAV++L +++A+VN  D N  +P+H AA  KA                                  E++ +LL  GA+I+  D   R  + WA    ++  +K L+  GA +  KD    + LH A S+G + +++ LL D   D+   ++   T L  AC YN  DVV                                   ELL+  G++VN +    +   H  +  G     Q + Q    +   + + N PLH A+  GH  ++  LIT+     K       R  +G   LHL+ +    + C+ LL +G D + P
Sbjct:   43 TPLHAAAYLGDAEIIELLILSGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLL-DLGVDMNEPNAYGNTPLHVAC-YNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTP 401          

HSP 6 Score: 85.1149 bits (209), Expect = 3.259e-15
Identity = 95/390 (24.36%), Postives = 160/390 (41.03%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAI-----EICKY--------------KKSVCQCKTYM------ELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPN--GLTPIFYAVSN-----CNEKIV-----------------------------KRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
             +D   +T LH +  L + E+ EL++      VN  D   LT LH  + S   E + +LLK++A+VN  D N +T L++A     +   E +   +++    + + D +G   LH+A      E+ K                +       YM      +LL+    ++ C+D+ S TPL  A +   +  V+ LL  G +    +      +H  C  G   + N+L    +   NV   N  G TP+ +A ++     C E +V                             + +I+  A +D  D+ G T  H AA  G    +  L++ G D   +   G  PLH AA  G+ +    LL   S+  +++  ++ G+T LH AA 
Sbjct:   36 FQDNEKRTPLHAAAYLGDAEIIELLILSGAR-VNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSN----VNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELI---DCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLL---SSGFDIDTPDDFGRTCLHAAAA 414          

HSP 7 Score: 80.8777 bits (198), Expect = 7.088e-14
Identity = 109/483 (22.57%), Postives = 194/483 (40.17%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHY--CFKYESCVELILSVAP-----------QLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITD-VNGVSPMHYAA-------------------KVKAXXXXXXXXXXXXXXXKH----------GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD---YKFDLETTDSNNCTALMYACSYNNVDVVELLLER----------------------------------GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A  + + K ++ LL N  + G +RD      +HY   + +  C++LI S  P            L D+  +   + LHLA+      +L  L+    D++ RN+  R+ L LA    + E V +L    A + + D V   +P+H AA                    V           ++++L  H          GA++D  D + R+ L     + +   +  L++ GA    +DS G + +H + + G++ ++  LL        +    D++  TAL +AC   +   VELLLE+                                   S VNA DSK R   H A+    ++ LQ+L   N  +   ++    PL  A+  G    VE L+++      +      ++ +  TALHL+  K +     ++L+   D N+ +  +N    T L +A +N   +++ +  GK +  L
Sbjct:  479 ATSDTDGKCLEYLLRNDANPG-IRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTL------QDKSKNTALHLACGKGHETSALLILEKITDRNL-INATNAALQTPLHVAARNGLTMVVQELLGKGASVL 953          

HSP 8 Score: 80.1073 bits (196), Expect = 1.111e-13
Identity = 103/411 (25.06%), Postives = 176/411 (42.82%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQL--LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF-INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            L +A    + + V+ LL++  DV + RD   +T LH     K   C E   S+ P L  ++  ++ G T LH A+       ++ LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G D++  + Y  +PL  A  +     +  LI+ GA +  K+  G + LH+A ++ +  +   LL     D+     +  T L     +      + +++ G+ ++ ED       H A+  G    +  L     +  K      +PLH A+  G ++    L+++         F I+  +  G+T LH +    NLE   +LL  GAD N   +   G+S      AN N   L  +  +G S +DL
Sbjct:   78 LHRAVASCSEEAVQILLKHSADV-NARDKNWQTPLHIAAANKAVKCAE---SLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDL-------GVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSS--------GFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKF--GRSPLHYAAANCNYQCLFALVGSGASVNDL 467          

HSP 9 Score: 78.5666 bits (192), Expect = 3.318e-13
Identity = 83/363 (22.87%), Postives = 149/363 (41.05%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA--------------------------IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+ +L+L +    +N FD+ +   +H       IE + LL+ + A V   D    T L+ A     ++ ++    Y+ D    +  P+  GN PLH A                               +  +       +ELL+    D+  + +  +TPL +          +T++++GA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:  135 VSDRAGRTALHHAAFSGHGEMVKLLLSRGAN-INAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVK----YLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTL-ITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAATSDTDGKCL 488          

HSP 10 Score: 77.7962 bits (190), Expect = 6.938e-13
Identity = 93/370 (25.14%), Postives = 161/370 (43.51%), Query Frame = 2
Query: 2087 GEVSEIRDQSGKTLLHYSLK-NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLA---VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTM---PLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            G V +  D++G T LH + +   EL    L  +     K     +  LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  +     D  G  PLHYA   C Y     QC   +  L+     +   D    TPL  A   +   + +E LL+N AN   RD Q   +VHY            + SE  L++  + +   +  + D   T    ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K  D  +   P+H AA  G+ E   +L+        V+ ++ +GQT L L+ +       + L++K + ++
Sbjct:  329 GAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNK----KDKFGRSPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRAT----ISPLHLAAYHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVK--DYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVD 680          

HSP 11 Score: 63.5438 bits (153), Expect = 1.380e-8
Identity = 79/299 (26.42%), Postives = 125/299 (41.81%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKE---LFELILKKTPELVNK--FDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT-RDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLS 2911
            G+ E V + +  G +   +RD  G+T +H S        L  L+   T    N    D    T LH    +     + LLL+ +      DGN  + L+ AVI +N  A E + D +      +   D+ G  PLH A     +   V +C   ++LLL  N  +   D   +TPL++A        VE L+ + +  LT +D     ++H  C +G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+
Sbjct:  697 GHEECVDALLQHGAKC-LLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVDNHGYTALHWACYNGHETCVELLLEQDVFQKI-DGNAFSPLHCAVINDNEGAAEMLIDSL--GASIVNATDSKGRTPLHAA----AFTDHV-EC---LQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHET--SALLILEKITDRNLINATNAALQTPLHVAARNGLTMVVQELLGKGASVLAVDENGYTPALACAPNKDVADCLALILA 981          

HSP 12 Score: 60.8474 bits (146), Expect = 1.035e-7
Identity = 90/386 (23.32%), Postives = 163/386 (42.23%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL----DDYK----------------------------FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLH-EASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTV 1243
            L  A   G+ + VK LL    ++ +  D  D+  +H+     +   V+L++S   ++    +K  YT LH A+     + ++YLL    D+N+ N    + L +A        V  L +  A VN  +  G +P+H+AA         +    + +L+ +GAD++      ++PL         ++ + +I+ GA I  +D +G + LH A   G+  +I  L+    D  K                            FD++T D    T L  A +  N++ + LLL  G++ N +D   R+  H+A+   + + L  L     ++  L+     PLH  A+     + +E+L+ N +    I      R+  G  A+H S  
Sbjct:  144 LHHAAFSGHGEMVKLLLSRGANI-NAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEV-TCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAA------STHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRN-DANPGI------RDKQGYNAVHYSAA 514          

HSP 13 Score: 60.8474 bits (146), Expect = 1.035e-7
Identity = 81/359 (22.56%), Postives = 160/359 (44.57%), Query Frame = 2
Query:  269 RDLTDKTLLHYCFK---YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTS-LRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNG------------VSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSS-GLSILHYATSNGNLEIIQMLLDDYKFD--LETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQ 1279
            +D   ++ LHY      Y+ C+  ++     + D  E+ G T LH A+        L YLL  + +   R+    +++  +  Y +   ++L+        + + +G            +SP+H AA            + + +L++   D+D  +   R+PL  A    ++  +  LI +GA I  KD     + +H A +NG+ E +++L+ + +    ++  D N  T LM +    + D V  LL +G+NV+A+D   R A H  +  G  + +  L Q+       ++    P+H ++  GH  ++  L+   T+++    +++  NH    G TALH +    +    ++LL+
Sbjct:  434 KDKFGRSPLHYAAANCNYQ-CLFALVGSGASVNDLDER-GCTPLHYAATSDTDGKCLEYLLRNDANPGIRDKQGYNAVHYSAAYGHRLCLQLIASETPLDVLMETSGTDMLSDSDNRATISPLHLAA-------YHGHHQALEVLVQSLLDLDVRNSSGRTPLDLAAFKGHVECVDVLINQGASILVKDYVLKRTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDANPAVVD--NH----GYTALHWACYNGHETCVELLLE 777          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96KQ7|EHMT2_HUMAN (Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=3)

HSP 1 Score: 113.235 bits (282), Expect = 9.463e-24
Identity = 61/198 (30.81%), Postives = 111/198 (56.06%), Query Frame = 2
Query:  665 GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKG-HNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNL 1255
            GA+I+ +D  +R+PLM AV +N+L   ++++++G C+YSK+  G + LH+A   GNLE++ +LL   + D+   DS   T +++A  + +++V+ +LL RG++V   D++     H+AS  G     +VL     +L  +N   + PLH A+ +  H+ ++ FL     P+         RN  G TA  L+  + ++
Sbjct:  708 GANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPE--------LRNKEGDTAWDLTPERSDV 897          

HSP 2 Score: 81.6481 bits (200), Expect = 4.974e-14
Identity = 62/220 (28.18%), Postives = 100/220 (45.45%), Query Frame = 2
Query: 2432 PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRND 3091
            PLH A +    K SV  C     +LL+   +I   D+  RTPL+ A+  NH+E    +++ G    +++      +H+    GNLE+ + L      D N  D  G TPI +A  + + ++++ L+   A + + D       H A+  G+    E+LL+   D  +  + G  PLH AA   Y +   + L   S   N   +N  G TA  L   R+D
Sbjct:  688 PLHAAAQ----KGSVEIC----HVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFL---SRGANPELRNKEGDTAWDLTPERSD 896          

HSP 3 Score: 59.3066 bits (142), Expect = 3.230e-7
Identity = 41/163 (25.15%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  806 LHYATSNGNLE-IIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            L+ +   G L+ +I MLLD+   + ++   +  T L  A    +V++  +LL+ G+N+NA D ++R     A     L+  + + Q    ++    D +  LH A+  G+ E+V  L++  +        +N ++S G T +  +    ++E+ ++LL  GAD
Sbjct:  654 LYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVD------VNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGAD 810          

HSP 4 Score: 56.9954 bits (136), Expect = 1.479e-6
Identity = 48/202 (23.76%), Postives = 92/202 (45.54%), Query Frame = 2
Query:  368 EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSN 973
            +++  T LH A+          LL    +IN  +   R+ L+ AV+ ++ E  + + +    V   + +G + +H+AAK+         L           D++  D    +P++WA    ++  ++ L+ +GA +   D+     LH+A+  G+  I ++LL + + DL   + +  T L  A   +  D V L L RG+N
Sbjct:  682 QQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQ------VDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLL-NARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGAN 876          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Z148|EHMT2_MOUSE (Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus OX=10090 GN=Ehmt2 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 1.333e-23
Identity = 62/198 (31.31%), Postives = 110/198 (55.56%), Query Frame = 2
Query:  665 GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKG-HNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNL 1255
            GA+I+ +D  +R+PLM AV +N+L   +++++ G C+YSK+  G + LH+A   GNLE++ +LL   + D+   DS   T +++A  + ++DV+ +LL RG++V   D++     H+AS  G     +VL     +L  +N   + PLH A+ +  H+ ++ FL     P+         RN  G TA  L+  + ++
Sbjct:  761 GANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPE--------LRNKEGDTAWDLTPERSDV 950          

HSP 2 Score: 78.1814 bits (191), Expect = 5.011e-13
Identity = 62/220 (28.18%), Postives = 99/220 (45.00%), Query Frame = 2
Query: 2432 PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRND 3091
            PLH A +    K SV  C     +LL+   +I   D+  RTPL+ A+  NH+E    +++ G    +++      +H+    GNLE+ + L      D N  D  G TPI +A  + +  +++ L+   A + + D       H A+  G+    E+LL+   D  +  + G  PLH AA   Y +   + L   S   N   +N  G TA  L   R+D
Sbjct:  741 PLHAAAQ----KGSVEIC----HVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAVNYHGDTPLHIAARESYHDCVLLFL---SRGANPELRNKEGDTAWDLTPERSD 949          

HSP 3 Score: 57.7658 bits (138), Expect = 8.129e-7
Identity = 40/163 (24.54%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  806 LHYATSNGNLE-IIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            L+ +   G L+ +I MLLD+   + ++   +  T L  A    +V++  +LL+ G+N+NA D ++R     A     L+  + + Q    ++    D +  LH A+  G+ E+V  L++  +        +N ++S G T +  +    ++++ ++LL  GAD
Sbjct:  707 LYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVD------VNAQDSGGWTPIIWAAEHKHIDVIRMLLTRGAD 863          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A2J7QBR4 (ANK_REP_REGION domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G06359 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.270e-59
Identity = 131/393 (33.33%), Postives = 217/393 (55.22%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES--CVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKV-----KAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
            L+ AC++  ++ V+++L    +    RD T KT LHYC +  S  C ++ LSVA  L+D  +++GYT LHLA +      +++LLSKN D+N  + +  S +  A +    EA++L+ +  A  +  D++G  P+HYAA++     +   +    L ++  LL  G +++  D   R P++WA  + +   +  L+  GA + + D  GL+ LH A S G+ + I+ L+     +++  DSN CTAL YA +  + D  +LLL  G+  + +D K R   H  + KG L+ L++L  +  NLW  N   +YPLHEA   G   +V +L+T         + +N  N++G+  LH++ V +N+E+CKILL N A  N  +R S G+ MT +D A
Sbjct:   40 LMYACQQSRDQDVRRILAKKPEAAKERDRTMKTALHYCAESASLTCADIFLSVAADLVDARDEDGYTPLHLAVIAGNRPLIKFLLSKNADVNSLDYERHSVVHWATVCGEVEALELVLDAGANPSTPDIHGGYPVHYAAQMCGPNSEMGNDVRFGLAVLRKLLARGVEVNVRDKDGRQPILWAASAGSADAILALVNAGANVEADDKDGLTALHCAASRGHTDCIETLVTLCGAEVDVIDSNGCTALFYAVTLGHADSTQLLLNFGAEPDRQDRKGRTPAHCGAAKGQLETLRILGTHGANLWVRNVRGDYPLHEAVVSGRKNLVYWLLTQRP------DAVNSPNNDGRCPLHIAAVNNNVEMCKILLDNQALLNPVMRTSKGQLMTPIDAA 426          

HSP 2 Score: 172.17 bits (435), Expect = 1.179e-41
Identity = 121/401 (30.17%), Postives = 192/401 (47.88%), Query Frame = 2
Query: 2090 EVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEIC----KYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILL-NTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLA---TTPDCKNTLKTFGGRSAKKVINCS 3262
            E ++ RD++ KT LHY  ++  L   ++ L    +LV+  DE   T LH+ +++     +  LL  NA+VN  D    + ++ A +   + ALE + D   + +     PD  G YP+HYA ++C    +    V      +  LL    ++  RD+  R P+L A +    +A+  L+  GAN    D   L ++H   S G+ +    L      + +V D NG T +FYAV+  +    + L+   A+ D  D+ GRT  H  A KG  + L +L ++G + W +   G  PLHEA   G K +   LL   P A   VN  NN G+  LH+AAV N+  MC +L+   + +N ++  TS  + +T  D A       C   L+  GG  A K+ + S
Sbjct:   61 EAAKERDRTMKTALHYCAESASLTCADIFLSVAADLVDARDEDGYTPLHLAVIAGNRPLIKFLLSKNADVNSLDYERHSVVHWATVCGEVEALELVLDAGANPS----TPDIHGGYPVHYAAQMCGPNSEMGNDVRFGLAVLRKLLARGVEVNVRDKDGRQPILWAASAGSADAILALVNAGANVEADDKDGLTALHCAASRGHTDCIETLVTLCGAEVDVIDSNGCTALFYAVTLGHADSTQLLLNFGAEPDRQDRKGRTPAHCGAAKGQLETLRILGTHGANLWVRNVRGDYPLHEAVVSGRKNLVYWLLTQRPDA---VNSPNNDGRCPLHIAAVNNNVEMCKILLDNQALLNPVM-RTSKGQLMTPIDAALHRGNRGCAKYLQLHGGVPASKLTDKS 453          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A067RB32 (ANK_REP_REGION domain-containing protein (Fragment) OS=Zootermopsis nevadensis OX=136037 GN=L798_03879 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 4.802e-57
Identity = 124/367 (33.79%), Postives = 202/367 (55.04%), Query Frame = 2
Query:  269 RDLTDKTLLHYCFKYES--CVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXX-----XXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
            RD T KT LHYC +  S  C ++ILS A  L+D  +++GYT +HLA +      +++L+SKN D+N  + +  S +  A +    EA++L+ +  A  +  D++G  P+HYAA++                ++  LL  G D++  D   R P++WA  + +   +  L+  GA + + D  GL+ LH A S G+ + ++ L+     D++  DSN CTAL YA +  + D  +LLL  G+  N +D K R   H  + KG L+ L++L  +  NLW  N   +YPLHEA   G  ++V +L+T   P+      +N  N++G+  LH++ + +N+E+CKILL + A  N  +R S G+ MT +D A
Sbjct:    1 RDRTMKTALHYCAESASLTCADMILSAARDLVDARDEDGYTPIHLAVIAGNRPLIKFLMSKNADVNSLDYERHSVVHWATVCGEVEALELVLDAGANPSTPDIHGGYPIHYAAQMCGPNSEMGNDVRFGLAVLRKLLAKGVDVNVRDKDGRQPILWAASAGSADAILALVNAGANVEADDKDGLTALHCAASRGHTDCLETLVTLCGADVDVIDSNGCTALFYAVTLGHADSTQLLLSFGAEPNRQDRKGRTPAHCGAAKGQLETLRILGTHGANLWVRNVRGDYPLHEAVVSGRKDLVRWLLTQ-RPEA-----VNSPNNDGRCPLHIAAINNNVEMCKILLDSQALLNPVMRTSKGQLMTPIDAA 361          

HSP 2 Score: 171.4 bits (433), Expect = 1.498e-42
Identity = 116/391 (29.67%), Postives = 188/391 (48.08%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKNKELF--ELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTY----MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLAT---TPDCKNTLKTFGGRSAKKV 3250
            RD++ KT LHY  ++  L   ++IL    +LV+  DE   T +H+ +++     +  L+  NA+VN  D    + ++ A +   + ALE + D   + +     PD  G YP+HYA ++C     +     +    +  LL    D+  RD+  R P+L A +    +A+  L+  GAN    D   L ++H   S G+ +    L      D +V D NG T +FYAV+  +    + L+   A+ +  D+ GRT  H  A KG  + L +L ++G + W +   G  PLHEA   G K++   LL      E VN  NN G+  LH+AA+ N+  MC +L+   + +N ++  TS  + +T  D A       C   L+  GG  A K+
Sbjct:    1 RDRTMKTALHYCAESASLTCADMILSAARDLVDARDEDGYTPIHLAVIAGNRPLIKFLMSKNADVNSLDYERHSVVHWATVCGEVEALELVLDAGANPS----TPDIHGGYPIHYAAQMCGPNSEMGNDVRFGLAVLRKLLAKGVDVNVRDKDGRQPILWAASAGSADAILALVNAGANVEADDKDGLTALHCAASRGHTDCLETLVTLCGADVDVIDSNGCTALFYAVTLGHADSTQLLLSFGAEPNRQDRKGRTPAHCGAAKGQLETLRILGTHGANLWVRNVRGDYPLHEAVVSGRKDLVRWLLTQRP--EAVNSPNNDGRCPLHIAAINNNVEMCKILLDSQALLNPVMR-TSKGQLMTPIDAALHRGNRGCAKYLQLHGGVPASKL 384          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A2J7QBR7 (ANK_REP_REGION domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G06359 PE=4 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 3.008e-56
Identity = 133/403 (33.00%), Postives = 218/403 (54.09%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES--CVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKV-----KAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAV---------C-SNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
            L+ AC++  ++ V+++L    +    RD T KT LHYC +  S  C ++ LSVA  L+D  +++GYT LHLA +      +++LLSKN D+N  + +  S +  A +    EA++L+ +  A  +  D++G  P+HYAA++     +   +    L ++  LL  G +++  D   R P++WA          C S +   +  L+  GA + + D  GL+ LH A S G+ + I+ L+     +++  DSN CTAL YA +  + D  +LLL  G+  + +D K R   H  + KG L+ L++L  +  NLW  N   +YPLHEA   G   +V +L+T         + +N  N++G+  LH++ V +N+E+CKILL N A  N  +R S G+ MT +D A
Sbjct:   40 LMYACQQSRDQDVRRILAKKPEAAKERDRTMKTALHYCAESASLTCADIFLSVAADLVDARDEDGYTPLHLAVIAGNRPLIKFLLSKNADVNSLDYERHSVVHWATVCGEVEALELVLDAGANPSTPDIHGGYPVHYAAQMCGPNSEMGNDVRFGLAVLRKLLARGVEVNVRDKDGRQPILWAASADSTSSASCPSGSADAILALVNAGANVEADDKDGLTALHCAASRGHTDCIETLVTLCGAEVDVIDSNGCTALFYAVTLGHADSTQLLLNFGAEPDRQDRKGRTPAHCGAAKGQLETLRILGTHGANLWVRNVRGDYPLHEAVVSGRKNLVYWLLTQRP------DAVNSPNNDGRCPLHIAAVNNNVEMCKILLDNQALLNPVMRTSKGQLMTPIDAA 436          

HSP 2 Score: 160.614 bits (405), Expect = 8.983e-38
Identity = 120/409 (29.34%), Postives = 191/409 (46.70%), Query Frame = 2
Query: 2090 EVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEIC----KYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINV----------NHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILL-NTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLA---TTPDCKNTLKTFGGRSAKKVIN 3256
            E ++ RD++ KT LHY  ++  L   ++ L    +LV+  DE   T LH+ +++     +  LL  NA+VN  D    + ++ A +   + ALE + D   + +     PD  G YP+HYA ++C    +    V      +  LL    ++  RD+  R P+L A +              +A+  L+  GAN    D   L ++H   S G+ +    L      + +V D NG T +FYAV+  +    + L+   A+ D  D+ GRT  H  A KG  + L +L ++G + W +   G  PLHEA   G K +   LL   P A   VN  NN G+  LH+AAV N+  MC +L+   + +N ++  TS  + +T  D A       C   L+  GG  A K+ +
Sbjct:   61 EAAKERDRTMKTALHYCAESASLTCADIFLSVAADLVDARDEDGYTPLHLAVIAGNRPLIKFLLSKNADVNSLDYERHSVVHWATVCGEVEALELVLDAGANPS----TPDIHGGYPVHYAAQMCGPNSEMGNDVRFGLAVLRKLLARGVEVNVRDKDGRQPILWAASADSTSSASCPSGSADAILALVNAGANVEADDKDGLTALHCAASRGHTDCIETLVTLCGAEVDVIDSNGCTALFYAVTLGHADSTQLLLNFGAEPDRQDRKGRTPAHCGAAKGQLETLRILGTHGANLWVRNVRGDYPLHEAVVSGRKNLVYWLLTQRPDA---VNSPNNDGRCPLHIAAVNNNVEMCKILLDNQALLNPVM-RTSKGQLMTPIDAALHRGNRGCAKYLQLHGGVPASKLTD 461          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A5E4MDK7 (ANK_REP_REGION domain-containing protein OS=Cinara cedri OX=506608 GN=CINCED_3A023948 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 5.331e-55
Identity = 137/423 (32.39%), Postives = 236/423 (55.79%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES----CVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLL-SKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKV------KAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA-NKNETKL--LIVKFNGKSSDDLLKT 1417
            L+KAC  G +++V+ +LE        RD   KT LHYC + +     C +L+L V P ++D  +++G+T LHLA +      +R+LL S + D NKR+ +  S++  A +  + +A++L+  +       DV+G   +HYAA++      ++       + ++  LL +GAD+   D + R P++WA  + +   +  LI  GA + S D  GL+ LH A S G++E +  LL     +++  DSN+C+AL YA +  + D  E+LLE G+N + +D K R   H  + KG L+ +++L  +  NLW  N+   YPLH+A   G  ++V +LI+ M P+      +++ + +G+  LH++ + +NLE+ KI+L NGA  N  +++  G+ +T LD+A  KN   L   +  + GK +  L+KT
Sbjct:   34 LMKACMYGRSEQVRLILEEKPLSVIERDGVFKTALHYCAENDEEDADCAKLLLEVDPSIVDIPDEDGHTALHLAVIAGNLPLVRFLLVSGHADPNKRDAEGHSTIHWATVCADVDALELVLSHGGTTKSADVHGGYAIHYAAQMCGTGICRSGEARTIGVRVLQSLLSYGADVHVTDKHGRQPILWAASAGSADAIITLINGGANVESHDKDGLTALHCAASRGHVECVDGLLTLCGSEVDAVDSNSCSALFYAVTLGHADATEILLEHGANPDRKDGKGRTPAHCGAFKGQLETVRLLADHGANLWLRNSKGGYPLHDAMRSGRKDLVLWLIS-MRPES-----VDYYDDDGKRPLHIAALNNNLEMSKIILDNGASINPVMKI-KGERLTPLDVALRKNNGHLAKFLHLYGGKPASKLIKT 449          

HSP 2 Score: 152.525 bits (384), Expect = 2.305e-33
Identity = 117/425 (27.53%), Postives = 200/425 (47.06%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEI-RDQSGKTLLHYSLKNKE----LFELILKKTPELVNKFDETNLTILHMVIMSKEIERLP-LLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCK-------TYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPD---CKNTLKTFGGRSAKKVI 3253
            L  +C  G  E V   I +   +S I RD   KT LHY  +N E      +L+L+  P +V+  DE   T LH+ +++  +  +  LL+  +A+ N  D  G + ++ A +  ++ ALE     +       +  D  G Y +HYA ++C     +C+           ++ LL    D+   D+  R P+L A +    +A+ TL+  GAN  + D   L ++H   S G++E  + L      + +  D N  + +FYAV+  +    + L+E  A  D  D  GRT  H  A KG  + + LL  +G + W +   G  PLH+A   G K++   L++     E+V+  ++ G+  LH+AA+ N+  M  +++   + IN ++      E LT  D+A   +       L  +GG+ A K+I
Sbjct:   34 LMKACMYGRSEQV-RLILEEKPLSVIERDGVFKTALHYCAENDEEDADCAKLLLEVDPSIVDIPDEDGHTALHLAVIAGNLPLVRFLLVSGHADPNKRDAEGHSTIHWATVCADVDALE----LVLSHGGTTKSADVHGGYAIHYAAQMCG--TGICRSGEARTIGVRVLQSLLSYGADVHVTDKHGRQPILWAASAGSADAIITLINGGANVESHDKDGLTALHCAASRGHVECVDGLLTLCGSEVDAVDSNSCSALFYAVTLGHADATEILLEHGANPDRKDGKGRTPAHCGAFKGQLETVRLLADHGANLWLRNSKGGYPLHDAMRSGRKDLVLWLISMRP--ESVDYYDDDGKRPLHIAALNNNLEMSKIILDNGASINPVMK--IKGERLTPLDVALRKNNGHLAKFLHLYGGKPASKLI 447          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A5E4MI26 (Ankyrin repeat-containing domain,Ankyrin repeat OS=Cinara cedri OX=506608 GN=CINCED_3A023948 PE=4 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 8.603e-55
Identity = 137/423 (32.39%), Postives = 236/423 (55.79%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES----CVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLL-SKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKV------KAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA-NKNETKL--LIVKFNGKSSDDLLKT 1417
            L+KAC  G +++V+ +LE        RD   KT LHYC + +     C +L+L V P ++D  +++G+T LHLA +      +R+LL S + D NKR+ +  S++  A +  + +A++L+  +       DV+G   +HYAA++      ++       + ++  LL +GAD+   D + R P++WA  + +   +  LI  GA + S D  GL+ LH A S G++E +  LL     +++  DSN+C+AL YA +  + D  E+LLE G+N + +D K R   H  + KG L+ +++L  +  NLW  N+   YPLH+A   G  ++V +LI+ M P+      +++ + +G+  LH++ + +NLE+ KI+L NGA  N  +++  G+ +T LD+A  KN   L   +  + GK +  L+KT
Sbjct:   34 LMKACMYGRSEQVRLILEEKPLSVIERDGVFKTALHYCAENDEEDADCAKLLLEVDPSIVDIPDEDGHTALHLAVIAGNLPLVRFLLVSGHADPNKRDAEGHSTIHWATVCADVDALELVLSHGGTTKSADVHGGYAIHYAAQMCGTGICRSGEARTIGVRVLQSLLSYGADVHVTDKHGRQPILWAASAGSADAIITLINGGANVESHDKDGLTALHCAASRGHVECVDGLLTLCGSEVDAVDSNSCSALFYAVTLGHADATEILLEHGANPDRKDGKGRTPAHCGAFKGQLETVRLLADHGANLWLRNSKGGYPLHDAMRSGRKDLVLWLIS-MRPES-----VDYYDDDGKRPLHIAALNNNLEMSKIILDNGASINPVMKI-KGERLTPLDVALRKNNGHLAKFLHLYGGKPASKLIKT 449          

HSP 2 Score: 151.754 bits (382), Expect = 4.080e-33
Identity = 117/425 (27.53%), Postives = 200/425 (47.06%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEI-RDQSGKTLLHYSLKNKE----LFELILKKTPELVNKFDETNLTILHMVIMSKEIERLP-LLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCK-------TYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPD---CKNTLKTFGGRSAKKVI 3253
            L  +C  G  E V   I +   +S I RD   KT LHY  +N E      +L+L+  P +V+  DE   T LH+ +++  +  +  LL+  +A+ N  D  G + ++ A +  ++ ALE     +       +  D  G Y +HYA ++C     +C+           ++ LL    D+   D+  R P+L A +    +A+ TL+  GAN  + D   L ++H   S G++E  + L      + +  D N  + +FYAV+  +    + L+E  A  D  D  GRT  H  A KG  + + LL  +G + W +   G  PLH+A   G K++   L++     E+V+  ++ G+  LH+AA+ N+  M  +++   + IN ++      E LT  D+A   +       L  +GG+ A K+I
Sbjct:   34 LMKACMYGRSEQV-RLILEEKPLSVIERDGVFKTALHYCAENDEEDADCAKLLLEVDPSIVDIPDEDGHTALHLAVIAGNLPLVRFLLVSGHADPNKRDAEGHSTIHWATVCADVDALE----LVLSHGGTTKSADVHGGYAIHYAAQMCG--TGICRSGEARTIGVRVLQSLLSYGADVHVTDKHGRQPILWAASAGSADAIITLINGGANVESHDKDGLTALHCAASRGHVECVDGLLTLCGSEVDAVDSNSCSALFYAVTLGHADATEILLEHGANPDRKDGKGRTPAHCGAFKGQLETVRLLADHGANLWLRNSKGGYPLHDAMRSGRKDLVLWLISM--RPESVDYYDDDGKRPLHIAALNNNLEMSKIILDNGASINPVMK--IKGERLTPLDVALRKNNGHLAKFLHLYGGKPASKLI 447          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ANKRD50 (ankyrin repeat domain 50 [Source:NCBI gene;Acc:103026486])

HSP 1 Score: 111.309 bits (277), Expect = 4.152e-24
Identity = 82/314 (26.11%), Postives = 161/314 (51.27%), Query Frame = 2
Query:  356 LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            +D  + NG T L  A+ +   + +  LL     ++  +++ R+ L +A    N E V+ L +   + N  D  G +P+H AA        E   ++ + LL+ GA    +D   R PL+ A    +   ++ L+E  +CI  +   G + L  A   G+ +I+++LL  +  D++  D++    L      N + + E  LE G+NV   D++ R A H +  +G ++ +++L  Y+ ++   +N+    L  A+++GH+++V+FLI +          ++H  + G TAL ++  + ++++ +ILL++GADPN
Sbjct:  768 VDHTDNNGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENHRDDAGWTPLHMAA-------FEGHRQVCDALLEQGARCSEVDNDGRIPLILAAQEGHYDCVQILLENKSCIDQRGYDGRNSLRVAALEGHRDIVELLLS-HGADIDYNDADGRPTLYILALENQLAMAEYFLENGANVETSDTEGRTALHVSCWQGHVEMVRLLISYHADVNSCDNEKRSALQSAAWQGHSKVVQFLIDSG-------THVDHTCNQGATALGIAAQEGHIDVVRILLEHGADPN 1066          

HSP 2 Score: 105.916 bits (263), Expect = 1.845e-22
Identity = 109/413 (26.39%), Postives = 174/413 (42.13%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLA-ALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE------------------------------NVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLAT 3193
            G+ E+V + ++ G +V      S   L   +    E   L L +    VNK D    T L         E +  LL + A VN  D +GRTAL++A +    +     +   + D+   +   D     PL  A     Y+  V      ++LLLE   D++  D   RTPLL A ++ H   V TLL  GA   + D +    +    ++GN+E+   L +    D N  D  G TP+  A    + ++   L+E  A+   VD  GR     AA++G + C+++LL        + +DG   L  AA  G+++I E+LL+  + I+                              NV   +  G+TALH++  +    M  LLIS  + +     N+ DNE+ +A   A 
Sbjct:  616 GHSEVVSALLYAGAKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDCMTPLLVA----AYEGHV----DVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTL-LDRGLDENHRDDAGWTPLHMAAFEGHRQVCDALLEQGARCSEVDNDGRIPLILAAQEGHYDCVQILLENKSCIDQRGYDGRNSLRVAALEGHRDIVELLLSHGADIDYNDADGRPTLYILALENQLAMAEYFLENGANVETSDTEGRTALHVSCWQGHVEMVRLLISYHADV-----NSCDNEKRSALQSAA 1014          

HSP 3 Score: 104.76 bits (260), Expect = 5.140e-22
Identity = 94/367 (25.61%), Postives = 176/367 (47.96%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            L  A ++G+ K V  L+   +++          L    +   S V   L  A   +D  + +  T L  A+       +  LL    ++NK +N+ R++L+ A    + E V+ L ++ AEVN  DV+G + +  AA        +    ++++L+  GA++D  D    +PL+ A    ++  +  L+E GA +   D++G + L  A S G+  ++  LL  +   +++ DS   T L  A +  NV+VV  LL+RG + N  D       H A+ +G  +    L +      +++ND   PL  A+ +GH + V+ L+ N        + I+ R  +G+ +L ++ ++ + +I ++LL +GAD
Sbjct:  576 LTLAARQGHTKVVNCLIGCDSNINHTDHDGWTALRSAAWGGHSEVVSALLYAGAKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAA--LCVPASKGHASVVSLLIDRGAEVDHCDKDCMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLL-FWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLLDRGLDENHRDDAGWTPLHMAAFEGHRQVCDALLEQGARCSEVDNDGRIPLILAAQEGHYDCVQILLENK-------SCIDQRGYDGRNSLRVAALEGHRDIVELLLSHGAD 932          

HSP 4 Score: 95.1301 bits (235), Expect = 4.334e-19
Identity = 99/397 (24.94%), Postives = 190/397 (47.86%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVI-----YDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
             +  L  A   G+++ V  LL     V D  D   +T L       +E  V  +L    ++ +  +  G T L  A+ +     + +LL    ++N  + D R++L +A +       +   V LL +  AEV+  D + ++P+  AA        E  ++++++LL+ GAD+D  D   R+PL+ A    + + +  L+  GA + S DS G ++L  A++ GN+E+++ LL D   D    D    T L  A    +  V + LLE+G+  +  D+  R     A+ +G    +Q+L +    + +   D    L  A+ +GH +IVE L+++          I++ +++G+  L++  +++ L + +  L+NGA+    +  S+ +  TAL ++
Sbjct:  605 GWTALRSAAWGGHSEVVSALLYAGAKV-DCADADSRTALRAAAWGGHEDIVLNLLQHGAEV-NKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDCMTPLLVAA-------YEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLLFWGAAVDSIDSEGRTVLSIASAQGNVEVVRTLL-DRGLDENHRDDAGWTPLHMAAFEGHRQVCDALLEQGARCSEVDNDGRIPLILAAQEGHYDCVQILLENKSCIDQRGYDGRNSLRVAALEGHRDIVELLLSHGAD-------IDYNDADGRPTLYILALENQLAMAEYFLENGAN----VETSDTEGRTALHVS 980          

HSP 5 Score: 81.2629 bits (199), Expect = 7.015e-15
Identity = 89/350 (25.43%), Postives = 149/350 (42.57%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL-------LNT--PSAIENVNEK 3043
            L A+  +G+  +V + +  G  V  I D  G+T+L  +    N E+   +L +  +  N  D+   T LHM       +    LL+  A  +  D +GR  L LA    +    +C+   + +K+   Q   +  N     A+E           +  +ELLL    DI+  D   R  L +    N +   E  L+NGAN  T D +   ++H  C +G++E+  +L +  + D N  D    + +  A    + K+V+ LI+    +D     G T    AA++G    + +LL +G DP      G   +  AA  G+  I ++L       LN   PS I  + +K
Sbjct:  779 LLAAASMGHASVVNTLLFWGAAVDSI-DSEGRTVLSIASAQGNVEVVRTLLDRGLD-ENHRDDAGWTPLHMAAFEGHRQVCDALLEQGARCSEVDNDGRIPLILAAQEGHY---DCVQILLENKSCIDQRGYDGRNSLRVAALE---------GHRDIVELLLSHGADIDYNDADGRPTLYILALENQLAMAEYFLENGANVETSDTEGRTALHVSCWQGHVEMV-RLLISYHADVNSCDNEKRSALQSAAWQGHSKVVQFLIDSGTHVDHTCNQGATALGIAAQEGHIDVVRILLEHGADPNHADQFGRTAMRVAAKGGHSGIIKLLEKYGASSLNGCNPSPIHTMEQK 1113          

HSP 6 Score: 78.9518 bits (193), Expect = 3.267e-14
Identity = 88/347 (25.36%), Postives = 151/347 (43.52%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKN--GYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDS---------------------------------NNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYK 1126
            LL A   G+   V  LL     V D  D   +T+L      +  VE++ ++  + LD   ++  G+T LH+A+          LL +    ++ +ND R  L+LA    + + V++L EN + ++    +G + +  AA        E   +I+ +LL HGADID  D   R  L      N L   ++ +E GA + + D+ G + LH +   G++E++++L+  Y  D+ + D+                                    TAL  A    ++DVV +LLE G++ N  D   R A   A+  G    +++L +Y  +   LN  +  P+H    K
Sbjct:  779 LLAAASMGHASVVNTLLFWGAAV-DSIDSEGRTVLSIA-SAQGNVEVVRTLLDRGLDENHRDDAGWTPLHMAAFEGHRQVCDALLEQGARCSEVDNDGRIPLILAAQEGHYDCVQILLENKSCIDQRGYDGRNSLRVAA-------LEGHRDIVELLLSHGADIDYNDADGRPTLYILALENQLAMAEYFLENGANVETSDTEGRTALHVSCWQGHVEMVRLLIS-YHADVNSCDNEKRSALQSAAWQGHSKVVQFLIDSGTHVDHTCNQGATALGIAAQEGHIDVVRILLEHGADPNHADQFGRTAMRVAAKGGHSGIIKLLEKYGAS--SLNGCNPSPIHTMEQK 1113          

HSP 7 Score: 65.0846 bits (157), Expect = 5.901e-10
Identity = 55/220 (25.00%), Postives = 99/220 (45.00%), Query Frame = 2
Query:  743 MKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL---------DDYK-----------------------FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTV-----KDNLEICKILLQNGAD 1291
            ++ L++ GA +   DSSG ++L  A  +GNL+++ +L+         D++                         ++  TD +  TAL  A    + +VV  LL  G+ V+  D+  R A   A+  G    +  L Q+   + K +N+    L  A+Y GH EIVE L+ +          +NH + +G+TAL ++ +     K +  +  +L+  GA+
Sbjct:  522 IRTLLDNGASVNQSDSSGRTLLGNAAYSGNLDVVNLLISRGANMELQDNHGQTPLTLAARQGHTKVVNCLIGCDSNINHTDHDGWTALRSAAWGGHSEVVSALLYAGAKVDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAE-------VNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAE 734          

HSP 8 Score: 54.299 bits (129), Expect = 1.102e-6
Identity = 47/164 (28.66%), Postives = 75/164 (45.73%), Query Frame = 2
Query: 2588 EAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            +++ TLL NGA+    D      +      GNL++ N L +    +  + D +G TP+  A    + K+V  LI  ++ ++  D  G T    AA  G  + +  LL  G        D    L  AA+ G++   +I+LN       VN+ +N G+TAL  AA
Sbjct:  520 DSIRTLLDNGASVNQSDSSGRTLLGNAAYSGNLDVVN-LLISRGANMELQDNHGQTPLTLAARQGHTKVVNCLIGCDSNINHTDHDGWTALRSAAWGGHSEVVSALLYAGAKVDCADADSRTALRAAAWGGHE---DIVLNLLQHGAEVNKADNEGRTALIAAA 679          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 107.842 bits (268), Expect = 4.582e-23
Identity = 116/431 (26.91%), Postives = 196/431 (45.48%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTG------EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI----------------TNMEPKE------KILNFINHRNS----NGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGK-SMTALDLA----NKNETKLLIVK 1381
            A +  + +    LL+N  +  DV   T  T LH    YE+     LSVA  LL+ G       KNG T LH+A+       +R LL +   I+ R  D  + L  A    +   +++L +  A +     NG+SP+H AA+        + ++ +  LL++ A+ID + L   +PL  A    +    K L++KGA   ++  +G + LH A    ++  + +LL  +   LE    +  T L  A    ++++V+ LL+RG++ NA + K     H A+  G  +  Q L Q    +     D   PLH A+  GH E+V+ L+                 ++  +E      +IL   N + +     G T LH++     +++ ++LL+ GA+PN     + GK  +T L +A    N +  KLL+ K
Sbjct:  155 AARNDDTRTAAVLLQNDPNP-DVLSKTGFTPLHIAAHYEN-----LSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQ-------GDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLK-HSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPN-----AAGKNGLTPLHVAVHHNNLDVVKLLVSK 566          

HSP 2 Score: 86.2705 bits (212), Expect = 2.182e-16
Identity = 97/378 (25.66%), Postives = 161/378 (42.59%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS-LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYIT---------------DKTRFIQI-------PD---NSGNYPLHYAIEICKYKK-SVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            L  + + G+ ++V   +H G ++ E   + G T LH + L  +E     L      VN   +   + L+M      +E +  LL+N AN + P  +G T L +A+   +   +  + +Y T               D TR   +       PD    +G  PLH A     Y+  SV Q      LLL    ++    +   TPL +A    +V  V  LL  GA    R    L  +H     G++ +  ++ + +         NGL+PI  A    +   V++L++ NA++D +     T  H AA  G  +  ++LL  G    ++  +G  PLH A  + +    ++LL   +++E V E   SG T LH+AA
Sbjct:   24 LHLASKEGHVKMVLELLHHGIDL-ETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIA---AHYENLSVAQ------LLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVI-EILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE---SGLTPLHVAA 387          

HSP 3 Score: 84.3445 bits (207), Expect = 7.013e-16
Identity = 83/316 (26.27%), Postives = 139/316 (43.99%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLW---KLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVS 1315
            T LH+A+        ++LL     ++ +  D ++ L  A    + E VKLL E+ A  +     G +P+H AA+          L+      K       +     +PL  A     +   + L+E+GA   +   +GL+ LH A  + NL+++++L+        +T  N  T L  A   N ++V   LL+ G+N N+E  +     H A+  G+ D+  L +  Q NVNL    +    +  PLH  + +GH  I + L+       K    +   +  G TALH++    N+++ K LLQ  A  N   RV 
Sbjct:  414 TPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTK-------MTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP-HSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLV-------KQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVG 714          

HSP 4 Score: 83.9593 bits (206), Expect = 1.018e-15
Identity = 93/389 (23.91%), Postives = 155/389 (39.85%), Query Frame = 2
Query: 1991 QIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALEC-MNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNN-----SGQTALHLAAVRNDCPMCFLLISKDSKI 3133
            +I +IT  +   L  +   G+  +    + D G  +  R  +G T LH + K   +   +L+LK +  L     E+ LT LH+      +  +  LL+  A+ N  +    T L++A       A  C +  ++      +         PLH A  +          K  ++LLLE   + +       TPL +A    H      LL   A       +    +H  C  G +++  +L +    +PN    NGLTP+  AV + N  +VK L+          + G T  H AA++   +    LL  G +  S+   G  PLH AA  G  ++  +L+   S   NVN  N      +  T LHL A      +  +L+ + + +
Sbjct:  305 EIDDITLDHLTPLHVAAHCGHHRMAKVLL-DKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASL-EAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAA-----RAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGH--------KELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDV-AELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLI---SKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASV 674          

HSP 5 Score: 81.2629 bits (199), Expect = 6.543e-15
Identity = 81/327 (24.77%), Postives = 141/327 (43.12%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELIL--SVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYK----FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI 1156
            A + G+ +  + LL+N   V D +   D+T LH   +  ++  V+L+L     P   D+    G+T LH+A+      + R LL  N    K      + L +A  Y   +  +LL E  A  N    NG++P+H A  V        +L +      H    +G      +PL  A   N L     L++ GA   S+   G++ LH A   G  +++ +L+         +   T     T L       +V + ++L+++G++V +       A H A   G++K ++ L Q   ++         PLH+A+ +GH +IV  L+
Sbjct:  419 AARAGHCEVAQFLLQNLAQV-DAKAKDDQTPLHCAARMGHKELVKLLLEHKANP---DSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVA--VHHNNLDVVKLLVSKGGSPHSTARNGY-----TPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLL 734          

HSP 6 Score: 80.8777 bits (198), Expect = 8.083e-15
Identity = 99/384 (25.78%), Postives = 164/384 (42.71%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICK--YKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAV-FENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDN 3163
            L  + R GN  I+   + D G   + R +   T LH + +N    + E++L +   +  K  +  L+ +HM      ++ +  LL+ NA ++    +  T L++A    +      M   + DK         +G  PLH A   CK  + +S       M+LLL+ +  +E       TPL +A  + H+  V++LL+ GA+    +++    +H     G+ E+   L       D    D    TP+  A    ++++VK L+E  A  D     G T  H AA +G      +LL            G  PLH A   G  ++AE+LL   +   N N    +G T LH+A   N+  +  LL+SK        H+T+ N
Sbjct:  218 LHIAARRGNV-IMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAK-TKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGH----HRMAKVLLDKGAKANARALNGFTPLHIA---CKKNHMRS-------MDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQ--TPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGA---NPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSP----HSTARN 576          

HSP 7 Score: 79.337 bits (194), Expect = 2.899e-14
Identity = 89/363 (24.52%), Postives = 162/363 (44.63%), Query Frame = 2
Query:  212 GNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSN--GQTALHLSTVKDNLEICKILLQNGA 1288
            G+++  K LL+      + R L   T LH   K  +   ++L+L  +  L    E +G T LH+A+ +     ++ LL +    N  N    + L +A    + E  + L +N A+V+    +  +P+H AA++          E++ +LL+H A+ D       +PL  A    +    + L++  A        G + LH A   G +++ ++LL+    +      N  T L  A  +NN+DVV+LL+ +G + ++         H A+ +  L+    L Q   N    +     PLH A+ +G  ++V  LI+    K+  +N  N   +     T LHL   + ++ I  +L++ GA
Sbjct:  324 GHHRMAKVLLDKGAKA-NARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMG-------HKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLE-RGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLIS----KQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGA 672          

HSP 8 Score: 75.485 bits (184), Expect = 3.854e-13
Identity = 84/317 (26.50%), Postives = 137/317 (43.22%), Query Frame = 2
Query:  356 LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-----DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            ++T  +NG   LHLAS       +  LL    D+        ++L +A +    + V  L    A VN     G SP++ AA+       EN LE++  LL++GA+      DG      +PL  A+   +   +  LI  G    +K    L  LH A  N +     +LL +   + +       T L  A  Y N+ V +LLL RG+NVN          H A+ +G++  +++L      +     D   PLH A+  GH  ++E L+    P       I  +  NG + +H++   D+++  + LLQ  A+
Sbjct:   13 INTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQ-------ENHLEVVKFLLENGANQSLPTEDGF-----TPLAVALQQGHENVVALLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDP-NPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAP-------IQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAE 305          

HSP 9 Score: 73.559 bits (179), Expect = 1.454e-12
Identity = 96/388 (24.74%), Postives = 161/388 (41.49%), Query Frame = 2
Query: 1868 SPDFNNEPVKLTNSKKIKDSSEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFI-HDGGEVSEIRDQSGKTLLHYSLKNKELFEL-ILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEI--CKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLK-----NGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            SP+ +N  VK+     +   +  C++     +N  ++++K       +  +  L  + R+G+ E+V   + H     S     +G T LH + +        IL        K  +   T LH+     +++   LLL+  AN N    NG T L++AV +NNL  ++ +      K         +G  PLH A +    +   S+ QC          N + E    +  TPL LA      + V  L+      N  N +   +  L  +H V  EG++ I + L V +          G T +  A    N K+VK L++  A ++   + G T  H+AA++G    + LLL +G  P     +GT PL  A   GY  + ++L
Sbjct:  404 SPNASN--VKVETPLHMAARAGHCEVAQFLLQNLAQVDAK------AKDDQTPLHCAARMGHKELVKLLLEHKANPDSAT--TAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL----VSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGA--------NANSESLQGI--TPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADML-VKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 10 Score: 66.2402 bits (160), Expect = 2.720e-10
Identity = 66/248 (26.61%), Postives = 112/248 (45.16%), Query Frame = 2
Query:  755 IEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKI---LNFINHRNSNGQTA--------------------LHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI-------VKFNGKSSDDL 1408
            I+ G  I + + +GL+ LH A+  G+++++  LL  +  DLETT     TAL  A       VV  L+  G+NVNA+  K  +  + A+ +  L+ ++ L +   N      D   PL  A  +GH  +V  LI N   K K+      I  RN + +TA                    LH++   +NL + ++LL  GA  N+     NG  +T L +A +    +++        + + ++ D+L
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLH-HGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI-NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGA--NVNFTPKNG--ITPLHIAARRGNVIMVRLLLDRGAQIDARTKDEL 248          

HSP 11 Score: 63.929 bits (154), Expect = 1.366e-9
Identity = 72/303 (23.76%), Postives = 122/303 (40.26%), Query Frame = 2
Query: 2192 VNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYA-----IEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPN--VTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            +N  ++  L  LH+      ++ +  LL +  ++      G TAL++A +      +  +  Y  +    +      G  PL+ A     +E+ K+             LLE   +         TPL +A+   H   V  L+    N+ T+    L ++H      +       AV    DPN  V    G TP+  A    N  + + L+   A ++   + G T  H AA +G    + LLL  G    ++  D   PLH AA  G+  + EILL+  + I+    K  +G + +H+AA
Sbjct:   13 INTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGAN----VNAQSQKGFSPLYMAAQENHLEVVKF-------------LLENGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRT---AAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQ---AKTKNGLSPIHMAA 288          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 105.916 bits (263), Expect = 2.367e-22
Identity = 105/412 (25.49%), Postives = 184/412 (44.66%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD-YKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI-----------TNMEPKEKILNFINHRNS---------------NGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
            A K GN   VK LL+    + D +     T LH   +  +E  VE++L     +L +  KNG + LH+A+       ++ LL  +  ++   ND  ++L +A    + +  K++ +  A  N   +NG +P+H A K       +N ++++ +LLKHGA +  +     +P+  A    +   +K L   GA   + +  G + LH A   G  ++++ LL +  K D++  D    TAL  A      ++V+LLL++G+  +A  +      H A  +G  +   +L ++  +L         PLH A+  G  E  + L+           T + P     ++ N R +               NG T LH++  K+ LEI   LL+ GA+ N   R    + ++ L LA
Sbjct:  249 AAKRGNGNMVKLLLDRGAKI-DAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACK-------KNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQ--TALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTR----QGISPLHLA 645          

HSP 2 Score: 102.834 bits (255), Expect = 1.990e-21
Identity = 95/354 (26.84%), Postives = 162/354 (45.76%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGA--NFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            L  + R G  ++V   + +G +V +I+ +  +T LH +  L   E+ +L+L+K     +    +  T LH+ +     E   LLL++ A+++     G T L++A  Y  + A + +      K         +G  PLH A      + ++        LLL+         +   TPL +A   N +E   TLL+ GA  N +TR  Q +  +H    EG++++ + L + +N + N+ + NGLTP+  A       + + L+   A++D   + G T  H A   G  K +  LL       SK   G  PLH+AA +G+  I  +LL   ++    NE   +G TAL +A
Sbjct:  444 LHMAARAGQADVVRYLLQNGAKV-DIKAKDDQTALHIASRLGKAEIVQLLLQKG-AWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL----LQKRAAPDTAGKTGLTPLHVAAHYDNQRVAL--------LLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTR--QGISPLHLAAQEGSVDLVS-LLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRAS---ANELTLNGNTALSIA 777          

HSP 3 Score: 97.8265 bits (242), Expect = 6.244e-20
Identity = 94/342 (27.49%), Postives = 154/342 (45.03%), Query Frame = 2
Query:  359 DTGEKNGYTVLHLASMIKPPTSLRYLLS--KNPDINKR------NNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNN--CTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANK 1354
            DT  K     LH+A+      S   LL    N D+  +       +   + L +A  Y N     LL    A V+    N ++P+H AAK            ++ +LL  GA ID       +PL     S +   ++ L+++GA I SK  +GLS LH AT   +L  +Q+LL   + D+   D  N   TAL  A    +  V ++++++ +N NA+        H A  K  +K +++L ++  +L  +      P+H A++ GH  IV+ L  +           N  N  G+TALH++      ++ + LLQNGA  +I  +       TAL +A++
Sbjct:  162 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAK-------RGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL---QHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASP-------NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAK----DDQTALHIASR 482          

HSP 4 Score: 96.6709 bits (239), Expect = 1.393e-19
Identity = 93/354 (26.27%), Postives = 144/354 (40.68%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESC--VELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNS------NGQTALHLS 1237
            A + G    V+ LL+N   V D++   D+T LH   +      V+L+L            +GYT LHLA       +   LL     ++       + L +A  Y   EA KLL +  A  +     G++P+H AA             +  +LL HGA          +PL  A   N L     L+E GA   +    G+S LH A   G+++++ +LL     ++   + N  T L  A   + V V E+LL  G+ V+A         H A   G++K +  L +    +         PLH+A+ +GH  I+  L             + HR S      NG TAL ++
Sbjct:  447 AARAGQADVVRYLLQNGAKV-DIKAKDDQTALHIASRLGKAEIVQLLLQKG-AWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYD-------NQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTK-NANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINML-------------LQHRASANELTLNGNTALSIA 777          

HSP 5 Score: 95.9005 bits (237), Expect = 2.292e-19
Identity = 97/399 (24.31%), Postives = 183/399 (45.86%), Query Frame = 2
Query:  194 LKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAP--QLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYA------------------AKVK------AXXXXXXXXXXXXXXXKHGADIDG-LDLYKRS-----PLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI-TNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            L+A + GN +K    L+   D+ ++ +      LH   K E  VE++  +      +D   K G T LH+AS+      +R L++   ++N ++ +  + L +A   ++ E V+ L E+ A  +I   +G +P+  A                   KV+      A  + + +   + +   H AD++  +  Y  +     PL  A    N+     L+ +GA +     + ++ LH A   GN  ++++LLD   K D +T D    T L       +  VVE+LL+RG+ + ++     +  H A+    L  +Q+L Q++V +  + ND    LH A++ GH ++ + ++     P  K L        NG T LH++  K+ +++ ++LL++GA
Sbjct:   12 LRAARAGNLEKALDYLKTGVDI-NICNQNGLNALHLASK-EGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD--GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKAL--------NGFTPLHIACKKNRVKVMELLLKHGA 398          

HSP 6 Score: 92.8189 bits (229), Expect = 2.042e-18
Identity = 92/381 (24.15%), Postives = 158/381 (41.47%), Query Frame = 2
Query: 2000 EITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            ++T  Y   L  +   G+++ V   I D       +  +G T LH + K    ++ EL+LK    L     E+ LT +H+         +  L  + A+ N  +  G TAL++A        +     Y+      + I        LH A  + K +         ++LLL+             TPL LA+   H E    LL++GA+      +    +H     G +E   +L + +   P+     GLTP+  A    N+++   L++  A      + G T  H AA+K   +    LL +G +  +    G  PLH AA  G  ++  +LL   +   NVN  N +G T LHLAA  +   +  +L++  ++++
Sbjct:  336 DVTNDYLTALHVAAHCGHYK-VAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASL-QAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVR----YLLQNGAKVDIKAKDDQTALHIASRLGKAE--------IVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEA-AKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNA---NVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVD 698          

HSP 7 Score: 91.2781 bits (225), Expect = 7.494e-18
Identity = 99/405 (24.44%), Postives = 175/405 (43.21%), Query Frame = 2
Query: 1919 KDSSEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNY--PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            KD ++   +L +   N  ++ SK      T S    L  +   GN  +    ++ G  V +   ++  T LH + K  N  + +L+L +  ++  K  +  LT LH    S   + + +LL   A +     NG + L++A   ++L  ++ +  +       + + D + +Y   LH A     YK +        +++++   +   +     TPL +A   N V+ +E LLK+GA+        L  +H     G+  I  QL       PN T+  G T +  A       +V+ L++  AK+DI  +  +T  H A+  G  + ++LLL  G    +    G  PLH A   G++E A +LL   +++    +K   G T LH+AA         LL+ K
Sbjct:  178 KDDTKSAALLLQNDHNA-DVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAV-DFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD-GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHD------VPVDDVTNDYLTALHVAAHCGHYKVA--------KVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL-THHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKK---GFTPLHVAAKYGQIEAAKLLLQK 561          

HSP 8 Score: 90.1225 bits (222), Expect = 1.342e-17
Identity = 81/306 (26.47%), Postives = 131/306 (42.81%), Query Frame = 2
Query: 2219 TILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            T LHM   + + + +  LL+N A V+    + +TAL++A   + L   E +   +  K  +      SG  PLH A+     + +         LLLE    +    +   TPL +A     +EA + LL+  A   T     L  +H      N  +   L +     P+    NG TP+  A      +I   L+E  A+ + V + G +  H AA++G+   + LLL+   +      +G  PLH AA      +AE+LLN  +    V+    +G T LH+A    +  M   L+   +KIN
Sbjct:  442 TALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIA---SRLGKAEIVQ-LLLQKGAWASAATTSGYTPLHLAVREGHQETA--------SLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRV-ALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGA---EVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKIN 731          

HSP 9 Score: 89.7373 bits (221), Expect = 1.897e-17
Identity = 87/378 (23.02%), Postives = 156/378 (41.27%), Query Frame = 2
Query:  170 SMGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELIL--SVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            ++  +  L  ACK+   K ++ LL++   +  V + +  T +H      +E+ V+ +     +P   +T    G T LH+A+       +RYLL     ++ +  D +++L +A      E V+LL +  A  +    +G +P+H A +                                          +      L+E GA + +    G + LH A   G +E  ++LL   +   +T      T L  A  Y+N  V  LLL+ G++ +A         H A+ K  L+    L ++      +      PLH A+ +G  ++V  L+T      K  N +N  N NG T LHL+  +D + + ++LL +GA+
Sbjct:  371 ALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTE-SGLTPIHVAAFMGHENIVKQLTHHGASP---NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVR----------------------------------------EGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQK-RAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLT------KNAN-VNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAE 696          

HSP 10 Score: 80.4925 bits (197), Expect = 1.360e-14
Identity = 89/333 (26.73%), Postives = 147/333 (44.14%), Query Frame = 2
Query:  371 KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-DDYKFDLE------TTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
            +NG   LHLAS       +  LL     ++       ++L +A +    + V+ L  N A VN    NG +P++ AA+       EN LE++  LL+HGA          +PL  A+   +   +  L+E      +K    L  LH A    + +   +LL +D+  D+E      T   +  T L  A  Y N++V  LLL RG+ V+          H A+ +G+   +++L      +     D   PLH  +  GH ++VE L+    P       I  +  NG + LH++T  D+L   ++LLQ+    ++P+       +TAL +A
Sbjct:   38 QNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQ-------ENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEND----TKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAP-------ILSKTKNGLSPLHMATQGDHLNCVQLLLQH----DVPVDDVTNDYLTALHVA 348          

HSP 11 Score: 75.0998 bits (183), Expect = 5.663e-13
Identity = 93/368 (25.27%), Postives = 158/368 (42.93%), Query Frame = 2
Query: 2006 TESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFELI--LKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANF--------LTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            + S   YL A+ R GN E    ++  G +++ I +Q+G   LH + K   + E++  L K    V+   +   T LH+  ++ + + +  L+ N ANVN    NG T L +A   N+L  +  + ++   ++    I    G  PL  A++    +         + LLLE     + + +V    L +A   +  ++   LL+N  N          T        +H     GN+ +   L +      +    N +TP+  A    N  +VK L++  AK+D   + G T  H  A  G  + +E+LL  G    SK  +G  PLH A    +    ++LL     +++V    N   TALH+AA
Sbjct:    5 SRSNASYLRAA-RAGNLEKALDYLKTGVDIN-ICNQNGLNALHLASKEGHV-EVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQS----IATEDGFTPLAVALQQGHDQ--------VVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVAT-LLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDV---TNDYLTALHVAA 349          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 105.145 bits (261), Expect = 3.522e-22
Identity = 102/399 (25.56%), Postives = 178/399 (44.61%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDD-YKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI-----------TNMEPKEKILNFINHRNS---------------NGQTALHLSTVKDNLEICKILLQNGADPNIPLR 1309
            A K GN   VK LL+    + D +     T LH   +  +E  VE++L     +L +  KNG + LH+A+       ++ LL  +  ++   ND  ++L +A    + +  K++ +  A  N   +NG +P+H A K       +N ++++ +LLKHGA +  +     +P+  A    +   +K L   GA   + +  G + LH A   G  ++++ LL +  K D++  D    TAL  A      ++V+LLL++G+  +A  +      H A  +G  +   +L ++  +L         PLH A+  G  E  + L+           T + P     ++ N R +               NG T LH++  K+ LEI   LL+ GA+ N   R
Sbjct:  277 AAKRGNGNMVKLLLDRGAKI-DAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACK-------KNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQ--TALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTR 664          

HSP 2 Score: 102.064 bits (253), Expect = 3.040e-21
Identity = 95/354 (26.84%), Postives = 162/354 (45.76%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGA--NFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            L  + R G  ++V   + +G +V +I+ +  +T LH +  L   E+ +L+L+K     +    +  T LH+ +     E   LLL++ A+++     G T L++A  Y  + A + +      K         +G  PLH A      + ++        LLL+         +   TPL +A   N +E   TLL+ GA  N +TR  Q +  +H    EG++++ + L + +N + N+ + NGLTP+  A       + + L+   A++D   + G T  H A   G  K +  LL       SK   G  PLH+AA +G+  I  +LL   ++    NE   +G TAL +A
Sbjct:  472 LHMAARAGQADVVRYLLQNGAKV-DIKAKDDQTALHIASRLGKAEIVQLLLQKG-AWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL----LQKRAAPDTAGKTGLTPLHVAAHYDNQRVAL--------LLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTR--QGISPLHLAAQEGSVDLVS-LLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRAS---ANELTLNGNTALSIA 805          

HSP 3 Score: 101.293 bits (251), Expect = 5.976e-21
Identity = 92/334 (27.54%), Postives = 153/334 (45.81%), Query Frame = 2
Query:  359 DTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNN--CTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANK 1354
            DT  K     LH+A+      S   LL  + + +  +    + L +A  Y N     LL    A V+    N ++P+H AAK            ++ +LL  GA ID       +PL     S +   ++ L+++GA I SK  +GLS LH AT   +L  +Q+LL   + D+   D  N   TAL  A    +  V ++++++ +N NA+        H A  K  +K +++L ++  +L  +      P+H A++ GH  IV+ L  +           N  N  G+TALH++      ++ + LLQNGA  +I  +       TAL +A++
Sbjct:  198 DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAK-------RGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL---QHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASP-------NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAK----DDQTALHIASR 510          

HSP 4 Score: 98.5969 bits (244), Expect = 3.525e-20
Identity = 96/393 (24.43%), Postives = 182/393 (46.31%), Query Frame = 2
Query:  194 LKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAP--QLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYA------------------AKVK------AXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI-TNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            L+A + GN +K    L+   D+ ++ +      LH   K E  VE++  +      +D   K G T LH+AS+      +R L++   ++N ++ +  + L +A   ++ E V+ L E+ A  +I   +G +P+  A                   KV+      A  + + +   + +   H AD++    +  +PL  A    N+     L+ +GA +     + ++ LH A   GN  ++++LLD   K D +T D    T L       +  VVE+LL+RG+ + ++     +  H A+    L  +Q+L Q++V +  + ND    LH A++ GH ++ + ++     P  K L        NG T LH++  K+ +++ ++LL++GA
Sbjct:   48 LRAARAGNLEKALDYLKTGVDI-NICNQNGLNALHLASK-EGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGF--TPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD--GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKAL--------NGFTPLHIACKKNRVKVMELLLKHGA 426          

HSP 5 Score: 96.2857 bits (238), Expect = 1.976e-19
Identity = 91/348 (26.15%), Postives = 143/348 (41.09%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESC--VELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLS 1237
            A + G    V+ LL+N   V D++   D+T LH   +      V+L+L            +GYT LHLA       +   LL     ++       + L +A  Y   EA KLL +  A  +     G++P+H AA             +  +LL HGA          +PL  A   N L     L+E GA   +    G+S LH A   G+++++ +LL     ++   + N  T L  A   + V V E+LL  G+ V+A         H A   G++K +  L +    +         PLH+A+ +GH  I+  L+ +           N    NG TAL ++
Sbjct:  475 AARAGQADVVRYLLQNGAKV-DIKAKDDQTALHIASRLGKAEIVQLLLQKG-AWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYD-------NQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTK-NANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASA-------NELTLNGNTALSIA 805          

HSP 6 Score: 92.4337 bits (228), Expect = 2.875e-18
Identity = 92/381 (24.15%), Postives = 158/381 (41.47%), Query Frame = 2
Query: 2000 EITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            ++T  Y   L  +   G+++ V   I D       +  +G T LH + K    ++ EL+LK    L     E+ LT +H+         +  L  + A+ N  +  G TAL++A        +     Y+      + I        LH A  + K +         ++LLL+             TPL LA+   H E    LL++GA+      +    +H     G +E   +L + +   P+     GLTP+  A    N+++   L++  A      + G T  H AA+K   +    LL +G +  +    G  PLH AA  G  ++  +LL   +   NVN  N +G T LHLAA  +   +  +L++  ++++
Sbjct:  364 DVTNDYLTALHVAAHCGHYK-VAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASL-QAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVR----YLLQNGAKVDIKAKDDQTALHIASRLGKAE--------IVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEA-AKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNA---NVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVD 726          

HSP 7 Score: 90.1225 bits (222), Expect = 1.531e-17
Identity = 81/306 (26.47%), Postives = 131/306 (42.81%), Query Frame = 2
Query: 2219 TILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            T LHM   + + + +  LL+N A V+    + +TAL++A   + L   E +   +  K  +      SG  PLH A+     + +         LLLE    +    +   TPL +A     +EA + LL+  A   T     L  +H      N  +   L +     P+    NG TP+  A      +I   L+E  A+ + V + G +  H AA++G+   + LLL+   +      +G  PLH AA      +AE+LLN  +    V+    +G T LH+A    +  M   L+   +KIN
Sbjct:  470 TALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIA---SRLGKAEIVQ-LLLQKGAWASAATTSGYTPLHLAVREGHQETA--------SLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRV-ALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGA---EVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKIN 759          

HSP 8 Score: 89.3521 bits (220), Expect = 2.836e-17
Identity = 91/369 (24.66%), Postives = 161/369 (43.63%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNY--PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            L  +   GN  +    ++ G  V +   ++  T LH + K  N  + +L+L +  ++  K  +  LT LH    S   + + +LL   A +     NG + L++A   ++L  ++ +  +       + + D + +Y   LH A     YK +        +++++   +   +     TPL +A   N V+ +E LLK+GA+        L  +H     G+  I  QL       PN T+  G T +  A       +V+ L++  AK+DI  +  +T  H A+  G  + ++LLL  G    +    G  PLH A   G++E A +LL   +++    +K   G T LH+AA         LL+ K
Sbjct:  241 LHIAAHYGNINVATLLLNRGAAV-DFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD-GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHD------VPVDDVTNDYLTALHVAAHCGHYKVA--------KVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQL-THHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKK---GFTPLHVAAKYGQIEAAKLLLQK 589          

HSP 9 Score: 88.9669 bits (219), Expect = 2.934e-17
Identity = 92/380 (24.21%), Postives = 168/380 (44.21%), Query Frame = 2
Query:  170 SMGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELIL--SVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            ++  +  L  ACK+   K ++ LL++   +  V + +  T +H      +E+ V+ +     +P   +T    G T LH+A+       +RYLL     ++ +  D +++L +A      E V+LL +  A  +    +G +P+H A +       E   E  ++LL+HGA +        +PL  A     +   K L++K A   +   +GL+ LH A    N + + +LL D+         N  T L  A   N +++   LLE G+  NA   +  +  H A+ +G +  + +L   N N+   N +   PLH A+ +    + E L+ +          ++     G T LH++    N+++   LL+N A  N
Sbjct:  399 ALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTE-SGLTPIHVAAFMGHENIVKQLTHHGASP---NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVR-------EGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDN-QRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAE-------VDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKIN 759          

HSP 10 Score: 81.6481 bits (200), Expect = 5.650e-15
Identity = 88/327 (26.91%), Postives = 147/327 (44.95%), Query Frame = 2
Query:  371 KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-DDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA 1348
            +NG   LHLAS       +  LL     ++       ++L +A +    + V+ L  N A VN    NG +P++ AA+       EN LE++  LL+HGA          +PL  A+   +   +  L+E      +K    L  LH A    + +   +LL +D+  D+E+   +  T L  A  Y N++V  LLL RG+ V+          H A+ +G+   +++L      +     D   PLH  +  GH ++VE L+    P       I  +  NG + LH++T  D+L   ++LLQ+    ++P+       +TAL +A
Sbjct:   74 QNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQ-------ENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEND----TKGKVRLPALHIAARKDDTKSAALLLQNDHNADVES--KSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAP-------ILSKTKNGLSPLHMATQGDHLNCVQLLLQH----DVPVDDVTNDYLTALHVA 376          

HSP 11 Score: 79.7221 bits (195), Expect = 2.091e-14
Identity = 92/360 (25.56%), Postives = 158/360 (43.89%), Query Frame = 2
Query: 2006 TESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFELI--LKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            ++S   YL A+ R GN E    ++  G +++ I +Q+G   LH + K   + E++  L K    V+   +   T LH+  ++ + + +  L+ N ANVN    NG T L +A   N+L  +  + ++   ++    I    G  PL  A++    +         + LLLE     + + +V    L +A   +  ++   LL+N  N           +H     GN+ +   L +      +    N +TP+  A    N  +VK L++  AK+D   + G T  H  A  G  + +E+LL  G    SK  +G  PLH A    +    ++LL     +++V    N   TALH+AA
Sbjct:   41 SDSNASYLRAA-RAGNLEKALDYLKTGVDIN-ICNQNGLNALHLASKEGHV-EVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQS----IATEDGFTPLAVALQQGHDQ--------VVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVAT-LLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDV---TNDYLTALHVAA 377          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000016978.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Source:NCBI gene;Acc:103025232])

HSP 1 Score: 105.145 bits (261), Expect = 3.922e-22
Identity = 216/985 (21.93%), Postives = 366/985 (37.16%), Query Frame = 2
Query:  347 PQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDY-KFDLETTDSNNC-TALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNE----TKLLIVKFNGKSSDDLLK--TSTINXXXXXXXXXXXXXXXXXXXXXFDSAGEIDENQKKIDSDAEEINSTYEQILNTQDEIDLRNEEVDDA-HIQIHN---------TEEQVDDTHIQINDTEVQVDHTHIQINDKLEQIDSAE-INNSIETNNLKDTNEFDEVYWKETNQNFNNQLKTSELSPDFNNEPVKLTNSKKIKDSSEECQILPKFTENENEINSK-RQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQS--------GKT-LLHYSLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT-RDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNV--TDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKG---------------------AFKCLELLLSYG-VD-----------------PWSKC---HDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            P++  T E++G +++ +A      + +  LL       ++  D R++L +A  +   + VKLL                P+HYAA   A                 G+      L K         SN   ++           + D  G   L  A   GN+ II+ LL    +  L+T  + +  TAL   C   +V++ ++L+E G++++ ++ + +   H A+ +GD   L+  +Q   N    +     PLH  + +GH  +VE L       EK  + +  R  +G T LH+++   + E     L+ G    +PL + N      L  A K       K L++K  G   D   K   + ++  +                      G+  E    + +  +E     E +L +  E++   E  + A H+             TEE  D T         +V  T + +          E I NS+ +     + E  E+  ++ NQ+    L    L+ +  NE V        +D  E+  I+    E   +I +  RQ+ E    Y        R+GN  ++   + +   V   R QS        G++ LL  + +       +L +    V+ FDE  +  LH+       +   +LL + A VN     G T L+L+    +   +  +   +      +     S   PLH A      +  VC        LL +  DI   D   +TPL LA   +H E V+  LK+     T   ++     H   ++G++ +  +L  F         +  NG  P+  A +  + ++VK L+E  A     D  G T  H AA  G                         L +  S+G VD                 P        DG  PLH AA  G++ +  +LLN+P  ++   E ++ G T LHLAA
Sbjct:   39 PEICQTDEESGLSLMMIAVRENRLSIVERLLELGVSPAEKAKDGRTALHIAAAHSKDDLVKLLARKVDPNAPGGPKAQLPLHYAASRPA-----------------GSPAVVQTLLK--------LSNKEARL-----------TADKDGCIPLLLAVEAGNVGIIKELLSGQTEPQLQTQRTGHGDTALHICCRKKDVEMAKVLVELGASMDFQNVEGQTPLHIAAWEGDEAMLKFFYQSKANPNISDKLDRSPLHITAERGHTNVVEIL------TEKFKSNVLARTKDGSTLLHIASQCGHPETALTFLKKG----VPLHMPNKSGAVCLHAAAKRGHTAVVKALLLK--GAHVDATTKDGQTALHIAVQNCKPQVVQMLLGFGAQVQLRGGKDLETPLHVAARVKEGEKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLT------WRSKVGETPLHVAVHHCHAHMVEAILNSLSSER---SREEAELCVRQENQSGETAL---HLAAELKNETVH-------RD-EEDVVIIRTLMEYNADITAATRQMGETPLHY------CARVGNAAVLQEMLDN---VPSSRLQSAINKHSKNGRSPLLLAAERGHTAVVRVLLENSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFVNAKTKLGLTPLHLSAQSGSARLVRLL---VETHQACVDALSLSKQTPLHLA--AISGQLDVCSN------LLNLRADITATDIHGQTPLHLAAENDHSEVVKLFLKHRPELATLASVEGATCTHIAAAKGSVAVIRELLKFSQGGLTTLHSKANGSCPLHLAAAGGHTEVVKVLLEAGASAAEEDSEGMTAVHLAARSGHTHILVVLKASVPLKIISSKTGLTALHVAASFGQVDFVREILTRVSAAIRSELPAGSAGISRDGYTPLHLAAQSGHESVVRLLLNSP-GVQADAETDSEGSTPLHLAA 934          

HSP 2 Score: 82.8037 bits (203), Expect = 2.127e-15
Identity = 103/435 (23.68%), Postives = 184/435 (42.30%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN--KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLP-LLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPL-----------------HYAIEICKYKKSVC------QCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANF--LTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-------NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPDCKNTLKTF 3226
            L A+ + G+  +V + +  G  V +   + G+T LH +++N   ++ +++L    ++  +  +   T LH+    KE E++  +LLK+ A VN    NG TA+++A  Y  L  +  + +   D T   ++    G  PL                   + E  + +  +C        +T + L  E+  +   RD               V  + TL++  A+    TR +     +HY    GN  +  ++   +N          N    NG +P+  A    +  +V+ L+E +A++D+ D+ G    H AAE+G     ++LLS+     +K   G  PLH +A  G   +  +L+ T  A   V+  + S QT LHLAA+     +C  L++  + I       +D    T   LA   D    +K F
Sbjct:  325 LHAAAKRGHTAVVKALLLKGAHV-DATTKDGQTALHIAVQNCKPQVVQMLLGFGAQVQLRGGKDLETPLHVAARVKEGEKVAEMLLKSGAEVNAEQENGETAMHVAARYGALQMMRALTEEGADLTWRSKV----GETPLHVAVHHCHAHMVEAILNSLSSERSREEAELCVRQENQSGETALHLAAELKNETVHRDE------------EDVVIIRTLMEYNADITAATRQMGE-TPLHYCARVGNAAVLQEM--LDNVPSSRLQSAINKHSKNGRSPLLLAAERGHTAVVRVLLENSARVDVFDEEGIAALHLAAEQGHDDIADILLSHKAFVNAKTKLGLTPLHLSAQSGSARLVRLLVETHQAC--VDALSLSKQTPLHLAAISGQLDVCSNLLNLRADI-----TATDIHGQTPLHLAAENDHSEVVKLF 732          

HSP 3 Score: 75.0998 bits (183), Expect = 5.805e-13
Identity = 108/442 (24.43%), Postives = 180/442 (40.72%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPD-INKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAK----------VKAXXXXXXXXXXXXXXXKHGADIDG-----LDLYKRS---------------PLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLK-NLQVLHQYNVNLW----------KLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKF 1384
            LL A + G+   V+ LLEN   V DV D      LH   +  ++   +++LS     ++   K G T LHL++       +R L+  +   ++  +   ++ L LA I    +    L    A++  TD++G +P+H AA+          +K   E      +      H A   G      +L K S               PL  A    +   +K L+E GA    +DS G++ +H A  +G+  I+ +L       +  +     TAL  A S+  VD V  +L R S     +    +A     G   L    Q  H+  V L           + +++ + PLH A+  GH  +V  L++       +      R+  G+T LHL++   ++   ++LL  GAD N     ++    TAL  A K    L +V+F
Sbjct:  584 LLLAAERGHTAVVRVLLENSARV-DVFDEEGIAALHLAAEQGHDDIADILLS-HKAFVNAKTKLGLTPLHLSAQSGSARLVRLLVETHQACVDALSLSKQTPLHLAAISGQLDVCSNLLNLRADITATDIHGQTPLHLAAENDHSEVVKLFLKHRPELATLASVEGATCTHIAAAKGSVAVIRELLKFSQGGLTTLHSKANGSCPLHLAAAGGHTEVVKVLLEAGASAAEEDSEGMTAVHLAARSGHTHILVVLKASVPLKI-ISSKTGLTALHVAASFGQVDFVREILTRVSAAIRSELPAGSAGISRDGYTPLHLAAQSGHESVVRLLLNSPGVQADAETDSEGSTPLHLAACNGHTAVVGLLLSKSASLLHL------RDRRGRTCLHLASANGHVATVRVLLGQGADIN----QTDKSGCTALHYAGKAGC-LEVVRF 1011          

HSP 4 Score: 74.3294 bits (181), Expect = 9.883e-13
Identity = 96/411 (23.36%), Postives = 171/411 (41.61%), Query Frame = 2
Query: 2117 GKTLLHYSLKN--KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRT-PLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP--NVTDPNGLTPIFYAVSNCNEKIVKRLI---------ELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLL-SYGVDPWSKC-HDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPDCKNTLKTF--GGRSAKKVINCSNSELDYSTQYN 3295
            G T LH S ++    L  L+++     V+    +  T LH+  +S +++    LL   A++   D +G+T L+LA   ++    E +  ++  +     +    G    H    I   K SV   +  ++      G      + + + PL LA    H E V+ LL+ GA+    D + + +VH     G+  I   L V +   P   ++   GLT +  A S      V+ ++         EL A    + + G T  H AA+ G    + LLL S GV   ++   +G+ PLH AA  G+  +  + L    +   ++ ++  G+T LHLA+         +L+ + + IN+     +D    TA   A    C   ++     G S +   +   + L Y+ + N
Sbjct:  646 GLTPLHLSAQSGSARLVRLLVETHQACVDALSLSKQTPLHLAAISGQLDVCSNLLNLRADITATDIHGQTPLHLAAENDHS---EVVKLFLKHRPELATLASVEGATCTH----IAAAKGSVAVIRELLKF--SQGGLTTLHSKANGSCPLHLAAAGGHTEVVKVLLEAGASAAEEDSEGMTAVHLAARSGHTHI---LVVLKASVPLKIISSKTGLTALHVAASFGQVDFVREILTRVSAAIRSELPAGSAGISRDGYTPLHLAAQSGHESVVRLLLNSPGVQADAETDSEGSTPLHLAACNGHTAV--VGLLLSKSASLLHLRDRRGRTCLHLASANGHVATVRVLLGQGADINQ-----TDKSGCTALHYAGKAGCLEVVRFLVESGASTRSECSAGRTPLQYTAEEN 1037          

HSP 5 Score: 66.2402 bits (160), Expect = 2.432e-10
Identity = 101/443 (22.80%), Postives = 180/443 (40.63%), Query Frame = 2
Query: 2090 EVSEIRDQSGKTLLHYSLKNKEL-----FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGN----YPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECR---DRVSRTPLLLAINVNHVEAVETLLKNGANF---LTRDIQNLCSVHYVCSEGNLE---IFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLL-SYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPDCKNTLKTFGGRSAKKVINCSNSELDYSTQYNAEVELVPQVNGYDISAPVSIRS 3361
            E S I   S + LL   L+ + +      + + K  PE+    +E+ L+++ + +    +  +  LL+   +      +GRTAL++A  ++        +D +    R +  P+  G      PLHYA        +V Q       LL+++ + E R   D+    PLLLA+   +V  ++ LL           R      ++H  C + ++E   +  +L    +F  NV    G TP+  A    +E ++K   +  A  +I D+  R+  H  AE+G    +E+L   +  +  ++  DG+  LH A+  G+ E A   L     +   +  N SG   LH AA R    +   L+ K + ++                 ATT D +  L          V NC    +     + A+V+L     G D+  P+ + +
Sbjct:    3 ESSGISPGSSQRLLQLCLRGEWVALEQNLKSLEKGDPEICQTDEESGLSLMMIAVRENRLSIVERLLELGVSPAEKAKDGRTALHIAAAHSK-------DDLVKLLARKVD-PNAPGGPKAQLPLHYAASRPAGSPAVVQT------LLKLS-NKEARLTADKDGCIPLLLAVEAGNVGIIKELLSGQTEPQLQTQRTGHGDTALHICCRKKDVEMAKVLVELGASMDFQ-NV---EGQTPLHIAAWEGDEAMLKFFYQSKANPNISDKLDRSPLHITAERGHTNVVEILTEKFKSNVLARTKDGSTLLHIASQCGHPETALTFLKKGVPL---HMPNKSGAVCLHAAAKRGHTAVVKALLLKGAHVD-----------------ATTKDGQTALHI-------AVQNCKPQVVQMLLGFGAQVQL---RGGKDLETPLHVAA 396          

HSP 6 Score: 59.6918 bits (143), Expect = 3.014e-8
Identity = 77/330 (23.33%), Postives = 140/330 (42.42%), Query Frame = 2
Query:  239 LENCTDVGDVR------DLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPD----INKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAK---------VKAXXXXXXXXXXXXXXXKH-GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLET-TDSNNCTAL-MYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI 1156
            L+ C+++ ++R      D+  +T LH   +  +   V+L L   P+L       G T  H+A+       +R LL  +      ++ + N S   L LA    + E VK+L E  A     D  G++ +H AA+         +KA +  +       +   H  A    +D  +       + +     ++  +  G+   S+D  G + LH A  +G+  ++++LL+      +  TDS   T L + AC+ +   V  LL +  S ++  D + R   H AS  G +  ++VL     ++ + +      LH A   G  E+V FL+
Sbjct:  693 LDVCSNLLNLRADITATDIHGQTPLHLAAENDHSEVVKLFLKHRPELATLASVEGATCTHIAAAKGSVAVIRELLKFSQGGLTTLHSKANGS-CPLHLAAAGGHTEVVKVLLEAGASAAEEDSEGMTAVHLAARSGHTHILVVLKASVPLKIISSKTGLTALHVAASFGQVDFVRE------ILTRVSAAIRSELPAGSAGISRD--GYTPLHLAAQSGHESVVRLLLNSPGVQADAETDSEGSTPLHLAACNGHTAVVGLLLSKSASLLHLRDRRGRTCLHLASANGHVATVRVLLGQGADINQTDKSGCTALHYAGKAGCLEVVRFLV 1013          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 1.205e-26
Identity = 107/405 (26.42%), Postives = 190/405 (46.91%), Query Frame = 2
Query: 1919 KDSSEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNY--PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            KD +    +L +  E+  ++ SK  + + TES    L  +   GN  +    ++ G  V +   ++G T LH + K  N  + +L+L +  ++  K  +  LT LH    S   + + +LL+ +A +     NG + L++A    +LA ++ +        R   + D + +Y  PLH A     Y+ +        +LLL+  G+   R     TPL +A   N ++ +E LLK+GA+  T     L  +H     G+L +  QL +      N T+  G TP+  A      ++VK L++  A++ +  +  +T  H A+  G  + ++LLL  G DP +    G+ PL+ A+  G+ ++A +LL   + I  V +K   G T LH+A+      +  LL+ K
Sbjct:  181 KDDTNAAALLLQH-EHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAV-DFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD-GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL------LGRQAPVDDVTLDYLTPLHVAAHCGHYRVA--------KLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVV-QLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKK---GFTPLHIASKYGRLEVATLLLEK 564          

HSP 2 Score: 113.235 bits (282), Expect = 1.444e-25
Identity = 111/398 (27.89%), Postives = 185/398 (46.48%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSV-APQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNMEPKEK-------ILNFINHRN----------------SNGQTALHLSTVKDNLEICKILLQNGADPNI 1300
            A K GNN  VK LL+    + D +     T LH   +  +E  +E++L   AP L  T  KNG + LH+A+  +    ++ LL +   ++    D  + L +A    +    KLL +   E N   +NG +P+H A K       +N ++++ +LLKHGA I        +P+  A    +L  ++ L++ GA   + +  G + LH A+  G LE+++ LL      +      + T L  A      ++V+LLL+RGS+ NA  +      +FAS  G GD+ +L  L +   ++  +      PLH AS  G  E+   L+    + +PK K       +    +H+                  NG T LH++  K+ LE+ K+LL+ GA+ N+
Sbjct:  252 AAKRGNNNMVKLLLDRGAKI-DTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKT--KNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACK-------KNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQS-GARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASL--LLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNM 636          

HSP 3 Score: 106.301 bits (264), Expect = 2.261e-23
Identity = 97/382 (25.39%), Postives = 163/382 (42.67%), Query Frame = 2
Query: 2000 EITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQL-AVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            ++T  Y   L  +   G++ +    +  GGE    R  +G T LH + K   +   EL+LK     ++   E+ LT +H+      +  + LLL+N A+ N  +  G T L++A   +    LE +   +    R + +       PLH A  + K +         ++LLL+   D         TPL  A    H +    LL+NGA+      +    +H     G LE+   L   + + DP     NGLTP+  A    ++K+   L++  A      + G T  H AA+K   +  ++LL  G +       G  PLH AA  G+ ++  +LL   ++I    +    G TA+HLAA  +   +  +L    + +N
Sbjct:  339 DVTLDYLTPLHVAAHCGHYRVAKLLLDRGGE-PNARALNGFTPLHIACKKNRIKVMELLLKHGAS-IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMA---SRAGQLEVVKTLLQSGAR-VGVKAREDQTPLHIASRLGKAE--------IVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPK--GKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK---GGLTAMHLAAQEDKVNVAEILTKHKADVN 701          

HSP 4 Score: 103.99 bits (258), Expect = 1.098e-22
Identity = 112/396 (28.28%), Postives = 169/396 (42.68%), Query Frame = 2
Query:  170 SMGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSK--NPDI------NKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL------DDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLR 1309
            S   +  L  A +E + + VK LL+N  +   V      T L    +  +E  V L+L       DT  K     LH+A+      +   LL    N D+      N+      + L +A  Y N     LL    A V+ T  NG++P+H AAK            ++ +LL  GA ID       +PL  A  S +   ++ L+E+ A I +K  +GLS LH AT   +L  +Q+LL      DD   D         T L  A    +  V +LLL+RG   NA         H A  K  +K +++L ++  ++         P+H AS+ GH  +V+ L+ N           N  N  G+T LH+++    LE+ K LLQ+GA   +  R
Sbjct:  106 SQNGFTPLYMAAQENHLEIVKFLLDNGANQ-SVATEDGFTPLAVALQQGHEQVVGLLLES-----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAK-------RGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDY-------LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASS-------NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAR 474          

HSP 5 Score: 98.2117 bits (243), Expect = 7.194e-21
Identity = 91/363 (25.07%), Postives = 168/363 (46.28%), Query Frame = 2
Query:  287 TLLHYCFKYESCVELILSVAPQLLDTGE------KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLIT-NMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANK 1354
            T LH    Y +     ++VA  LL+ G       +NG T LH+A+       ++ LL +   I+ +  D  + L  A    + + +++L E +A +     NG+SP+H A + +     +  L          A +D + L   +PL  A    +    K L+++G    ++  +G + LH A     ++++++LL  +   + TT  +  T +  A    +++VV+LLL+ G++ NA + +     H AS  G L+ ++ L Q    +     +   PLH AS  G  EIV+ L+    +P        N   ++G T L+ ++ + + ++  +LL+NGAD    +     K  T L +A+K
Sbjct:  214 TPLHIAAHYGN-----MNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQ-------APVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLK-HGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP--------NAPTASGSTPLYFASREGHGDVASLLLENGAD----ISPVTKKGFTPLHIASK 551          

HSP 6 Score: 85.1149 bits (209), Expect = 6.670e-17
Identity = 82/327 (25.08%), Postives = 139/327 (42.51%), Query Frame = 2
Query:  335 LSVAPQLLDTGEKNGY------TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            L V   LL +G + G       T LH+AS +     ++ LL +  D N       + L  A    + +   LL EN A+++     G +P+H A+K          LE        G +  GL     +PL  A   ++      L++KGA  +S   +G + LH A     LE+ ++LL+    +           L  A    + D+V LLL R ++++        A H A+ +  +   ++L ++  ++         PLH AS+ G+ ++V FL+ N          +N +  NG T LH +  + +  +   LLQ+ A PN
Sbjct:  456 LEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKN--GL-----TPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLE-LGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA-------LVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPN 767          

HSP 7 Score: 77.7962 bits (190), Expect = 1.303e-14
Identity = 82/336 (24.40%), Postives = 134/336 (39.88%), Query Frame = 2
Query: 2252 IERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITD---KTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLA------------------------------------VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINEL 3142
            +ERL   LK   ++N  + NG  AL+LA       + E   D +T+   +   I      GN  LH A        ++      + +L+E   +I  + +   TPL +A   NH+E V+ LL NGAN           +     +G+ ++   L                                     V      N T  +G TP+  A    N  +   L+ L A +D   + G T  H AA++G    ++LLL  G    +K  DG  PLH AA  G++++ E+LL   + I     K  +G + LH+A          LL+ + + ++++
Sbjct:   23 LERLMDHLKGGMDINTCNQNGLNALHLA-------SKEGHVDVVTELLKREAEIDTATKVGNTALHIA--------ALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPIL---AKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDV 340          

HSP 8 Score: 73.1738 bits (178), Expect = 3.681e-13
Identity = 95/359 (26.46%), Postives = 152/359 (42.34%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESC--VELILS--------------------------VAPQLLDTGE------KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFL-ITNMEP 1171
            A + G  + VK LL++   VG V+   D+T LH   +      V+L+L                           VA  LL+ G       K G+T LH+AS          LL K    + +  +  + L +A  YD+ +   LL +  A  + T  NG +P+H AAK       +N+LE+  +LL+ GA+ + L     +PL  A    +   +  L+ + A I      GL+ +H A     + + + +L  +K D+ TT     T L  A  Y N+ +V  LL   + VNA+        H A+ +G    +  L Q+  +  +L  + N  L  A   G+  +V+ L I   EP
Sbjct:  450 ASRAGQLEVVKTLLQSGARVG-VKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAK-------KNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAE-ILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILTEEP 799          

HSP 9 Score: 61.2326 bits (147), Expect = 1.380e-9
Identity = 75/316 (23.73%), Postives = 129/316 (40.82%), Query Frame = 2
Query:  437 LSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-------------------DDY-----------------KFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILL 1276
            L    DIN  N +  ++L LA    + + V  L +  AE++     G + +H AA          + +I+ +L++ GA+I+       +PL  A   N+L  +K L++ GA        G + L  A   G+ +++ +LL                   DD                  K  L  T  +  T L  A  Y N++V  LLL  G+ V+          H A+ +G+   +++L      +     D   PLH A+  GH +++E L+    P       I  +  NG + LH++T  ++L   ++LL
Sbjct:   30 LKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAA-------LAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAP-------ILAKTKNGLSPLHMATQGEHLACVQLLL 331          

HSP 10 Score: 61.2326 bits (147), Expect = 1.541e-9
Identity = 77/328 (23.48%), Postives = 136/328 (41.46%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            L  + R+G  EIV   +  G +       SG T L+++ +  + ++  L+L+   + ++   +   T LH+      +E   LLL+  A+ +    NG T L++A  Y++    + +   + DK         +G  PLH A      KK+  +     ++LLE+  +     +    PL LA    H + V  LL   A+        L ++H    E  + +  ++      D N T     TP+  A    N K+V  L+   A ++   + G T  H+AA++G    +  LL +   P     +G   L  A   GY  + + L
Sbjct:  480 LHIASRLGKAEIVQLLLQRGSD-PNAPTASGSTPLYFASREGHGDVASLLLENGAD-ISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDH----QKVALLLLDKGASPHSTAKNGYTPLHIAA-----KKNQLEVG---KVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVA-EILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 11 Score: 60.077 bits (144), Expect = 3.693e-9
Identity = 74/281 (26.33%), Postives = 131/281 (46.62%), Query Frame = 2
Query:  470 NDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVL--HQYNVNL---WKLNN--DSNY-PLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            +D+ +S L A    N E +    +   ++N  + NG++ +H A+K       E  ++++  LLK  A+ID       + L  A  +     ++ L+E GA I ++  +G + L+ A    +LEI++ LLD+       T+ +  T L  A    +  VV LLLE     + +   R  A H A+ K D     +L  H++N ++     LN   +S + PLH A++ G+  +   L+        +   ++    NG T LH++  + N  + K+LL  GA
Sbjct:    8 SDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASK-------EGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATE-DGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLL-------NLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGA 269          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 2.224e-25
Identity = 98/382 (25.65%), Postives = 164/382 (42.93%), Query Frame = 2
Query: 2000 EITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLA-VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            ++T  Y   L  +   G++ +    +  GGE    R  +G T LH + K   +   EL+LK     ++   E+ LT +H+      +  + LLL+N A+ N  +  G T L++A   +    LE +   +    R + +       PLH A  + K +         ++LLL+   D         TPL  A    H +    LL+NGA+      +    +H     G LE+   L   + + DP V   NGLTP+  A    ++K+   L++  A      + G T  H AA+K   +  ++LL  G +       G  PLH AA  G+ ++  +LL   ++I    +    G TA+HLAA  +   +  +L    + +N
Sbjct:  332 DVTLDYLTPLHVAAHCGHYRVAKLLLDRGGE-PNARALNGFTPLHIACKKNRIKVMELLLKHGAS-IHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMA---SRAGQLEVVKTLLQSGAR-VGVKAREDQTPLHIASRLGKAE--------IVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATK---GGLTAMHLAAQEDKVNVAEILTKHKADVN 696          

HSP 2 Score: 110.923 bits (276), Expect = 7.783e-25
Identity = 110/400 (27.50%), Postives = 186/400 (46.50%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSV-APQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNMEPK------------------EKILNFINHRNS-------NGQTALHLSTVKDNLEICKILLQNGADPNI 1300
            A K GNN  VK LL+    + D +     T LH   +  +E  +E++L   AP L  T  KNG + LH+A+  +    ++ LL +   ++    D  + L +A    +    KLL +   E N   +NG +P+H A K       +N ++++ +LLKHGA I        +P+  A    +L  ++ L++ GA   + +  G + LH A+  G LE+++ LL      +      + T L  A      ++V+LLL+RGS+ NA  +      +FAS  G GD+ +L  L +   ++  +      PLH AS  G  E+   L+    + +PK                  +K+   +  + +       NG T LH++  K+ LE+ K+LL+ GA+ N+
Sbjct:  245 AAKRGNNNMVKLLLDRGAKI-DTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKT--KNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACK-------KNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQS-GARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASL--LLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNM 631          

HSP 3 Score: 108.612 bits (270), Expect = 3.737e-24
Identity = 98/369 (26.56%), Postives = 173/369 (46.88%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLK--NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNY--PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISK 3121
            L  +   GN  +    ++ G  V +   ++G T LH + K  N  + +L+L +  ++  K  +  LT LH    S   + + +LL+ +A +     NG + L++A    +LA ++ +        R   + D + +Y  PLH A     Y+ +        +LLL+  G+   R     TPL +A   N ++ +E LLK+GA+  T     L  +H     G+L +  QL +      N T+  G TP+  A      ++VK L++  A++ +  +  +T  H A+  G  + ++LLL  G DP +    G+ PL+ A+  G+ ++A +LL   + I  V +K   G T LH+A+      +  LL+ K
Sbjct:  209 LHIAAHYGNMNVATLLLNLGAAV-DFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRD-GLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL------LGRQAPVDDVTLDYLTPLHVAAHCGHYRVA--------KLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVV-QLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKK---GFTPLHIASKYGRLEVATLLLEK 557          

HSP 4 Score: 106.686 bits (265), Expect = 1.703e-23
Identity = 109/388 (28.09%), Postives = 167/388 (43.04%), Query Frame = 2
Query:  170 SMGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL------DDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLR 1309
            S   +  L  A +E + + VK LL+N  +   V      T L    +  +E  V L+L       DT  K     LH+A+      +   LL    + +  +    + L +A  Y N     LL    A V+ T  NG++P+H AAK            ++ +LL  GA ID       +PL  A  S +   ++ L+E+ A I +K  +GLS LH AT   +L  +Q+LL      DD   D         T L  A    +  V +LLL+RG   NA         H A  K  +K +++L ++  ++         P+H AS+ GH  +V+ L+ N           N  N  G+T LH+++    LE+ K LLQ+GA   +  R
Sbjct:  107 SQNGFTPLYMAAQENHLEIVKFLLDNGANQ-SVATEDGFTPLAVALQQGHEQVVGLLLES-----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAK-------RGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDY-------LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASS-------NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAR 467          

HSP 5 Score: 99.7525 bits (247), Expect = 1.935e-21
Identity = 93/371 (25.07%), Postives = 171/371 (46.09%), Query Frame = 2
Query:  263 DVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGE------KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLIT-NMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANK 1354
            DV   +  T LH    Y +     ++VA  LL+ G       +NG T LH+A+       ++ LL +   I+ +  D  + L  A    + + +++L E +A +     NG+SP+H A + +     +  L          A +D + L   +PL  A    +    K L+++G    ++  +G + LH A     ++++++LL  +   + TT  +  T +  A    +++VV+LLL+ G++ NA + +     H AS  G L+ ++ L Q    +     +   PLH AS  G  EIV+ L+    +P        N   ++G T L+ ++ + + ++  +LL+NGAD    +     K  T L +A+K
Sbjct:  199 DVTSKSGFTPLHIAAHYGN-----MNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQ-------APVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLK-HGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP--------NAPTASGSTPLYFASREGHGDVASLLLENGAD----ISPVTKKGFTPLHIASK 544          

HSP 6 Score: 99.3673 bits (246), Expect = 3.019e-21
Identity = 99/375 (26.40%), Postives = 165/375 (44.00%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYK-FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            Y+  L       + +V KLL +     + R L   T LH   K      +EL+L     +  T E +G T +H+AS +     ++ LL      N  N    + L +A      E VK L ++ A V +      +P+H A+++        + EI+ +LL+ G+D +       +PL +A    +      L+E GA I      G + LH A+  G LE+  +LL+ Y   D +    N  T L  A  Y++  V  LLL++G++ ++         H A+ K  L+  +VL +       L      PLH A+ +GH ++V  L+            I+     G TA+HL+  +D + + +IL ++ AD N
Sbjct:  337 YLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTE-SGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLG-------KAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHAS-------ISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVN 696          

HSP 7 Score: 91.6633 bits (226), Expect = 7.150e-19
Identity = 99/404 (24.50%), Postives = 181/404 (44.80%), Query Frame = 2
Query:  167 FSMGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTL--LHYCFKYESCVELILSVAPQL--LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYA------------------AKVK------AXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI-TNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            F   +    L+A + GN   +++L+++     D+       L  LH   K E  V+++  +  +   +DT  K G T LH+A++      +R L+    +IN ++ +  + L +A   ++ E VK L +N A  ++   +G +P+  A                   KV+      A  + +     + +  +H AD+     +  +PL  A    N+     L+  GA +     +G++ LH A   GN  ++++LLD   K D +T D    T L  A    +  V+E+LLER + + A+     +  H A+    L  +Q+L      +  +  D   PLH A++ GH  + + L+    EP        N R  NG T LH++  K+ +++ ++LL++GA
Sbjct:    7 FQSDAATSFLRAARNGN---LERLMDHLKGGMDINTCNQNGLNALHLASK-EGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGF--TPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDG--LTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEP--------NARALNGFTPLHIACKKNRIKVMELLLKHGA 394          

HSP 8 Score: 87.4261 bits (215), Expect = 1.491e-17
Identity = 82/327 (25.08%), Postives = 139/327 (42.51%), Query Frame = 2
Query:  335 LSVAPQLLDTGEKNGY------TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            L V   LL +G + G       T LH+AS +     ++ LL +  D N       + L  A    + +   LL EN A+++     G +P+H A+K          LE         A  +GL     +PL  A   ++      L++KGA  +S   +G + LH A     LE+ ++LL+    +           L  A    + D+V LLL R ++++        A H A+ +  +   ++L ++  ++         PLH AS+ G+ ++V FL+ N          +N +  NG T LH +  + +  +   LLQ+ A PN
Sbjct:  449 LEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGL-----TPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLE-LGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRA-------LVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPN 762          

HSP 9 Score: 82.8037 bits (203), Expect = 4.040e-16
Identity = 81/328 (24.70%), Postives = 136/328 (41.46%), Query Frame = 2
Query: 2252 IERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITD---KTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFN----------------------------QLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINEL 3142
            +ERL   LK   ++N  + NG  AL+LA       + E   D +T+   +   I      GN  LH A        ++      + +L+E   +I  + +   TPL +A   NH+E V+ LL NGAN           +     +G+ ++                               L +    + +VT  +G TP+  A    N  +   L+ L A +D   + G T  H AA++G    ++LLL  G    +K  DG  PLH AA  G++++ E+LL   + I     K  +G + LH+A          LL+ + + ++++
Sbjct:   24 LERLMDHLKGGMDINTCNQNGLNALHLA-------SKEGHVDVVTELLKREAEIDTATKVGNTALHIA--------ALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPIL---AKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDV 333          

HSP 10 Score: 69.3218 bits (168), Expect = 4.403e-12
Identity = 97/363 (26.72%), Postives = 154/363 (42.42%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESC--VELILS--------------------------VAPQLLDTGE------KNGYTVLHLASMIKPPTSLRYLLSK----NPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFL-ITNMEP 1171
            A + G  + VK LL++   VG V+   D+T LH   +      V+L+L                           VA  LL+ G       K G+T LH+AS          LL K    +P +  +N    + L +A  YD+ +   LL +  A  + T  NG +P+H AAK       +N+LE+  +LL+ GA+ + L     +PL  A    +   +  L+ + A I      GL+ +H A     + + + +L  +K D+ TT     T L  A  Y N+ +V  LL   + VNA+        H A+ +G    +  L Q+  +  +L  + N  L  A   G+  +V+ L I   EP
Sbjct:  443 ASRAGQLEVVKTLLQSGARVG-VKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQN--GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAK-------KNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAE-ILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILTEEP 794          

HSP 11 Score: 60.077 bits (144), Expect = 3.391e-9
Identity = 85/363 (23.42%), Postives = 143/363 (39.39%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNL-AALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGA--NFLTRDIQNLCSVHYVCSEGNLEIFN--------------------QLAVFEN------------FDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            L  + R G  E+V + +  G  V  ++ +  +T LH +  L   E+ +L+L++  +  N    +  T L+        +   LLL+N A+++     G T L++A  Y  L  A   +  Y +   +   +   +G  PLH A      K ++        LLL+         +   TPL +A   N +E  + LL+ GA  N LT+  Q +  +H    EG+ ++                       LA  E+             D N T     TP+  A    N K+V  L+   A ++   + G T  H+AA++G    +  LL +   P     +G   L  A   GY  + + L
Sbjct:  440 LHMASRAGQLEVVKTLLQSGARVG-VKAREDQTPLHIASRLGKAEIVQLLLQRGSD-PNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPK---VAGQNGLTPLHVATHYDHQKVAL--------LLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQ--QGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 12 Score: 58.5362 bits (140), Expect = 1.041e-8
Identity = 60/259 (23.17%), Postives = 111/259 (42.86%), Query Frame = 2
Query:  707 LMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI---TNMEPKEKILNFINHRN-------------------SNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI---VKFNGKSSDDL 1408
             + A  + NL ++   ++ G  I + + +GL+ LH A+  G+++++  LL   + +++T      TAL  A      D+V +L+E G+N+NA+        + A+ +  L+ ++ L     N      D   PL  A  +GH ++V  L+   T  + +   L+    ++                    +G T LH++    N+ +  +LL  GA  +   R        A    N N  KLL+    K + K+ D L
Sbjct:   15 FLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLK-REAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGL 272          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: invs (inversin [Source:NCBI gene;Acc:245946])

HSP 1 Score: 103.99 bits (258), Expect = 6.174e-23
Identity = 88/341 (25.81%), Postives = 155/341 (45.45%), Query Frame = 2
Query:  377 GYTVLHLASMIKPPTSLRYLLS--KNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC-IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGD----LKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN--------------------MEPKEKILNFINHR------NSNGQTALHLSTVKDNLEICKILLQNGADPNI 1300
            G T LHLA+  + P  L  LL   +  +++ ++N  R++L  +  Y++PE V++L ++++ + + D  G  P+H+AA  K          ++       + ++  D   R+PL +AV   N   +  L     C + + D+   + LH+A   G+ +I+ +LL+        +DS   T L YA   N+ + VE+ L   S  +  D +RR A  +A+GKG        L+++   +VNL   +      LH A+  GH   V  L+ +                    M  KE I   I         + +G + LH + +  N +IC IL++NG  P++
Sbjct:  111 GMTGLHLATRHETPRCLALLLKHIEPGEVDVQDNQKRTALHWSAYYNHPEHVRMLIKHDSNIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPT-DSILNWQDYEGRTPLHFAVADGNEAVVDILTSPQVCNVTAYDNLFRTSLHWAALLGHAKIVHLLLERNSSGTIPSDSQGATPLHYAAQSNHAETVEVFLSHPSVHDEPDLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNL--ADKYGGTALHAAALSGHVSTVRLLLAHGAQVDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQDGHSPLHWAALGGNADICLILIRNGIHPDV 448          

HSP 2 Score: 92.4337 bits (228), Expect = 2.222e-19
Identity = 114/492 (23.17%), Postives = 194/492 (39.43%), Query Frame = 2
Query: 1808 EVYWKETNQNFNNQLKTSELSPDFNNEPVKLTNSK----KIKDSSEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKT-PELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYI--TDKTRFIQIPDNSGNYPLHYAIEICK-------YKKSVCQCKTY-------------------MELLLEMN--GDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFN-QLAVFENFDPNVTDPNG---------------------------------LTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALH 3070
            +V+    N + +   K    +P+F + P +   +      + D  E  + L K   N N+ +         +S +  L  + + GN+ I+   +     + + +D  G T LH + +++      L+LK   P  V+  D    T LH        E + +L+K+++N+  PD  G+  L+ A    + +A+  +   +  T     +   D  G  PLH+A+               VC    Y                   + LLLE N  G I   D    TPL  A   NH E VE  L + +     D++   +  +   +G+  + +  L +  N D N+ D  G                                  TP+F A    ++++++ LIE  A++D+VDQ G +  H AA  G      +L+  G+ P  + H    PL  AAY GY     +L+++  A  N+ +K   G TALH
Sbjct:   14 QVHAAAINGDRSALQKIDSSNPEFRDAPDQFGRTPLMYCVLADRPECAEALVKAGANVNKTD---------KSKRTALHLAAQKGNYRILKLLLSRRASLLQ-KDLEGMTGLHLATRHETPRCLALLLKHIEPGEVDVQDNQKRTALHWSAYYNHPEHVRMLIKHDSNIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPTDSILNWQDYEGRTPLHFAVADGNEAVVDILTSPQVCNVTAYDNLFRTSLHWAALLGHAKIVHLLLERNSSGTIPS-DSQGATPLHYAAQSNHAETVEVFLSHPSVHDEPDLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQVDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQDGHSPLHWAALGGNADICLILIRNGIHPDVRDHVRRTPLQCAAYGGYINCMVVLMDS-QADPNIQDKE--GMTALH 491          

HSP 3 Score: 78.5666 bits (192), Expect = 4.756e-15
Identity = 93/373 (24.93%), Postives = 147/373 (39.41%), Query Frame = 2
Query: 2147 NKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEM--NGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNA-KLDIVDQYGRTLCHKAAEKGAFKCLELLL---SYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIE--------------------------------NVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            ++   + I    PE  +  D+   T L   +++   E    L+K  ANVN  D + RTAL+LA    N   L+ +        +     D  G   LH A    +++   C     + LLL+    G+++ +D   RT L  +   NH E V  L+K+ +N    D +    +H+  +  +    + +       P     N  D  G TP+ +AV++ NE +V  L       +   D   RT  H AA  G  K + LLL   S G  P      G  PLH AA   + E  E+ L+ PS  +                                +VN  +  G TALH AA+        LL++  ++++
Sbjct:   23 DRSALQKIDSSNPEFRDAPDQFGRTPLMYCVLADRPECAEALVKAGANVNKTDKSKRTALHLAAQKGNYRILKLLLSRRASLLQ----KDLEGMTGLHLA---TRHETPRC-----LALLLKHIEPGEVDVQDNQKRTALHWSAYYNHPEHVRMLIKHDSNIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPTDSILNWQDYEGRTPLHFAVADGNEAVVDILTSPQVCNVTAYDNLFRTSLHWAALLGHAKIVHLLLERNSSGTIPSDS--QGATPLHYAAQSNHAETVEVFLSHPSVHDEPDLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQVD 381          

HSP 4 Score: 74.3294 bits (181), Expect = 1.057e-13
Identity = 67/263 (25.48%), Postives = 125/263 (47.53%), Query Frame = 2
Query:  194 LKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQL-LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKF-DLETTDSNNCTALMYACSYNNVDVVELLLERGS 970
            L    + N+ +  ++  +   V D  DL  +T   +      ++ V  +L + P L ++  +K G T LH A++    +++R LL+    ++  N    + L  A    + E ++ L E  A V++ D +G SP+H+AA            +I  IL+++G   D  D  +R+PL  A     +  M  L++  A    +D  G++ LH+  +NG L  +++LL+   F +   T+    T L YA    + +V++ +LE G+
Sbjct:  290 LHYAAQSNHAETVEVFLSHPSVHDEPDLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGAQVDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQDGHSPLHWAA-------LGGNADICLILIRNGIHPDVRDHVRRTPLQCAAYGGYINCMVVLMDSQADPNIQDKEGMTALHWCCNNGYLNAVKLLLEYGAFPNHMETNEERYTPLDYALLGGHQEVIQYMLEHGA 545          

HSP 5 Score: 68.9366 bits (167), Expect = 5.233e-12
Identity = 93/363 (25.62%), Postives = 159/363 (43.80%), Query Frame = 2
Query:  314 ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKH--GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGN---LEIIQMLLDDYKFD--LETTDSNNCTALMYACSYNNVDVVELLLE-RGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSN--YPLHEASYKGHNEIVEFLITNM----EPK-EKILNF-----------------------INHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
             S ++ I S  P+  D  ++ G T L    +   P     L+    ++NK +   R++L LA    N   +KLL    A +   D+ G++ +H A +             + +LLKH    ++D  D  KR+ L W+   N+   ++ LI+  + I   DS G   LH+A +N +   +  ++ LL+    D  L   D    T L +A +  N  VV++L   +  NV A D+  R + H+A+  G  K + +L + N +   + +DS    PLH A+   H E VE  +++     EP  E+   F                       +N  +  G TALH + +  ++   ++LL +GA
Sbjct:   24 RSALQKIDSSNPEFRDAPDQFGRTPLMYCVLADRPECAEALVKAGANVNKTDKSKRTALHLAAQKGNYRILKLLLSRRASLLQKDLEGMTGLHLATR-------HETPRCLALLLKHIEPGEVDVQDNQKRTALHWSAYYNHPEHVRMLIKHDSNIGVPDSEGKIPLHWAANNKDPSAVHTVRCLLEATPTDSILNWQDYEGRTPLHFAVADGNEAVVDILTSPQVCNVTAYDNLFRTSLHWAALLGHAKIVHLLLERNSS-GTIPSDSQGATPLHYAAQSNHAETVEVFLSHPSVHDEPDLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAALSGHVSTVRLLLAHGA 378          

HSP 6 Score: 56.9954 bits (136), Expect = 2.804e-8
Identity = 53/201 (26.37%), Postives = 96/201 (47.76%), Query Frame = 2
Query:  779 SKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVK 1381
            SK  S  S +H A  NG+   +Q +        +  D    T LMY    +  +  E L++ G+NVN  D  +R A H A+ KG+ + L++L     +L + + +    LH A+       +  L+ ++EP E     ++ +++  +TALH S   ++ E  ++L+++  D NI +  S GK        NK+ + +  V+
Sbjct:    6 SKSPSLTSQVHAAAINGDRSALQKIDSSNPEFRDAPDQFGRTPLMYCVLADRPECAEALVKAGANVNKTDKSKRTALHLAAQKGNYRILKLLLSRRASLLQKDLEGMTGLHLATRHETPRCLALLLKHIEPGE-----VDVQDNQKRTALHWSAYYNHPEHVRMLIKH--DSNIGVPDSEGKIPLHWAANNKDPSAVHTVR 199          

HSP 7 Score: 54.6842 bits (130), Expect = 1.364e-7
Identity = 66/269 (24.54%), Postives = 106/269 (39.41%), Query Frame = 2
Query:  284 KTLLHYC--FKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAV---KLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQML--------------------------------LDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVN 979
            +T LH+     +   V L+L          +  G T LH A+      ++   LS +P ++   +  R +  +       +AV    L    N +VN+ D  G + +H AA           +  + +LL HGA +D  ++ K +PL  A    +   ++ LIE GA +   D  G S LH+A   GN +I  +L                                L D + D    D    TAL + C+   ++ V+LLLE G+  N
Sbjct:  253 RTSLHWAALLGHAKIVHLLLERNSSGTIPSDSQGATPLHYAAQSNHAETVEVFLS-HPSVHDEPDLERRTAFMWAAGKGSDAVVSTMLRLIPNLDVNLADKYGGTALHAAA-------LSGHVSTVRLLLAHGAQVDAANVMKHTPLFRACEMGHKEVIETLIEGGARVDLVDQDGHSPLHWAALGGNADICLILIRNGIHPDVRDHVRRTPLQCAAYGGYINCMVVLMDSQADPNIQDKEGMTALHWCCNNGYLNAVKLLLEYGAFPN 513          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009528.1 (pep scaffold:Pmarinus_7.0:GL478737:432:18044:-1 gene:ENSPMAG00000008612.1 transcript:ENSPMAT00000009528.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 1.253e-22
Identity = 59/193 (30.57%), Postives = 97/193 (50.26%), Query Frame = 2
Query:  665 GADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTV 1243
            G +ID  D  +++PL+ A  SN L   ++L++ GA +  KD  G + LH A   GNLE++Q L+   K ++   D    T +++   Y +VDVV LLL RG++V   D++     H+A+  G +   +       +L   N   + PLH AS + H E V  L+            ++ RN  G+T +  ++V
Sbjct:  588 GGNIDACDQDQKTPLLQAAESNQLASTRYLVKAGAYVAHKDDEGATCLHLAAKKGNLEVVQYLVSTGKVNINCQDDGGWTPVIWTAEYKHVDVVRLLLSRGADVTLRDNEENICLHWAAFAGSVDIAEEFINAQCDLHAANLHGDTPLHIASRENHYECVVLLLARGA-------NVDVRNKEGETPMECASV 773          

HSP 2 Score: 71.2478 bits (173), Expect = 1.436e-12
Identity = 57/233 (24.46%), Postives = 104/233 (44.64%), Query Frame = 2
Query: 2495 MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLH-NTSDNEELTAYDLA 3190
            +  L++  G+I+  D+  +TPLL A   N + +   L+K GA    +D +    +H    +GNLE+   L      + N  D  G TP+ +     +  +V+ L+   A + + D       H AA  G+    E  ++   D  +    G  PLH A+   + E   +LL   +   NV+ +N  G+T +  A+V +     +L +  + K+ E++    +  E +   D+A
Sbjct:  581 LHTLVQAGGNIDACDQDQKTPLLQAAESNQLASTRYLVKAGAYVAHKDDEGATCLHLAAKKGNLEVVQYLVSTGKVNINCQDDGGWTPVIWTAEYKHVDVVRLLLSRGADVTLRDNEENICLHWAAFAGSVDIAEEFINAQCDLHAANLHGDTPLHIASRENHYECVVLLL---ARGANVDVRNKEGETPMECASVDS---TVWLALQMNRKLREIVACRPARTERILTRDIA 807          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 2.965e-22
Identity = 96/385 (24.94%), Postives = 162/385 (42.08%), Query Frame = 2
Query: 2000 EITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM---NDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENF-DPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            +IT  Y   L  +   G++      + D G    +R  +G T LH + K   +   EL+LK     +    E+ LT +H+      +  + +LL+  A+ N  +  G TAL++A        +  +      +  K R  Q P       LH A  + K +         ++LLL+     +       TPL +A    H +    LL++GA+      +    +H     G +E+ + L   + F  P+    NGLTP+  A    N+K+   L++  A      + G T  H AA+K   +    LL YG +  +    G  PLH  A  G+ ++A +LL   +   +VN    SG + LHLAA  +   +  +L+   + +N
Sbjct:   67 DITLDYLTALHVAAHCGHYR-TAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGAS-IEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTP-------LHIAARLGKLE--------IVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLL--LQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLL---ARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVN 429          

HSP 2 Score: 97.4413 bits (241), Expect = 1.423e-20
Identity = 93/364 (25.55%), Postives = 159/364 (43.68%), Query Frame = 2
Query:  212 GNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES--CVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            G+ +  K LL+   +  +VR L   T LH   K      +EL+L     +    E +G T +H+++ +     +  LL      N  N    ++L +A      E V+ L  N A+V+       +P+H AA++        +LEI+ +LL+H A  D       +PL  A    +      L+E GA +      G + LH A+  G +E+  +LL  +    +    N  T L  A  Y+N  V  LLL++G++ +A         H A+ K  L+    L +Y      +      PLH  + +GH ++   L+            +NH   +G + LHL+  +D + + +IL+++GA  N
Sbjct:   83 GHYRTAKVLLDKGANP-NVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTE-SGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLG-------KLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFA-SPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYAD-------VNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVN 429          

HSP 3 Score: 90.8929 bits (224), Expect = 1.604e-18
Identity = 80/310 (25.81%), Postives = 141/310 (45.48%), Query Frame = 2
Query:  368 EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
             ++G T LH A+       +  LL +   I  +  +  S L +A   D+ E V++L +  A V+   ++ ++ +H AA                +LL  GA+ +   L   +PL  A   N +  M+ L++ GA I +   SGL+ +H +   GNL I+ +LL         T+    TAL  A      +VV  LL  G+ V+A+  + +   H A+  G L+ +Q+L Q+  +     ++   PLH A+ +GH ++   L+ +          +      G T LH+++    +E+  +LLQ  A P+
Sbjct:    3 RQDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCG-------HYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQG-GASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGAS-------LAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPD 297          

HSP 4 Score: 88.9669 bits (219), Expect = 6.374e-18
Identity = 89/357 (24.93%), Postives = 158/357 (44.26%), Query Frame = 2
Query:  311 YESCVELIL-SVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL-DDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKI-------LNFINHRN-------------------SNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            +E  VE++L   AP L  T  KNG + LH+A+       ++ L+     ++    D  ++L +A    +    K+L +  A  N+  +NG +P+H A K       +N + ++ +LLK+GA I+ +     +P+  +    NL  +  L++ GA   + +  G + LH A   G  E+++ LL +  + D +  +    T L  A     +++V+LLL+  ++ +A  S      H A+ +G      +L ++  +L         PLH AS  G  E+   L+      +         L+  +H +                    NG T LH++  KD LEI   LL+ GA+ N
Sbjct:   18 HEQVVEILLEQGAPILAKT--KNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACK-------KNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQ--TPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETN 363          

HSP 5 Score: 84.3445 bits (207), Expect = 1.575e-16
Identity = 91/364 (25.00%), Postives = 151/364 (41.48%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYES--CVELILS--VAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLS------TVKDNLEI 1261
            A + G  + V+ LL N   V D +   ++T LH   +      V+L+L    +P   D    NGYT LH+A+          LL     +        + L +A  Y   E   LL +  A  +    NG++P+H A+            ++  +LL  GA          +PL  A   + L     L+E GA   +    G++ LH     G+ ++  +LL  Y  D+     +  + L  A   + V+V E+L++ G++VNA           A   G++K +  L Q+  ++     +   PLH+A+ +GH  IV  L+       K     N    NG TAL ++      +V D L++
Sbjct:  178 AARAGQTEVVRSLLRNGAQV-DAKAREEQTPLHIAARLGKLEIVQLLLQHMASP---DAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYD-------NQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYA-DVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL-------KCGARPNDVTVNGNTALAIARRLGYISVVDTLKV 522          

HSP 6 Score: 83.9593 bits (206), Expect = 1.882e-16
Identity = 93/359 (25.91%), Postives = 158/359 (44.01%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS--LKNKELFELILK--KTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGN---YPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGA--NFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLA 3076
            L  + R G  E+V S + +G +V + + +  +T LH +  L   E+ +L+L+   +P+          T LH+       +   +LL++ A++      G T L++A  Y  +     +        RF   PD +G     PLH A      K ++        LLL+         +   TPL +A   + +E   TLL+ GA  N +TR  Q +  +H    EG+ ++ + L +    D N    +GL+P+  A       + + L++  A ++   + G T    A   G  K +  LL +G D  SK  +G  PLH+AA +G+  I  +LL   +     N+   +G TAL +A
Sbjct:  175 LHMAARAGQTEVVRSLLRNGAQV-DAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATS---NGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQ------RFAS-PDAAGKNGLTPLHVASHYDNQKVAL--------LLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITR--QGVAPLHLGAQEGHADVAS-LLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGA---RPNDVTVNGNTALAIA 508          

HSP 7 Score: 70.8626 bits (172), Expect = 1.947e-12
Identity = 55/195 (28.21%), Postives = 90/195 (46.15%), Query Frame = 2
Query: 2495 MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            +E+LLE    I  + +   +PL +A   +HVE V+ L++  A      +  L ++H     G+      L + +  +PNV   NG TP+  A      ++++ L++  A ++ V + G T  H +A  G    + +LL  G  P +    G   LH AA  G  E+   LL   +    V+ K    QT LH+AA
Sbjct:   22 VEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVL-LDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGA---QVDAKAREEQTPLHIAA 212          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 57.7658 bits (138), Expect = 1.042e-8
Identity = 47/178 (26.40%), Postives = 84/178 (47.19%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLL-LAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSN-NCTAL 910
            T LH AS+    + + +L+S+  D+N R     ++ L  A  Y     V  L ++ A+  +TD  G + +H +  V +         + N++ K   DID  D   R+ L+WA    +   +  L++ GA I   D+ G + LH+ T  G   +++ L+ D     + TD+  +C A+
Sbjct:  111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLS--VNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAI 286          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 56.9954 bits (136), Expect = 2.404e-8
Identity = 62/281 (22.06%), Postives = 123/281 (43.77%), Query Frame = 2
Query:  554 VNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHF------------------ASGKGDLKNLQVLHQYNVNLWKLNNDSNY-PLHEASYKGHNEIV-EFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD-PNIPLRVSNGKSMT 1333
            +N  D++   P+HYAA++       + L    +      D+D +D   ++PL+ A+ +N++  ++ L+  G                     N   I+  + DY  ++ ++       L  AC +NN D  +LLLE  S  NA+++K +++ H                   A   GD + +Q+L +Y  +  +++  + + P+  A   GH+E++ E L  N          ++  + NG + L  +  + ++++   LLQ   + P+ PL   N +S T
Sbjct:  417 LNAQDIHSRVPLHYAAELGKLEFVHSLLITNLL-----EDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGG-------------------ANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNAR--------LDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEINSQSST 665          

HSP 2 Score: 48.521 bits (114), Expect = 7.167e-6
Identity = 31/88 (35.23%), Postives = 44/88 (50.00%), Query Frame = 2
Query: 2648 LCSVHYVCSEGNLEIFNQLAVFENFDPNVTDP-NGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLL 2908
            LC++H V   G      QL +    DPN  D  N  TPIFYAV + + +++  L++ NA+LDI D  G +    A  +     L  LL
Sbjct:  558 LCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALL 645          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 53.9138 bits (128), Expect = 4.033e-8
Identity = 59/210 (28.10%), Postives = 86/210 (40.95%), Query Frame = 2
Query: 2426 NYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDI---QNLCSVHYVCSEGNLEIFNQLAVFENFD-PNVTDPN-----GLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDP--WSKCHDGTMPLHEAAYRGYKEIAEILLNTPSA 3022
            NYPLH A    ++ K      +   LLL+       +D+  R PL  +++    E    LL    N    D          H  CS GNLE+   L     +D P   D N     G+T +  AV     ++ + LIE  A + I D++ +   H+AA  G+ K +ELL   G     W     G  PL  A   G+ + A +L+    A
Sbjct:    3 NYPLHQACMENEFFKVQELLHSKPSLLLQ-------KDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSL-----YDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQD-KQGWTPLFHALAEGHGDAAVLLVEKYGA 199          

HSP 2 Score: 51.9878 bits (123), Expect = 1.643e-7
Identity = 55/215 (25.58%), Postives = 93/215 (43.26%), Query Frame = 2
Query: 2225 LHMVIMSKEIERLPLLLKNNANVNF-PDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQI---PDNSGNYPLHYAIEICKYK--KSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIE-LNAKLDIVDQYG 2848
            LH   M  E  ++  LL +  ++    D +GR  L+ +V +    A E +  ++  K   + +   PD+SG  P H A  +   +  KS+       +L    N  + C        L LA+     E  + L++NGA+   +D  N   +H   S G+L++   L        N  D  G TP+F+A++  +      L+E   A+ D+VD  G
Sbjct:    6 LHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQ---AHE-ITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTC--------LHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKG 208          

HSP 3 Score: 47.3654 bits (111), Expect = 4.842e-6
Identity = 43/145 (29.66%), Postives = 65/145 (44.83%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELILSVAPQ--LLDTGEKNGYTVLHLASMIKPPTSLRYLLSK--NPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKV 607
            L +AC E    KV++LL +   +   +D   +  LH+   F+       +LS      L D  + +G+T  H+A  +     ++ L  +   PD+NK  N   + L LAV     E  + L EN A V I D     P+H AA V
Sbjct:    6 LHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASV 150          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 55.0694 bits (131), Expect = 6.433e-8
Identity = 60/228 (26.32%), Postives = 102/228 (44.74%), Query Frame = 2
Query:  716 AVCSNNLTKMKHLIEKGACIYSKDS-SGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQY------NVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTV-KDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            A    +L  +K ++E GA   + D    LS LH+A  N    + + LL       +       TAL +A  Y N+ +V+LLL+ G++   +D +  N  HF+    ++  +  +  +      NV++   +N++  PL  A+Y+G    VE L+       K  + +   ++ G  ALH + V  D   IC ++L +GA+        N +     DLA    TK L 
Sbjct:   57 AAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLL-------KFGSTVAWTDNRGFNALHCALVGGDQRVICDLIL-SGAN----FYERNNQKQDCFDLAEGMGTKSLF 272          

HSP 2 Score: 54.299 bits (129), Expect = 1.090e-7
Identity = 41/135 (30.37%), Postives = 69/135 (51.11%), Query Frame = 2
Query:  701 SPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYK-----FDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNN 1090
            + L WA    N+  +  L++ GA    KD  GL+I+H++  + N+ ++  +L          D+++ D+NN T L++A    +   VELLL+ GS V   D++  NA H A   GD + +  L     N ++ NN
Sbjct:  120 TALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNN 254          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 53.9138 bits (128), Expect = 1.903e-7
Identity = 47/152 (30.92%), Postives = 64/152 (42.11%), Query Frame = 2
Query:  887 DSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALD 1342
            DS   T L  AC     DVV+ ++E G                               Y++N    +N  N  LHEA+ +GH EIVE LI N       +N I      G T L  ++   +L++ K LL+NGADP I     N K +TA +
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGG------------------------------YDIN--DQDNAGNTALHEAALQGHIEIVELLIENGAD----VN-IKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTI----RNAKGLTAFE 437          

HSP 2 Score: 49.2914 bits (116), Expect = 4.426e-6
Identity = 38/153 (24.84%), Postives = 72/153 (47.06%), Query Frame = 2
Query:  773 IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-MEPKEKILNFINHRNSNGQTAL 1228
            IY +DS G + L  A   G  ++++ ++++  +D+   D+   TAL  A    ++++VELL+E G++VN                  +K++++               + PL +AS  GH ++V++L+ N  +P          RN+ G TA 
Sbjct:  324 IY-RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVN------------------IKSIEMF-------------GDTPLIDASANGHLDVVKYLLKNGADP--------TIRNAKGLTAF 436          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO29974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T238])

HSP 1 Score: 81.6481 bits (200), Expect = 1.489e-15
Identity = 73/250 (29.20%), Postives = 117/250 (46.80%), Query Frame = 2
Query: 2525 IECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTR----DIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAV-SNCNEKIVKRLIELNAKLDIVDQYGRTLCHKA--AEKGAFKCL----ELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAI----------------ENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLAT 3193
            I  RDR  RTPL LA+  N++ AVE L+K G N   +    D     +   +  +  L++   L +    D N+TD    T + YAV SN    +V+ L+E  A ++  D + RT  H A  A  G F+ L    +L++ +G D  ++   G +PLH  A+   K+  +  L+ P +I                + +N  +  GQT LH AA+R     C  L+ + ++I+ +     DN+  T + LA 
Sbjct:   34 INSRDRHGRTPLQLAVKWNNLHAVEALVKAGVNLNLKSHNADEDFFGTALIMACDNKLQVVKAL-IEGKADVNLTDKQNRTALSYAVSSNTATPMVQSLLEAGAHVNTADSHARTPLHYAVNATTGGFESLTETEDLVIKHGGDIAAQDIKGRIPLHY-AFVKLKKHTDASLSDPVSICSLLLEAMAEHGKDMSKLLNTHDKFGQTPLHRAAIRGATICCLNLLQRGARIDAI-----DNDGNTPFSLAA 276          

HSP 2 Score: 67.3958 bits (163), Expect = 3.096e-11
Identity = 66/243 (27.16%), Postives = 110/243 (45.27%), Query Frame = 2
Query:  674 IDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACI----YSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNV-DVVELLLERGSNVNAEDSKRRNATHFA--SGKGDLKNL----QVLHQYNVNLWKLNNDSNYPLHEA--SYKGHNE--------IVEFLITNM-EPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA-------DPNIPLRVS 1315
            I+  D + R+PL  AV  NNL  ++ L++ G  +    ++ D            +  L++++ L++  K D+  TD  N TAL YA S N    +V+ LLE G++VN  DS  R   H+A  +  G  ++L     ++ ++  ++   +     PLH A    K H +        I   L+  M E  + +   +N  +  GQT LH + ++     C  LLQ GA       D N P  ++
Sbjct:   34 INSRDRHGRTPLQLAVKWNNLHAVEALVKAGVNLNLKSHNADEDFFGTALIMACDNKLQVVKALIEG-KADVNLTDKQNRTALSYAVSSNTATPMVQSLLEAGAHVNTADSHARTPLHYAVNATTGGFESLTETEDLVIKHGGDIAAQDIKGRIPLHYAFVKLKKHTDASLSDPVSICSLLLEAMAEHGKDMSKLLNTHDKFGQTPLHRAAIRGATICCLNLLQRGARIDAIDNDGNTPFSLA 275          

HSP 3 Score: 66.6254 bits (161), Expect = 6.491e-11
Identity = 73/272 (26.84%), Postives = 117/272 (43.01%), Query Frame = 2
Query: 2291 VNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMEL---LLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHYV--CSEGNLEIFNQ---LAVFENFDPNVTDPNGLTPIFYA---------------VSNCN---EKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL--LNTPS 3019
            +N  D +GRT L LAV +NNL A+E +          ++   N  N   H A E       +  C   +++   L+E   D+   D+ +RT L  A++ N     V++LL+ GA+  T D      +HY    + G  E   +   L +    D    D  G  P+ YA               VS C+   E + +   +++  L+  D++G+T  H+AA +GA  C   LL  G    +  +DG  P   AA  G+   A +   +N P+
Sbjct:   34 INSRDRHGRTPLQLAVKWNNLHAVEAL----------VKAGVNL-NLKSHNADEDFFGTALIMACDNKLQVVKALIEGKADVNLTDKQNRTALSYAVSSNTATPMVQSLLEAGAHVNTADSHARTPLHYAVNATTGGFESLTETEDLVIKHGGDIAAQDIKGRIPLHYAFVKLKKHTDASLSDPVSICSLLLEAMAEHGKDMSKLLNTHDKFGQTPLHRAAIRGATICCLNLLQRGARIDAIDNDGNTPFSLAARHGHHSCAMMFIQMNAPA 294          

HSP 4 Score: 51.6026 bits (122), Expect = 2.235e-6
Identity = 72/313 (23.00%), Postives = 134/313 (42.81%), Query Frame = 2
Query:  287 TLLHYCFKYE-----SCVELIL---SVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLL---LAVIYDNP-EAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSN-----NLTKMKHLIEK-GACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEP 1171
            T LH+  +++     +C++++L   +    ++++ +++G T L LA       ++  L+    ++N +++++        L +  DN  + VK L E  A+VN+TD    + + YA              ++  LL+ GA ++  D + R+PL +AV +      +LT+ + L+ K G  I ++D  G   LHYA           L D             C+ L+ A + +  D+ +LL       N  D   +   H A+ +G       L Q    +  ++ND N P   A+  GH+      I    P
Sbjct:    3 TCLHFLTRHKDEGTPTCLQVLLGRLAACHDVINSRDRHGRTPLQLAVKWNNLHAVEALVKAGVNLNLKSHNADEDFFGTALIMACDNKLQVVKALIEGKADVNLTDKQNRTALSYAVS------SNTATPMVQSLLEAGAHVNTADSHARTPLHYAVNATTGGFESLTETEDLVIKHGGDIAAQDIKGRIPLHYAFVKLKKHTDASLSDPVSI---------CSLLLEAMAEHGKDMSKLL-------NTHDKFGQTPLHRAAIRGATICCLNLLQRGARIDAIDNDGNTPFSLAARHGHHSCAMMFIQMNAP 293          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 77.0258 bits (188), Expect = 1.492e-15
Identity = 62/214 (28.97%), Postives = 101/214 (47.20%), Query Frame = 2
Query:  662 HGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYN-NVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSN----YPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            +G D++  D   R+PL  A CS N+  ++ L+ +       D  G + LHYA  + N   + M L     ++   D+  CT L YA + + +   VE LL    N +  D +  +A H+AS  G    +++L   + N   LN  S      PLH A++ GH   +E LI       K  N +  R+  G+T L L++ + ++E  + LL + A
Sbjct:   22 YGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCV-MSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDL-LNRSSGSPCVTPLHLAAFHGHKPALEVLI-------KSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNA 226          

HSP 2 Score: 72.4034 bits (176), Expect = 5.276e-14
Identity = 61/229 (26.64%), Postives = 109/229 (47.60%), Query Frame = 2
Query:  389 LHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTK-MKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDL--ETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYN 1066
            LHLA +       + LL    D+N ++N+ R+ L  A    N   ++LL     + N  D  G +P+HYAA              +  L+  G++++  D    +PL +A  S+   K ++HL+        +D  G S +HYA++NG+   I+MLLD    DL   ++ S   T L  A  + +   +E+L++  +++   D + R     AS +G ++ ++ L  +N
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAG-------HTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHN 225          

HSP 3 Score: 61.6178 bits (148), Expect = 2.686e-10
Identity = 64/232 (27.59%), Postives = 99/232 (42.67%), Query Frame = 2
Query: 2432 PLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAV-SNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGT---MPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRN--DCPMCFL 3109
            PLH A   C    + C CK     LL    D+  +D   RTPL  A    +V  +E L+    +F   D      +HY     N      L V    + N  D    TP+ YA  S+ + K V+ L+         D+ G +  H A+  G    +E+LL    +       G+    PLH AA+ G+K   E+L+ + + +E    +++ G+T L LA+ +   +C  C L
Sbjct:    3 PLHLA---CLGGFTEC-CKK----LLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSL-VTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLE---VRDDRGRTPLDLASFQGHVECVECLL 222          

HSP 4 Score: 58.5362 bits (140), Expect = 2.571e-9
Identity = 52/207 (25.12%), Postives = 92/207 (44.44%), Query Frame = 2
Query: 2402 IQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLC----HKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLN 3010
            +   DN+   PLH     C        C   +ELL+   GD  C D++ R PL  A    +   V +L+  G+N    D +    +HY  +        +  +    + +  D  G + + YA +N ++  ++ L++++A  D++++   + C    H AA  G    LE+L+    D   +   G  PL  A+++G+ E  E LLN
Sbjct:   26 VNAKDNNDRTPLH-----CAACSGNVNC---LELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSAN-DLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLN 223          

HSP 5 Score: 58.151 bits (139), Expect = 3.947e-9
Identity = 61/234 (26.07%), Postives = 103/234 (44.02%), Query Frame = 2
Query: 2225 LHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVN-HVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGN---LEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSY 2914
            LH+  +    E    LL    +VN  D N RT L+ A    N+  LE +     D        D  G  PLHYA     ++  +         L+    ++   D  + TPL  A   +   + VE LL+N  N   RD Q   +VHY  + G+   +E+   ++  +  + +   P  +TP+  A  + ++  ++ LI+    L++ D  GRT    A+ +G  +C+E LL++
Sbjct:    4 LHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGD----FNCIDKLGRNPLHYAAGHTNFRCVMS--------LVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSP-CVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNH 224          

HSP 6 Score: 55.4546 bits (132), Expect = 3.166e-8
Identity = 56/199 (28.14%), Postives = 92/199 (46.23%), Query Frame = 2
Query:  806 LHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHN-EIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLA----NKNETKLLIVKFN 1387
            LH A   G  E  + LL  Y  D+   D+N+ T L  A    NV+ +ELL+ +  + N  D   RN  H+A+G  + + +  L     N+ K +  +  PLH A+    + + VE L+ N     K       R+  G +A+H ++   +    ++LL   A+ ++  R S    +T L LA    +K   ++LI  FN
Sbjct:    4 LHLACLGGFTECCKKLLF-YGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASK-------RDKQGYSAVHYASANGHKLAIEMLLDVSAN-DLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFN 193          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 72.0182 bits (175), Expect = 3.392e-14
Identity = 51/179 (28.49%), Postives = 90/179 (50.28%), Query Frame = 2
Query:  527 KLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADID---GLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVL 1054
            KLL  N   +N  D +G SP+HYA         +  L+        GAD+D      + +  P++ A   N +   + L+  GA +   +  G + LH+AT  G+ +++++LL D + D+   D +N T+L  A    +  +++ LL  G+N+ A+D+    A H A+ +G+ + LQ L
Sbjct:   13 KLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDA-------GADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTL 184          

HSP 2 Score: 58.9214 bits (141), Expect = 9.502e-10
Identity = 51/192 (26.56%), Postives = 91/192 (47.40%), Query Frame = 2
Query: 2669 CSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDI-----VDQYGRTLCHKAAEKGAFKCLELLLSYGVD-PWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPDCKNTLKTF 3226
            C +G  +   +L      + N  D +G +P+ YA +  +  IV+ L++  A +D+     + +    +C  AA+  A +   +LL  G D   + C+ G   LH A  RG+ ++ E+LL       NV +++N+  T+LH+AA+    P+   L+   + I        DN+  TA+ LA     +  L+T 
Sbjct:    3 CRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIIC--AAKFNAIESCRVLLRAGADVNITNCY-GQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNT--TSLHVAAMIGSNPIIKTLLFCGANI-----TAKDNDGFTAFHLAAREGEEEVLQTL 184          

HSP 3 Score: 54.6842 bits (130), Expect = 3.435e-8
Identity = 50/183 (27.32%), Postives = 97/183 (53.01%), Query Frame = 2
Query:  815 ATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDS---KRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANK 1354
            A  +G  + ++ LL     +L T D++  + L YA + N+VD+V++LL+ G++V+   S   +R      A+    +++ +VL +   ++   N      LH A+ +GH+++VE L+ + +     +N ++  N+   T+LH++ +  +  I K LL  GA  NI  + ++G   TA  LA +
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMD---VNVVDRDNT---TSLHVAAMIGSNPIIKTLLFCGA--NITAKDNDG--FTAFHLAAR 174          

HSP 4 Score: 53.1434 bits (126), Expect = 1.066e-7
Identity = 43/157 (27.39%), Postives = 73/157 (46.50%), Query Frame = 2
Query: 2552 TPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVF--ENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLI-ELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNT 3013
            +PL  A   NHV+ V+ LL  GA+   R   ++  +  +             V      D N+T+  G T + +A    + K+V+ L+ +    +++VD+   T  H AA  G+   ++ LL  G +  +K +DG    H AA  G +E+ + LL T
Sbjct:   31 SPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRT 187          

HSP 5 Score: 50.0618 bits (118), Expect = 9.837e-7
Identity = 45/184 (24.46%), Postives = 86/184 (46.74%), Query Frame = 2
Query:  314 ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSL---LLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL 856
            + CV  +L      L+T + +G++ LH A+       ++ LL    D++ R + S   +   + A  ++  E+ ++L    A+VNIT+  G + +H+A +        +   +  +L     D++ +D    + L  A    +   +K L+  GA I +KD+ G +  H A   G  E++Q LL
Sbjct:    8 KDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATR------RGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO35983 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJZ3])

HSP 1 Score: 68.9366 bits (167), Expect = 7.303e-14
Identity = 39/121 (32.23%), Postives = 67/121 (55.37%), Query Frame = 2
Query:  794 GLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI 1156
            G+S++H A  +G+ E ++ LL     D   T + + T LM A + +  D  ELL+E G++V   DS +R A H+A+  G  + +++L  +  ++  + +  N PLH A+  GH + V  LI
Sbjct:    2 GMSLVHVAACSGSYESLKRLLL-LGMDPNKTSNQDVTPLMLAATRDCTDFAELLIEGGASVQMTDSSQRGAIHYAASCGKTRTVELLLDHGASVNDITDRRNTPLHSAATNGHTKTVAALI 121          

HSP 2 Score: 49.2914 bits (116), Expect = 5.646e-7
Identity = 34/117 (29.06%), Postives = 49/117 (41.88%), Query Frame = 2
Query: 2657 VHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILL 3007
            VH     G+ E   +L +    DPN T    +TP+  A +       + LIE  A + + D   R   H AA  G  + +ELLL +G            PLH AA  G+ +    L+
Sbjct:    6 VHVAACSGSYESLKRLLLL-GMDPNKTSNQDVTPLMLAATRDCTDFAELLIEGGASVQMTDSSQRGAIHYAASCGKTRTVELLLDHGASVNDITDRRNTPLHSAATNGHTKTVAALI 121          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 68.9366 bits (167), Expect = 7.482e-12
Identity = 99/425 (23.29%), Postives = 165/425 (38.82%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELIL---------KKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTY-------MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIF--------------------------NQLAVFENFDPNVTDPNG----------LTPIFYAVSNCNEKIVKRLIELN-AKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            L  +C  G   +    +  G ++  + D+   T LH++    N  + +L+              ++V   D    T LH+ +     +   L L+  ANVN    +     +  ++     A EC+         F+ I  +   Y     +  CK +K   +   Y       +  ++     IECRD+   TPL++A   NHV+ V TLL++GA+   +DI +  SV    +EG +E                            N+L +       +   NG          +TPI YA      + V  L++ + A ++  D    T  H AA  G    ++ LL  G    ++      PL  AA RG  E+A ILL+  +    V+  + +  T LHLA+      M  LL+S+ + I 
Sbjct:    8 LHVACSHGCIPVAKCLVEAGADLRSL-DEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVV----ARECI---------FVMIKVSKLKY-----LSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAP---VDPTDKAKTTPLHLASREGHVEMVKLLLSRKANIT 410          

HSP 2 Score: 60.4622 bits (145), Expect = 3.313e-9
Identity = 58/260 (22.31%), Postives = 110/260 (42.31%), Query Frame = 2
Query:  431 YLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVC-----------SNNLTKM-----KHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN 1162
            Y++     I  R+ D  + L++A   ++ + V+ L ++ A++   D+N  + +  AA        E                    L  + P+ W +C           SN L  +     + L++ GACI SK+   ++ +HYA   G +  +  LL      +   D  + T L  A  + +  VV+ LL RG  ++A ++        A+ +G ++   +L   +  +   +     PLH AS +GH E+V+ L++ 
Sbjct:  165 YIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAA------------------LEHQKPV-WTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSR 405          

HSP 3 Score: 56.6102 bits (135), Expect = 5.574e-8
Identity = 45/164 (27.44%), Postives = 81/164 (49.39%), Query Frame = 2
Query:  527 KLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFA 1018
            +LL +N A ++  +   ++P+HYAAK            +  +L +  A I+  D    +PL  A    +   +K L+ +G  I +++++  + L  A + G +E+  +LLD+    ++ TD    T L  A    +V++V+LLL R +N+   DS  RN    A
Sbjct:  267 QLLLDNGACIDSKNDEDITPIHYAAKFG------RVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDE-DAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIA 423          

HSP 4 Score: 56.6102 bits (135), Expect = 5.871e-8
Identity = 58/236 (24.58%), Postives = 116/236 (49.15%), Query Frame = 2
Query:  668 ADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVV----ELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNND---SNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANK 1354
            A I+  D  K +PLM A   N++  ++ L++ GA I +KD +  + +  A + G +E ++  L+  K  + T   + C   +   S   + V+    +LLL+ G+ +++++ +     H+A+  G ++ +  L + +  +  +N++   SN PLH A+  GH  +V+ L+            I+ RN+   T L  +  +  +E+  ILL    D + P+  ++    T L LA++
Sbjct:  171 ACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQK-PVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAI--INDEDGASNTPLHLAALHGHAAVVKELLYRG-------GAIDARNATLWTPLDCAAARGMVEVANILL----DEDAPVDPTDKAKTTPLHLASR 392          

HSP 5 Score: 49.6766 bits (117), Expect = 6.861e-6
Identity = 54/209 (25.84%), Postives = 91/209 (43.54%), Query Frame = 2
Query:  701 SPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL--DDYKFDLETT-------DSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF---INHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            +PL  A     +   K L+E GA + S D   ++ LH+A   GNL + ++L    + +    T        D    TAL  A    + D+ +L LE+G+NVNA    +    H        K + V  +    + K++    Y     S K   EI+ +    +     I+ F   I  R+ +  T L ++  K++++  + LLQ+GAD
Sbjct:    6 TPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFH--------KTIVVARECIFVMIKVSK-LKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGAD 205          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 112.464 bits (280), Expect = 2.573e-24
Identity = 102/369 (27.64%), Postives = 171/369 (46.34%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTG------EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            A +  + +    LL+N  +  DV   T  T LH    YE+     +SVA  LL+ G       KNG T LH+AS       +R LL +   I+ +  D  + L  A    +   +++L E+ A +     NG+SP+H AA+        + ++ +  LL++ A+ID + L   +PL  A    +    K L++KGA   ++  +G + LH A    ++  + +LL  +   LE    +  T L  A    ++++V+ LL+RG++ NA + K     H AS  G  +  Q L Q    +     D   PLH A+  GH E+V+ L+ +    +          + G T LH++  + ++   +ILL  GA
Sbjct:  178 AARNDDTRTAAVLLQNDPNP-DVLSKTGFTPLHIAAHYEN-----MSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQ-------GDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLK-HSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSA-------TTAGHTPLHIAAREGHIHTIRILLDAGA 525          

HSP 2 Score: 102.834 bits (255), Expect = 1.993e-21
Identity = 99/395 (25.06%), Postives = 182/395 (46.08%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILS-VAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLI-----TNMEPKEKI--LNFINHRNS-------------------NGQTALHLSTVKDNLEICKILLQNGADPN 1297
            A + GN   V+ LL+    + D +   + T LH   +  +   +E++L   AP  +    KNG + +H+A+       +R LL  N +I+    D  + L +A    +    K+L +  A+ N   +NG +P+H A K       +N +  +++LLKH A ++ +     +PL  A    +L  +K+L+++GA   + +    + LH A+  G+ E+ Q LL +    ++    ++ T L  A    + ++V+LLL+  +N ++  +      H A+ +G +  +++L        K+      PLH AS  G  ++ E L+      N   K  +  L+   H N+                   NG T LH++  ++ +E+  +LLQNGA PN
Sbjct:  244 ASRRGNVMMVRLLLDRGAQI-DAQTKDELTPLHCAARNGHVRIIEILLEHGAP--IQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACK-------KNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAA-QVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPN 627          

HSP 3 Score: 99.3673 bits (246), Expect = 2.159e-20
Identity = 97/400 (24.25%), Postives = 182/400 (45.50%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVG-DVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
             +  L  A +E + + VK LLEN  +      D      +     +E+ V L+++       T  K     LH+A+      +   LL  +P+ +  +    + L +A  Y+N    +LL    A VN T  NG++P+H A++          + ++ +LL  GA ID     + +PL  A  + ++  ++ L+E GA I +K  +GLS +H A    +++ ++ LL  Y  +++    ++ T L  A    +  + ++LL++G+  NA         H A  K  ++++ +L +++ +L  +      PLH A++ GH  IV+ L+             N  N   +T LH+++   + E+ + LLQN A  +   +        A  + +K   KLL+
Sbjct:  109 GFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYG-----TKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASR-------RGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQ-YNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASP-------NASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLL 488          

HSP 4 Score: 90.8929 bits (224), Expect = 7.918e-18
Identity = 92/384 (23.96%), Postives = 158/384 (41.15%), Query Frame = 2
Query: 1991 QIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALEC-MNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKI 3133
            +I +IT  +   L  +   G+  +    + D G  +  R  +G T LH + K   +   +L+LK +  L     E+ LT LH+      +  +  LL+  A+ N  +    T L++A       A  C +  ++      +         PLH A  +          K  ++LLL+   + +       TPL +A    H+  +  LL  GA  +    +    +H     G +++  +L +    +PN    NGLTP+  AV + N  +VK L+          + G T  H AA++   +   +LL  G  P  +   G  PLH A+  G  ++  +L+   S   NVN  N +G T LHL A      +   L+ + + +
Sbjct:  328 EIDDITLDHLTPLHVAAHCGHHRMAKVLL-DKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASL-EAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMAS-----RAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGH--------KELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDV-AELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLI---SKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASV 692          

HSP 5 Score: 90.1225 bits (222), Expect = 1.610e-17
Identity = 93/361 (25.76%), Postives = 166/361 (45.98%), Query Frame = 2
Query:  212 GNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            G+++  K LL+      + R L   T LH   K  +   ++L+L  +  L    E +G T LH+A+ +     ++ LL +    N  N    + L +A    + E  + L +N A+V+    +  +P+H AA++          E++ +LL H A+ D       +PL  A    ++  ++ L++ GA        G + LH A+  G +++ ++LL+    +      N  T L  A  +NN+DVV+LL+ +G + ++         H A+ +  ++   VL Q   +    +     PLH AS +G  ++V  LI+      K  N +N  N NG T LHL   + ++ I   L++ GA
Sbjct:  347 GHHRMAKVLLDKGAKA-NARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE-SGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMG-------HKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLE-RGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLIS------KQAN-VNLGNKNGLTPLHLVAQEGHVGIADTLVKQGA 690          

HSP 6 Score: 88.1965 bits (217), Expect = 5.206e-17
Identity = 88/313 (28.12%), Postives = 144/313 (46.01%), Query Frame = 2
Query:  383 TVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFAS--GKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVS 1315
            T LH+AS        ++LL     ++ R  D ++ L  A    + E VKLL ++ A  +     G +P+H AA+       E  +  I ILL  GA    +     +PL  A     +   + L+E+GA   +   +GL+ LH A  + NL+++++L+        +T  N  T L  A   N ++V  +LL+ G++ N E  +     H AS  G+ D+  + +  Q NVNL   N +   PLH  + +GH  I + L+     K+    +   R   G T LH++    N+++ K LLQ  A  N   R+ 
Sbjct:  437 TPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAR-------EGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGG-SAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLG--NKNGLTPLHLVAQEGHVGIADTLV-----KQGASVYAASRM--GYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMG 732          

HSP 7 Score: 88.1965 bits (217), Expect = 6.216e-17
Identity = 93/381 (24.41%), Postives = 164/381 (43.04%), Query Frame = 2
Query: 1868 SPDFNNEPVKLTNSKKIKDSSEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEIL 3004
            SP+ +N  VK+     +   +  C++     +N  +++++       +  +  L  + R+G+ E+V   + D     +    +G T LH + +   +    ++L    + V K  +   T LH+     +++   LLL+  AN N    NG T L++AV +NNL  ++ +      K         +G  PLH A +  + + +         +LL+      C      TPL LA      + V  L+   AN    +   L  +H V  EG++ I + L V +          G TP+  A    N K+VK L++  A ++   + G T  H+AA++G    + LLL +G  P     +GT PL  A   GY  + ++L
Sbjct:  427 SPNASN--VKVETPLHMASRAGHCEVAQFLLQNAAQVDAR------AKDDQTPLHCAARMGHKELV-KLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQV-KMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLL----VSKGGSAHSTARNGYTPLHIAAKQNQIEVA--------SVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTL-VKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 8 Score: 87.0409 bits (214), Expect = 1.285e-16
Identity = 101/379 (26.65%), Postives = 160/379 (42.22%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYS-LKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYIT---------------DKTRFIQI-------PD---NSGNYPLHYAIEICKYK-KSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP-NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            L  + + G+ ++V   +H G E+ E   + G T LH + L  +E     L      VN       + L+M      +E +  LL+N AN + P  +G T L +A+   +   +  + +Y T               D TR   +       PD    +G  PLH A     Y+  SV Q      LLL    ++    +   TPL +A    +V  V  LL  GA    +    L  +H     G++ I   L   E+  P      NGL+PI  A    +   V++L++ NA++D +     T  H AA  G  +  ++LL  G    ++  +G  PLH A  + +    ++LL   +++E V E   SG T LH+AA
Sbjct:   47 LHLASKEGHVKMVLELLHSGIEL-EATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIA---AHYENMSVAQ------LLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEIL--LEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTE---SGLTPLHVAA 410          

HSP 9 Score: 83.1889 bits (204), Expect = 1.998e-15
Identity = 98/385 (25.45%), Postives = 169/385 (43.90%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEV-SEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICK--YKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAV-FENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDN 3163
            L  + R GN  +V   +  G ++ ++ +D+   T LH + +N    + E++L+    +  K  +  L+ +HM      ++ +  LL+ NA ++    +  T L++A    +      M   + DK         +G  PLH A   CK  + +S       M+LLL+ +  +E       TPL +A  + H+  V+ LL+ GA+    +++    +H     G+ E+   L       D    D    TP+  A    ++++VK L++  A  D     G T  H AA +G    + +LL  G         G  PLH A+  G  ++AE+LL   +   N N    +G T LH+A   N+  +  LL+SK        H+T+ N
Sbjct:  241 LHIASRRGNVMMVRLLLDRGAQIDAQTKDE--LTPLHCAARNGHVRIIEILLEHGAPIQAK-TKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGH----HRMAKVLLDKGAKANARALNGFTPLHIA---CKKNHMRS-------MDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQ--TPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGA---NPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSA----HSTARN 599          

HSP 10 Score: 77.411 bits (189), Expect = 1.047e-13
Identity = 79/360 (21.94%), Postives = 144/360 (40.00%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFK--YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKIL 1273
            A + G+ + VK LL++  +  D       T LH   +  +   + ++L    Q +    K G+T LH+AS          LL +  + N    +  + L +AV ++N + VKLL       + T  NG +P+H AAK                                         N +     L++ GA    +   G++ LH A+  G  +++ ML+   + ++   + N  T L       +V + + L+++G++V A         H A   G++K ++ L Q   ++         PLH+A+ +GH +IV  L+       K     N   SNG + L ++     + +  +L
Sbjct:  475 AARMGHKELVKLLLDHKANP-DSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKM-TKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAK----------------------------------------QNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISK-QANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLL-------KHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 11 Score: 73.9442 bits (180), Expect = 1.384e-12
Identity = 84/312 (26.92%), Postives = 135/312 (43.27%), Query Frame = 2
Query:  371 KNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADI-----DGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            +NG   LHLAS       +  LL    ++        ++L +A +    + V  L    A VN     G SP++ AA+       EN LE++  LL++GA+      DG      +PL  A+   +   +  LI  G    +K    L  LH A  N +     +LL +   + +       T L  A  Y N+ V +LLL RG+NVN          H AS +G++  +++L      +     D   PLH A+  GH  I+E L+ +  P       I  +  NG + +H++   D+++  + LLQ  A+
Sbjct:   41 QNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQ-------ENHLEVVKFLLENGANQSLPTEDGF-----TPLAVALQQGHENVVALLINYG----TKGKVRLPALHIAARNDDTRTAAVLLQNDP-NPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAP-------IQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAE 328          

HSP 12 Score: 54.299 bits (129), Expect = 1.171e-6
Identity = 41/165 (24.85%), Postives = 76/165 (46.06%), Query Frame = 2
Query:  890 SNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNF---INHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            ++  T+ + A    N+D     ++ G N+N  +    N  H AS +G +K +  L    + L       N  LH A+  G  ++V  L+          N+   +N ++  G + L+++  +++LE+ K LL+NGA+ ++P          AL   ++N   LLI
Sbjct:    8 ADAATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELV----------NYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI 162          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: invs (inversin [Source:NCBI gene;Acc:101168237])

HSP 1 Score: 111.309 bits (277), Expect = 3.227e-24
Identity = 88/339 (25.96%), Postives = 156/339 (46.02%), Query Frame = 2
Query:  377 GYTVLHLASMIKPPTSLRYLLSK-NP-DINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC-IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKG--DLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN--------------------MEPKEKILNFINHR------NSNGQTALHLSTVKDNLEICKILLQNGADPNI 1300
            G T LHLA+    P +L  LL    P +++ ++ + +++L  +  Y+ PE V+LL ++++ + I D  G  P+H+AA  +     +    I+         ++  D   R+PL +AV   N   ++ L     C + + D+   + LH+A   G+ +I+ +LL+  K     +DS   T L Y    NN + V + L   S  +  D + R A  +ASGKG  D+    + H  ++++   +      LH A+  GH   V+ L+                      M  ++ IL  I         + +G TALH + +  N E+C++L++NG  PN+
Sbjct:  113 GMTPLHLATRHPSPKALALLLKHIGPGEVDTQDKNKQTALHWSAFYNRPEHVRLLIKHDSNIGIPDSEGKIPLHWAAHSQEASATQTVRCILEAAPTESL-LNWQDYEGRTPLHFAVADGNQAVVEVLTSYEGCNVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGTIPSDSQGATPLHYGAQSNNAETVGVFLSHPSVKDEPDLEGRTAFMWASGKGSDDVICTMLEHNPHIDINMADKYGGTALHAAALSGHVSTVQLLLEKGAMVDALDVMKHTPLFRACEMGHRDVILTLIKGSARVDLVDVDGHTALHWAALGGNAEVCQMLMENGISPNV 450          

HSP 2 Score: 88.9669 bits (219), Expect = 2.438e-17
Identity = 107/429 (24.94%), Postives = 171/429 (39.86%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYI-------TDKTRF------------------------IQIPDNSGNYPLHYAIEICKYKKS-VCQC------------------------------KTYMELLLEMNG-DIECRDRVSRTPLLLAINVNHVEAVETLL-KNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTD-PN--GLTPIFYAVSNCNEKIVKRLIELNAKLDI--VDQYGRTLCHKAAEKGAFKCLELLLSYG--VDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLI 3115
            G+   +   I     + +  DQ G+T L Y +    L   E++LK     VNK D +  + LH+      +  L LLL   AN    D  G T L+LA  + +  AL  +  +I        DK +                         I IPD+ G  PLH+A    +   +   +C                              +  +E+L    G ++   D + RTPL  A  + H + V  LL +N +  +  D Q    +HY     N E    + VF +  P+V D P+  G T   +A    ++ ++  ++E N  +DI   D+YG T  H AA  G    ++LLL  G  VD          PL  A   G++++   L+   + ++ V+     G TALH AA+  +  +C +L+
Sbjct:   24 GDRSALIKLIAGESSLRDHEDQFGRTPLMYCVLADRLDCAEILLKAGAS-VNKTDHSQRSALHLAAQKGNVRFLKLLLSRRANWLQKDLEGMTPLHLATRHPSPKALALLLKHIGPGEVDTQDKNKQTALHWSAFYNRPEHVRLLIKHDSNIGIPDSEGKIPLHWAAHSQEASATQTVRCILEAAPTESLLNWQDYEGRTPLHFAVADGNQAVVEVLTSYEGCNVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGTIPSDSQGATPLHYGAQSNNAET---VGVFLSH-PSVKDEPDLEGRTAFMWASGKGSDDVICTMLEHNPHIDINMADKYGGTALHAAALSGHVSTVQLLLEKGAMVDALDVMKH--TPLFRACEMGHRDVILTLIKGSARVDLVDV---DGHTALHWAALGGNAEVCQMLM 442          

HSP 3 Score: 84.3445 bits (207), Expect = 7.180e-16
Identity = 98/369 (26.56%), Postives = 165/369 (44.72%), Query Frame = 2
Query:  227 VKKLLENCTDVGDVRDLTDKTLLHYCFKYESC-----VELILSVAP--QLLDTGEKNGYTVLHLASMIKPPTSLRYLLS-KNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNI-TDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACI--YSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-MEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            V+ L+++ +++G + D   K  LH+    +       V  IL  AP   LL+  +  G T LH A        +  L S +  ++   +N  R+ L  A +  + + V LL E N    I +D  G +P+HY A+        N  E + + L H +  D  DL  R+  MWA    +   +  ++E    I     D  G + LH A  +G++  +Q+LL+     ++  D    T L  AC   + DV+  L++  + V+  D     A H+A+  G+ +  Q+L +  ++    ++    PL  A+Y G+   +  LI N  +P        N ++  G+TALH S     L+  K+LL   A PN
Sbjct:  164 VRLLIKHDSNIG-IPDSEGKIPLHWAAHSQEASATQTVRCILEAAPTESLLNWQDYEGRTPLHFAVADGNQAVVEVLTSYEGCNVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGTIPSDSQGATPLHYGAQ-------SNNAETVGVFLSHPSVKDEPDLEGRTAFMWASGKGSDDVICTMLEHNPHIDINMADKYGGTALHAAALSGHVSTVQLLLEKGAM-VDALDVMKHTPLFRACEMGHRDVILTLIKGSARVDLVDVDGHTALHWAALGGNAEVCQMLMENGISPNVQDHAGRTPLQCAAYGGYITCMAVLIENHADP--------NIQDKEGRTALHWSCNNGYLDAVKLLLSYNAFPN 515          

HSP 4 Score: 83.5741 bits (205), Expect = 1.206e-15
Identity = 103/432 (23.84%), Postives = 168/432 (38.89%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAA---LECMNDYITDKTRFIQIPDNSGNYPLHYAIE---------ICKYKKSVCQCKTY-------------------MELLLEMN--GDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIF-NQLAVFENFDPNVTDPNG---------------------------------LTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLA 3190
            +D  G T LH + ++   K L  L+    P  V+  D+   T LH        E + LL+K+++N+  PD  G+  L+ A      +A   + C+ +    ++  +   D  G  PLH+A+          +  Y+   C    Y                   + LLLE N  G I   D    TPL      N+ E V   L + +     D++   +  +   +G+ ++    L    + D N+ D  G                                  TP+F A    +  ++  LI+ +A++D+VD  G T  H AA  G  +  ++L+  G+ P  + H G  PL  AAY GY     +L+    A  N+ +K   G+TALH +          LL+S ++  N + H     E  T  D A
Sbjct:  109 KDLEGMTPLHLATRHPSPKALALLLKHIGPGEVDTQDKNKQTALHWSAFYNRPEHVRLLIKHDSNIGIPDSEGKIPLHWAAHSQEASATQTVRCILEAAPTES-LLNWQDYEGRTPLHFAVADGNQAVVEVLTSYEG--CNVTAYDNLFRTPLHWAALLGHAKIVHLLLERNKSGTIPS-DSQGATPLHYGAQSNNAETVGVFLSHPSVKDEPDLEGRTAFMWASGKGSDDVICTMLEHNPHIDINMADKYGGTALHAAALSGHVSTVQLLLEKGAMVDALDVMKHTPLFRACEMGHRDVILTLIKGSARVDLVDVDGHTALHWAALGGNAEVCQMLMENGISPNVQDHAGRTPLQCAAYGGYITCMAVLIEN-HADPNIQDKE--GRTALHWSCNNGYLDAVKLLLSYNAFPNHMEHT---EERYTPLDYA 530          

HSP 5 Score: 70.8626 bits (172), Expect = 9.045e-12
Identity = 49/173 (28.32%), Postives = 88/173 (50.87%), Query Frame = 2
Query:  806 LHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGK 1324
            +H A  NG+   +  L+       +  D    T LMY    + +D  E+LL+ G++VN  D  +R+A H A+ KG+++ L++L     N  + + +   PLH A+     + +  L+ ++ P E     ++ ++ N QTALH S   +  E  ++L+++  D NI +  S GK
Sbjct:   17 VHAAAVNGDRSALIKLIAGESSLRDHEDQFGRTPLMYCVLADRLDCAEILLKAGASVNKTDHSQRSALHLAAQKGNVRFLKLLLSRRANWLQKDLEGMTPLHLATRHPSPKALALLLKHIGPGE-----VDTQDKNKQTALHWSAFYNRPEHVRLLIKH--DSNIGIPDSEGK 182          

HSP 6 Score: 56.6102 bits (135), Expect = 2.054e-7
Identity = 48/160 (30.00%), Postives = 71/160 (44.38%), Query Frame = 2
Query: 2657 VHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            VH     G+     +L   E+   +  D  G TP+ Y V        + L++  A ++  D   R+  H AA+KG  + L+LLLS   +   K  +G  PLH A      +   +LL      E V+ ++ + QTALH +A  N      LLI  DS I 
Sbjct:   17 VHAAAVNGDRSALIKLIAGESSLRDHEDQFGRTPLMYCVLADRLDCAEILLKAGASVNKTDHSQRSALHLAAQKGNVRFLKLLLSRRANWLQKDLEGMTPLHLATRHPSPKALALLLKHIGPGE-VDTQDKNKQTALHWSAFYNRPEHVRLLIKHDSNIG 175          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 110.538 bits (275), Expect = 6.467e-24
Identity = 99/344 (28.78%), Postives = 153/344 (44.48%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGN------------YPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQ-NLCSVHYVCSEGNLEIFNQLAVFENFDP--NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNS-GQTALHLA 3076
            +D  G+T LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ A  Y +   LE     I  +T    + + SG              PLH A     ++         ME+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D       +H   + G+ E    L    +     ++ D NG TP+  AV + +   V  L+   A ++  D++GRT  H+ A  G  +C+E LL +      +   G  P+H AA  G+  +   LL+   ++E +    +S G T LH A
Sbjct:  434 KDSFGRTPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLE----LIASETPLDVLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQA--------MEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWA 763          

HSP 2 Score: 97.0561 bits (240), Expect = 9.149e-20
Identity = 109/412 (26.46%), Postives = 174/412 (42.23%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCV--ELILSVAPQLLDTGEKNGYTVLHL-ASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGA--------------------------DIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYN-NVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQ-------YNVNLWKLNNDSNY-----PLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            SY  L  A   G    VK LL+   D+ +     +  L   C+  +  V  ELI      +    EK G+  LH  A+       L  L+    D+N ++ D ++ L +  I+      + + EN AE++  D NG +P+H AA+    L     +       K G                           DID  D + R+ L  A    NL  +  L+  GA    KDS G + LHYA +N N + +  L+      +   D   CT L YA + + +   +E LL   +N    D++  NA H+AS  G    L+++            +   + NDS+      PLH A+Y GH++ +E L+      + +L+ ++ RNS G+T L L+  K ++E   +L+  GA
Sbjct:  206 SYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELI-ECGAHVNQVNEK-GFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGS-GASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLV------QSLLD-LDVRNSQGRTPLDLAAFKGHVECVDVLINQGA 607          

HSP 3 Score: 90.1225 bits (222), Expect = 1.110e-17
Identity = 88/338 (26.04%), Postives = 150/338 (44.38%), Query Frame = 2
Query:  416 PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFL----ITNMEP---------------KEKILN-------FINHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            P  +R L+ K  D+N ++N+ R+ L  A    + E ++LL  + A VN  D   ++P+H A             E + +LLKH AD++  D   ++PL  A  +  +   + L+   + +   D +G + LH+A  +G+LE+                                  V LLL RGSN+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   +V+FL    +   EP               ++ ++N        +N  N  G   LH +    +  +C ++L+ NGAD NI  +  +GK+   MTA+
Sbjct:   21 PDEVRSLIFKKEDVNAQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVA-------SCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEM----------------------------------VRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNI--KSKDGKTPLHMTAI 315          

HSP 4 Score: 85.5001 bits (210), Expect = 2.964e-16
Identity = 101/384 (26.30%), Postives = 172/384 (44.79%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFELILKKTPELVNKFDETNLTI-----LHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPL-LLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLAVFENF-DPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTM---PLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKI 3133
            G F    + I +G E+ +  D++G T LH + +     EL++     + N+ D     I     LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  R     D+ G  PLHYA   C Y     QC   +  L+     +   D    TPL   A +    + +E LL+N AN   RD Q   +VHY            + SE  L++  + +  +   D +V  P  ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K  D T+   P+H AA  G+ E   +L+        V+ ++ +GQT L LA +       + L++K + +
Sbjct:  317 GRFSRSQAIIENGAEI-DCEDKNGNTPLHIAARYGH--ELLINTL--ITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNR----KDSFGRTPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAP--VSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVK--DFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASV 679          

HSP 5 Score: 83.5741 bits (205), Expect = 1.353e-15
Identity = 90/375 (24.00%), Postives = 156/375 (41.60%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHY--ATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIP 1303
            L +A    + + V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       +R LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G DI+  + Y  +PL  A  +     +  LIE GA +   +  G + LH+  A+ +G L +  ++ +    ++++ D    T L     +      + ++E G+ ++ ED                                  + N PLH A+  GH  ++  LITN     K       R  +G   LHL+ +    + C+ LL +G D + P
Sbjct:   78 LHRAVASCSEEAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVRCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDL-------GVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGK--TPLHMTAIHGRFSRSQAIIENGAEIDCED---------------------------------KNGNTPLHIAARYGHELLINTLITNRADTAK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTP 401          

HSP 6 Score: 82.4185 bits (202), Expect = 2.760e-15
Identity = 94/375 (25.07%), Postives = 162/375 (43.20%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN--KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM-------NDYITDKTRFIQIPDNSGNYPL------HYAIEICKYKKSVCQCK--------TYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
            L A+  +G+ EI+   I  G  V+  +D    T LH ++ +  +E  +++LK + + VN  D+   T LH+   +K +     L+   +NVN  D  GRTAL+ A    +L  +  +       N +     R I      G+  +      H A   CK KKS             + ++ LL++  DI   +    TPL +A        V  L++ GA+    + +    +H+  +  +  +  +L V    D N+   +G TP+     +      + +IE  A++D  D+ G T  H AA  G    +  L++   D   +   G  PLH AA  G+ +    LL   S+  +++  ++ G+T LH AA 
Sbjct:   45 LHAAAYLGDAEIIELLILSGARVNA-KDNKWLTPLHRAVASCSEEAVQVLLKHSAD-VNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLL---SSGFDIDTPDDFGRTCLHAAAA 414          

HSP 7 Score: 78.5666 bits (192), Expect = 4.060e-14
Identity = 97/415 (23.37%), Postives = 186/415 (44.82%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC-FK-YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINK----RNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYS----KDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLER--GSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A   G+++ ++ L+++  D+ DVR+   +T L    FK +  CV+++++    +L        T +H A+       LR L+  N D+      ++ + ++ L+LAV+  + + V  L    A V   D  G + +H  A            E +  LL+H A     D   R+P+  A    ++  +  L+     + +     DS G + LH+A  NG+   +++LL+   F     + N  + L  A   +N    E+L++    + VNA+D K R   H A+    ++ LQ+L  +N  +  ++     PL  A+  G    VE L+++ +    I + +        TALHL+  K +     ++L+  +D N+ +  +N    T L +A +N   +++ +   K +  L
Sbjct:  557 AAYHGHHQAMEVLVQSLLDL-DVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIG-NADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGA-------VTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEVF--HKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVK------NTALHLACSKGHETSALLILEKISDRNL-INATNAALQTPLHVAARNGLTVVVQELLAKGASVL 953          

HSP 8 Score: 76.2554 bits (186), Expect = 2.121e-13
Identity = 87/366 (23.77%), Postives = 150/366 (40.98%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVC-----QCKTY------------------------MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+  L+L +    +N FD+ +   +H       IE + LL  + A V   D    T L+ A     ++ ++ + D   D    I  P+  GN PLH A   C   + V      +C  +                        +ELL+    D+  + +  +TPL +          + +++NGA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:  135 VSDRAGRTALHHAAFSGHLEMVRLLLSRGSN-INAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVD----INEPNAYGNTPLHVA---CYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTL-ITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAAASDTDGKCL 488          

HSP 9 Score: 74.3294 bits (181), Expect = 7.439e-13
Identity = 88/356 (24.72%), Postives = 160/356 (44.94%), Query Frame = 2
Query:  269 RDLTDKTLLHYCFK---YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKP-PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNA-----EVNITDV-------NGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSS-GLSILHYATSNGNLEIIQMLLD--DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQ 1279
            +D   +T LHY      Y+ C+  ++     + D  E+ G T LH A+        L YLL  + +   R+N   +++  A  Y +   ++L+          E + TD+         VSP+H AA            + + +L++   D+D  +   R+PL  A    ++  +  LI +GA I  KD +   + +H A +NG+ E +++L+   D +  ++  D N  T LM A    + D V  LL +G++V A+D   R A H  +  G  + ++ L Q+N +    +     P+H A+  GH  ++  L+   +  E +       +S+G T LH +    +    ++LL+
Sbjct:  434 KDSFGRTPLHYAAANCNYQ-CLFALVGSGASVNDLDER-GCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAPVSPLHLAA-------YHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLT---DSHGYTPLHWACYNGHDTCVEVLLE 777          

HSP 10 Score: 73.9442 bits (180), Expect = 9.840e-13
Identity = 90/370 (24.32%), Postives = 153/370 (41.35%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN---NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT----RDIQNLCSVHYVCSEGN---LEIFNQLAVFEN-----FDP-------------------------NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYG-VDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            ++R+  G+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    + V+  DGNG+T L LAV+  +    +C+   + +K   ++  D  G   LH        + +V   +  ME LL+ N     RD   RTP+ LA    H+  +  LL    +  T     D      +H+ C  G+   +E+  +  VF       F P                         N  D    TP+  A    + + ++ L+  NA+++ VD  G++    AAE G    +ELL+S    D   +       LH A  +G++  A ++L   S    +N  N + QT LH+AA
Sbjct:  577 DVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHT---DCVYSLL-NKGASVEAKDKWGRTALH--------RGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEVFHKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAA 934          

HSP 11 Score: 56.9954 bits (136), Expect = 1.734e-7
Identity = 43/145 (29.66%), Postives = 70/145 (48.28%), Query Frame = 2
Query: 2708 VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINEL 3142
            +F+  D N  D    TP+  A    + +I++ LI   A+++  D    T  H+A    + + +++LL +  D  ++  +   PLH AA       AE L+     + NVN  + +G+TALH AA      M  LL+S+ S IN  
Sbjct:   28 IFKKEDVNAQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALV---PLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAF 169          

HSP 12 Score: 53.9138 bits (128), Expect = 1.592e-6
Identity = 71/311 (22.83%), Postives = 125/311 (40.19%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIM-------------SKEIERLPLLLKNNANVNF-----------------------PDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNG-ANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGR 2851
            G+ + V S ++ G  V E +D+ G+T LH      ++E  E +L+     + + D    T +H+                ++ +E LP+L  ++                             +GN  + L+ AVI +N  A E + D  T     +   D     PLH A     +   V +C   ++LLL  N  +   D   ++PL++A       AVE L+ +  A+   +D     ++H  CS+G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G+
Sbjct:  664 GHTDCVYSLLNKGASV-EAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVR-DCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEVFHKAEGNPFSPLHCAVIRDNEGAAEMLID--TLGPTIVNAKDGKNRTPLHAA----AFTDHV-EC---LQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHET--SALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGK 960          

HSP 13 Score: 51.6026 bits (122), Expect = 7.002e-6
Identity = 63/234 (26.92%), Postives = 108/234 (46.15%), Query Frame = 2
Query:  185 VELLKACKEGNNKKVKKLLENCTDVGDVRDLTDK---TLLHY-CF-KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLL-SKNPDI-NKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGA---CIYSKDSSGLSILHYATSNGNLEIIQMLL 856
            V L  AC  G+   +  LL     V  +  LTD    T LH+ C+  +++CVE++L    ++    E N ++ LH A +     +   L+ +  P I N ++  +R+ L  A   D+ E ++LL  +NA+VN  D  G SP+  AA+            +  ++    AD+   D  K + L  A    + T    ++EK +    I + +++  + LH A  NG   ++Q LL
Sbjct:  723 VHLAAAC--GHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLE--QEVFHKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAE------NGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELL 946          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd28b (ankyrin repeat domain 28 [Source:NCBI gene;Acc:101159131])

HSP 1 Score: 110.538 bits (275), Expect = 6.987e-24
Identity = 99/344 (28.78%), Postives = 153/344 (44.48%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSLKN---KELFELILKKTPELVNKFDETNLTILHMVIMSKEIER-LPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGN------------YPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQ-NLCSVHYVCSEGNLEIFNQLAVFENFDP--NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNS-GQTALHLA 3076
            +D  G+T LHY+  N   + LF L+   +   VN  DE   T LH    S    + L  LL+N+AN    D  G  A++ A  Y +   LE     I  +T    + + SG              PLH A     ++         ME+L++   D++ R+   RTPL LA    HVE V+ L+  GA+ L +D       +H   + G+ E    L    +     ++ D NG TP+  AV + +   V  L+   A ++  D++GRT  H+ A  G  +C+E LL +      +   G  P+H AA  G+  +   LL+   ++E +    +S G T LH A
Sbjct:  434 KDSFGRTPLHYAAANCNYQCLFALV--GSGASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLE----LIASETPLDVLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQA--------MEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWA 763          

HSP 2 Score: 97.0561 bits (240), Expect = 9.882e-20
Identity = 109/412 (26.46%), Postives = 174/412 (42.23%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCV--ELILSVAPQLLDTGEKNGYTVLHL-ASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGA--------------------------DIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYN-NVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQ-------YNVNLWKLNNDSNY-----PLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            SY  L  A   G    VK LL+   D+ +     +  L   C+  +  V  ELI      +    EK G+  LH  A+       L  L+    D+N ++ D ++ L +  I+      + + EN AE++  D NG +P+H AA+    L     +       K G                           DID  D + R+ L  A    NL  +  L+  GA    KDS G + LHYA +N N + +  L+      +   D   CT L YA + + +   +E LL   +N    D++  NA H+AS  G    L+++            +   + NDS+      PLH A+Y GH++ +E L+      + +L+ ++ RNS G+T L L+  K ++E   +L+  GA
Sbjct:  206 SYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELI-ECGAHVNQVNEK-GFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGS-GASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLV------QSLLD-LDVRNSQGRTPLDLAAFKGHVECVDVLINQGA 607          

HSP 3 Score: 89.7373 bits (221), Expect = 1.560e-17
Identity = 88/338 (26.04%), Postives = 150/338 (44.38%), Query Frame = 2
Query:  416 PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFL----ITNMEP---------------KEKILN-------FINHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKS---MTAL 1339
            P  +R L+ K  D+N ++N+ R+ L  A    + E ++LL  + A VN  D   ++P+H A             E + +LLKH AD++  D   ++PL  A  +  +   + L+   + +   D +G + LH+A  +G+LE+                                  V LLL RGSN+NA D K R A H+A+  G ++ +++L  +   +   +  S  PLH A+  G   +V+FL    +   EP               ++ ++N        +N  N  G   LH +    +  +C ++L+ NGAD NI  +  +GK+   MTA+
Sbjct:   21 PDEVRSLIFKKEDVNAQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVA-------SCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEM----------------------------------VRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNI--KSKDGKTPLHMTAI 315          

HSP 4 Score: 85.5001 bits (210), Expect = 3.016e-16
Identity = 101/384 (26.30%), Postives = 172/384 (44.79%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFELILKKTPELVNKFDETNLTI-----LHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPL-LLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHY------------VCSEGNLEIFNQLAVFENF-DPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTM---PLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKI 3133
            G F    + I +G E+ +  D++G T LH + +     EL++     + N+ D     I     LH+  +S   +    LL +  +++ PD  GRT L+ A    NL  L  + +   D  R     D+ G  PLHYA   C Y     QC   +  L+     +   D    TPL   A +    + +E LL+N AN   RD Q   +VHY            + SE  L++  + +  +   D +V  P  ++P+  A  + + + ++ L++    LD+ +  GRT    AA KG  +C+++L++ G     K  D T+   P+H AA  G+ E   +L+        V+ ++ +GQT L LA +       + L++K + +
Sbjct:  317 GRFSRSQAIIENGAEI-DCEDKNGNTPLHIAARYGH--ELLINTL--ITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNR----KDSFGRTPLHYAAANCNY-----QC---LFALVGSGASVNDLDERGCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAP--VSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVK--DFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASV 679          

HSP 5 Score: 82.8037 bits (203), Expect = 2.291e-15
Identity = 90/375 (24.00%), Postives = 156/375 (41.60%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCF--KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHY--ATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIP 1303
            L +A    + + V+ LL++  DV + RD   +T LH     K   C E ++ +   + +  ++ G T LH A+       +R LLS+  +IN  +   R ++  A    + E VKLL  + AEV   D    +P+H AA        +  L++       G DI+  + Y  +PL  A  +     +  LIE GA +   +  G + LH+  A+ +G L +  ++ +    ++++ D    T L     +      + ++E G+ ++ ED                                  + N PLH A+  GH  ++  LITN     K       R  +G   LHL+ +    + C+ LL +G D + P
Sbjct:   78 LHRAVASCSEEAVQVLLKHSADV-NARDKNWQTPLHIAAANKAVRCAEALVPLLSNV-NVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDL-------GVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGK--TPLHMTAIHGRFSRSQAIIENGAEIDCED---------------------------------KNGNTPLHIAARYGHELLINTLITNRADTAK-------RGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTP 401          

HSP 6 Score: 82.4185 bits (202), Expect = 3.057e-15
Identity = 94/375 (25.07%), Postives = 162/375 (43.20%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN--KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECM-------NDYITDKTRFIQIPDNSGNYPL------HYAIEICKYKKSVCQCK--------TYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
            L A+  +G+ EI+   I  G  V+  +D    T LH ++ +  +E  +++LK + + VN  D+   T LH+   +K +     L+   +NVN  D  GRTAL+ A    +L  +  +       N +     R I      G+  +      H A   CK KKS             + ++ LL++  DI   +    TPL +A        V  L++ GA+    + +    +H+  +  +  +  +L V    D N+   +G TP+     +      + +IE  A++D  D+ G T  H AA  G    +  L++   D   +   G  PLH AA  G+ +    LL   S+  +++  ++ G+T LH AA 
Sbjct:   45 LHAAAYLGDAEIIELLILSGARVNA-KDNKWLTPLHRAVASCSEEAVQVLLKHSAD-VNARDKNWQTPLHIAAANKAVRCAEALVPLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVDINEPNAYGNTPLHVACYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTLITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLL---SSGFDIDTPDDFGRTCLHAAAA 414          

HSP 7 Score: 77.411 bits (189), Expect = 9.484e-14
Identity = 115/488 (23.57%), Postives = 196/488 (40.16%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYC--FKYESCVELILSVAPQ-----------LLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVN-GVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD-DYKF-------------------------------DLET----TDSNNCTALMYACSYNNVDV-VELLLER-----------------------GSN-----------VNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            A  + + K ++ LL N  + G +RD      +HY   + +  C+ELI S  P            L D+  +   + LHLA+      ++  L+    D++ RN+  R+ L LA    + E V +L    A + + D     +P+H AA           +   ++       +D  D   ++PLM AV S +   +  L+ KGA + +KD  G + LH     G+ E ++ LL  +  F                                +ET    TDS+  T L +AC YN  D  VE+LLE+                       G+            VNA+D K R   H A+    ++ LQ+L  +N  +  ++     PL  A+  G    VE L+++ +    I + +        TALHL+  K +     ++L+  +D N+ +  +N    T L +A +N   +++ +   K +  L
Sbjct:  479 AASDTDGKCLEYLLRNDANPG-IRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLLDLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSA----VDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWAC-YNGHDTCVEVLLEQEVFHKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVK------NTALHLACSKGHETSALLILEKISDRNL-INATNAALQTPLHVAARNGLTVVVQELLAKGASVL 953          

HSP 8 Score: 76.2554 bits (186), Expect = 2.330e-13
Identity = 87/366 (23.77%), Postives = 150/366 (40.98%), Query Frame = 2
Query: 2102 IRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVC-----QCKTY------------------------MELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCF 3106
            + D++G+T LH++    + E+  L+L +    +N FD+ +   +H       IE + LL  + A V   D    T L+ A     ++ ++ + D   D    I  P+  GN PLH A   C   + V      +C  +                        +ELL+    D+  + +  +TPL +          + +++NGA     D      +H     G+  + N L +    D      +G+ P+  A  +      ++L+     +D  D +GRT  H AA  G  +CL LLL+ G D   K   G  PLH AA     +    L+ + +++ +++E+   G T LH AA  +    C 
Sbjct:  135 VSDRAGRTALHHAAFSGHLEMVRLLLSRGSN-INAFDKKDRRAIHWAAYMGHIEVVKLLASHGAEVTCKDKKSYTPLHAAASSGMISVVKFLLDLGVD----INEPNAYGNTPLHVA---CYNGQDVVVNELIECGAHVNQVNEKGFAPLHFTAASRHGALCLELLVCNGADVNIKSKDGKTPLHMTAIHGRFSRSQAIIENGAEIDCEDKNGNTPLHIAARYGHELLINTL-ITNRADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNRKDSFGRTPLHYAAANCNYQCLFALVGSGASVNDLDER---GCTPLHYAAASDTDGKCL 488          

HSP 9 Score: 73.9442 bits (180), Expect = 9.277e-13
Identity = 88/356 (24.72%), Postives = 158/356 (44.38%), Query Frame = 2
Query:  269 RDLTDKTLLHYCFK---YESCVELILSVAPQLLDTGEKNGYTVLHLASMIKP-PTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNA-----EVNITDV-------NGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSS-GLSILHYATSNGNLEIIQMLLD--DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQ 1279
            +D   +T LHY      Y+ C+  ++     + D  E+ G T LH A+        L YLL  + +   R+N   +++  A  Y +   ++L+          E + TD+         VSP+H AA        E  ++ +        D+D  +   R+PL  A    ++  +  LI +GA I  KD +   + +H A +NG+ E +++L+   D +  ++  D N  T LM A    + D V  LL +G++V A+D   R A H  +  G  + ++ L Q+N +    +     P+H A+  GH  ++  L+   +  E +       +S+G T LH +    +    ++LL+
Sbjct:  434 KDSFGRTPLHYAAANCNYQ-CLFALVGSGASVNDLDER-GCTPLHYAAASDTDGKCLEYLLRNDANPGIRDNQGYNAVHYASAYGHRLCLELIASETPLDVLMETSGTDILNDSDVRAPVSPLHLAAYHGHHQAMEVLVQSLL-------DLDVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHTDCVYSLLNKGASVEAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLT---DSHGYTPLHWACYNGHDTCVEVLLE 777          

HSP 10 Score: 73.559 bits (179), Expect = 1.280e-12
Identity = 90/370 (24.32%), Postives = 153/370 (41.35%), Query Frame = 2
Query: 2099 EIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKN---NANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLT----RDIQNLCSVHYVCSEGN---LEIFNQLAVFEN-----FDP-------------------------NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYG-VDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAA 3079
            ++R+  G+T L  +    + E  ++++ +   ++ K      T +H    +   E L LL+ N    + V+  DGNG+T L LAV+  +    +C+   + +K   ++  D  G   LH        + +V   +  ME LL+ N     RD   RTP+ LA    H+  +  LL    +  T     D      +H+ C  G+   +E+  +  VF       F P                         N  D    TP+  A    + + ++ L+  NA+++ VD  G++    AAE G    +ELL+S    D   +       LH A  +G++  A ++L   S    +N  N + QT LH+AA
Sbjct:  577 DVRNSQGRTPLDLAAFKGHVECVDVLINQGASILVKDFTLKRTPIHAAATNGHSECLRLLIGNADLQSAVDIQDGNGQTPLMLAVLSGHT---DCVYSLL-NKGASVEAKDKWGRTALH--------RGAVTGHEECMEALLQHNASFLVRDCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEVFHKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAA 934          

HSP 11 Score: 57.7658 bits (138), Expect = 8.735e-8
Identity = 83/349 (23.78%), Postives = 140/349 (40.11%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIM-------------SKEIERLPLLLKNNANVNF-----------------------PDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNG-ANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDP----NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAE-KGAFKCLELLLSYGVDPWSKCHDG-TMPL 2959
            G+ + V S ++ G  V E +D+ G+T LH      ++E  E +L+     + + D    T +H+                ++ +E LP+L  ++                             +GN  + L+ AVI +N  A E + D  T     +   D     PLH A     +   V +C   ++LLL  N  +   D   ++PL++A       AVE L+ +  A+   +D     ++H  CS+G+    + L + E        N T+    TP+  A  N    +V+ L+   A +  VD+ G T     A  K    CL L+L+  + P S C    T+P 
Sbjct:  664 GHTDCVYSLLNKGASV-EAKDKWGRTALHRGAVTGHEECMEALLQHNASFLVR-DCRGRTPVHLAAACGHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLEQEVFHKAEGNPFSPLHCAVIRDNEGAAEMLID--TLGPTIVNAKDGKNRTPLHAA----AFTDHV-EC---LQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAKADLTIQDAVKNTALHLACSKGHET--SALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYTPALACAPNKDVADCLALILAT-MMPVSPCTSAPTLPF 997          

HSP 12 Score: 56.6102 bits (135), Expect = 2.161e-7
Identity = 43/145 (29.66%), Postives = 70/145 (48.28%), Query Frame = 2
Query: 2708 VFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINEL 3142
            +F+  D N  D    TP+  A    + +I++ LI   A+++  D    T  H+A    + + +++LL +  D  ++  +   PLH AA       AE L+     + NVN  + +G+TALH AA      M  LL+S+ S IN  
Sbjct:   28 IFKKEDVNAQDNEKRTPLHAAAYLGDAEIIELLILSGARVNAKDNKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVRCAEALV---PLLSNVNVSDRAGRTALHHAAFSGHLEMVRLLLSRGSNINAF 169          

HSP 13 Score: 53.5286 bits (127), Expect = 1.871e-6
Identity = 71/268 (26.49%), Postives = 120/268 (44.78%), Query Frame = 2
Query:  185 VELLKACKEGNNKKVKKLLENCTDVGDVRDLTDK---TLLHY-CF-KYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLL-SKNPDI-NKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGA---CIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLL 958
            V L  AC  G+   +  LL     V  +  LTD    T LH+ C+  +++CVE++L    ++    E N ++ LH A +     +   L+ +  P I N ++  +R+ L  A   D+ E ++LL  +NA+VN  D  G SP+  AA+       E  +          AD+   D  K + L  A    + T    ++EK +    I + +++  + LH A  NG   ++Q LL      L   ++    AL  A + +  D + L+L
Sbjct:  723 VHLAAAC--GHIGVLGGLLHAAQSVETLPVLTDSHGYTPLHWACYNGHDTCVEVLLE--QEVFHKAEGNPFSPLHCAVIRDNEGAAEMLIDTLGPTIVNAKDGKNRTPLHAAAFTDHVECLQLLLSHNAQVNTVDAAGKSPLMMAAENGQTNAVELLVSSAK------ADLTIQDAVKNTALHLACSKGHETSALLILEKISDRNLINATNAALQTPLHVAARNGLTVVVQELLAKGASVLAVDENGYTPALACAPNKDVADCLALIL 980          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankrd52a (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C [Source:NCBI gene;Acc:101155432])

HSP 1 Score: 107.842 bits (268), Expect = 4.250e-23
Identity = 116/457 (25.38%), Postives = 190/457 (41.58%), Query Frame = 2
Query: 1928 SEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPN--GLTPIFYAVSN-----CNEKIV-----------------------------KRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTP---------------SAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINE 3139
            +EE Q+L   TE+ N ++ +R         +  L A+  +G+  I+   I  G  V+ ++DQ   T LH +   +N+    L+L++  E  N  D+   T LH+   ++       LL + +N+N  D  GRTAL+ A      +  + M   + +K   +   D     P+H A  +   +         ++LLL  + D  C+D++  TPL  A    H+E V+ LL+ GA     +     ++H  C  G   +  +L    N   NV  PN  G TP+  A  +     C E +V                             + LI+    +D VD+YG T  H AA+ G    +  L++ G D   +   G  PLH A   G+ +    LL++                SA   +N  +N G+T LH AA   +     LL+S  + +N+
Sbjct:   21 AEEVQLLLHKTEDVNALDQER---------RTPLHAAACVGDVHIIDLLIESGASVN-VKDQVWLTPLHRAAASRNERAVSLLLRRGAE-ANARDKFWQTPLHVASANRATRCAEALLSHLSNLNIADRTGRTALHHAA----QSGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLE--------VVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMACYMGQEAVATELV---NHGANVNQPNKCGYTPLHLAAVSTNGALCLELLVNNGADVNQQSKEGKSPLHMAAIHGRFTRSQILIQNGGDIDCVDKYGNTPLHVAAKYGHELLISTLMTNGADTARRGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVSSMSKEHVLSAGFEINTPDNFGRTCLHAAASGGNVECLNLLLSSGADLNK 451          

HSP 2 Score: 104.375 bits (259), Expect = 4.875e-22
Identity = 104/375 (27.73%), Postives = 163/375 (43.47%), Query Frame = 2
Query: 1976 INSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNK--ELFELILKKTPELVNKFDETNL---TILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCN-EKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
            +N    +  I +  +  +  +  +G+ E+V   +    + S  +D+ G T LH +  +   E+ + +L+   E+    DE N    T LHM     +      L+ + ANVN P+  G T L+LA +  N A   C+   + +     Q     G  PLH A    ++ +S        ++L++  GDI+C D+   TPL +A    H   + TL+ NGA+   R I  +  +H             LAV   F            ++  VS+ + E ++    E+N      D +GRT  H AA  G  +CL LLLS G D   +   G  PLH AA  G  +    L+   SA   VNE + +G T LH +A 
Sbjct:  160 LNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKS-CKDKLGYTPLHAAAASGHIEIVKYLLRMGAEI----DEPNTFGNTALHMACYMGQEAVATELVNHGANVNQPNKCGYTPLHLAAVSTNGAL--CLELLVNNGADVNQ-QSKEGKSPLHMAAIHGRFTRS--------QILIQNGGDIDCVDKYGNTPLHVAAKYGHELLISTLMTNGADTARRGIHGMFPLH-------------LAVLYGFSDCCRKLLSSGQLYSIVSSMSKEHVLSAGFEINTP----DNFGRTCLHAAASGGNVECLNLLLSSGADLNKRDIMGRTPLHYAAANGRYQCTVTLV---SAGAEVNESDQTGCTPLHYSAA 498          

HSP 3 Score: 100.908 bits (250), Expect = 5.830e-21
Identity = 105/387 (27.13%), Postives = 163/387 (42.12%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKEL-FELILKKTPELVNKFDETNLTILHMVIMSKEIER----------------------LPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQ--IPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGAN-FLTRDIQNLCSVHYVCSEGNLEIFNQLAVF--ENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNE-KNNSGQTALHLAAVRN--DC 3094
            L A+   GN E +   +  G ++++ RD  G+T LHY+  N      + L      VN+ D+T  T LH    S+   R                      L  LL + A+ +  +  G +A++ A  + N   LE + +   +    I+  IP +    PLH A +   ++         + LL E    ++ +D   R+ L LA    HV  VE LL  GA+ FL  +      +H   + G+ +    +  +  E    NV D  G TP+  AV   +   V+ L+E  +  D  D+ G T  H+AA  G   C+  LL +   P  +   G  PLH AA RG  EI   L+    A +  ++  +N   T LH AA +   DC
Sbjct:  427 LHAAASGGNVECLNLLLSSGADLNK-RDIMGRTPLHYAAANGRYQCTVTLVSAGAEVNESDQTGCTPLHYSAASQAFGRVERHFSGNHQKEEEEEKGSYFCLEHLLDSGADPSMVNSKGYSAVHYAAYHGNKQNLELLLEMSFNALGDIESSIPVS----PLHLAADNGHWQA--------LRLLTETAAYVDMQDAAGRSVLYLAAQKGHVRCVEVLLAQGASCFLNDNRLMWTPIHVAAANGHSDCLRMMIDYGEEGDLTNVADKFGQTPLMLAVLGGHTDCVRFLLERASSPDAQDKRGSTALHRAAVLGHDDCVTALLKHKASPLCRDIQGRTPLHYAASRGQTEILSSLMQAAVAADPQDQLLDNKQYTPLHWAAYKGHEDC 800          

HSP 4 Score: 89.3521 bits (220), Expect = 2.109e-17
Identity = 83/327 (25.38%), Postives = 152/327 (46.48%), Query Frame = 2
Query:  425 LRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEIC-KILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSD 1402
            ++ LL K  D+N  + + R+ L  A    +   + LL E+ A VN+ D   ++P+H AA  +           +++LL+ GA+ +  D + ++PL  A  +      + L+   + +   D +G + LH+A  +G  E++++LL+    +L   D      +  A    +++VV+LLL R ++ + +D       H A+  G ++ ++ L +    + + N   N  LH A Y G   +   L+ +          +N  N  G T LHL+ V  N  +C ++L+ NGAD N   +   GKS   +   +   T+  I+  NG   D
Sbjct:   24 VQLLLHKTEDVNALDQERRTPLHAAACVGDVHIIDLLIESGASVNVKDQVWLTPLHRAAASR-------NERAVSLLLRRGAEANARDKFWQTPLHVASANRATRCAEALLSHLSNLNIADRTGRTALHHAAQSGFQEMVKLLLNK-GANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMACYMGQEAVATELVNHGAN-------VNQPNKCGYTPLHLAAVSTNGALCLELLVNNGADVN--QQSKEGKSPLHMAAIHGRFTRSQILIQNGGDID 333          

HSP 5 Score: 85.1149 bits (209), Expect = 3.806e-16
Identity = 99/413 (23.97%), Postives = 180/413 (43.58%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILS-VAPQLLDTGEK--NGYTVLHLASM------------------IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTK----------------------MKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLD---DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNY-PLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            A   G   + + L++N  D+ D  D    T LH   KY    EL++S +     DT  +  +G   LHLA +                  I    S  ++LS   +IN  +N  R+ L  A    N E + LL  + A++N  D+ G +P+HYAA            +    L+  GA+++  D    +PL ++  S    +                      ++HL++ GA     +S G S +HYA  +GN + +++LL+   +   D+E+  S   + L  A    +   + LL E  + V+ +D+  R+  + A+ KG ++ ++VL     + +  +N   + P+H A+  GH++ +  +I   E  +      N  +  GQT L L+ +  + +  + LL+  + P+
Sbjct:  313 AAIHGRFTRSQILIQNGGDI-DCVDKYGNTPLHVAAKYGH--ELLISTLMTNGADTARRGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVSSMSKEHVLSAGFEINTPDNFGRTCLHAAASGGNVECLNLLLSSGADLNKRDIMGRTPLHYAAA-------NGRYQCTVTLVSAGAEVNESDQTGCTPLHYSAASQAFGRVERHFSGNHQKEEEEEKGSYFCLEHLLDSGADPSMVNSKGYSAVHYAAYHGNKQNLELLLEMSFNALGDIES--SIPVSPLHLAADNGHWQALRLLTETAAYVDMQDAAGRSVLYLAAQKGHVRCVEVLLAQGASCFLNDNRLMWTPIHVAAANGHSDCLRMMIDYGEEGD----LTNVADKFGQTPLMLAVLGGHTDCVRFLLERASSPD 709          

HSP 6 Score: 83.5741 bits (205), Expect = 1.370e-15
Identity = 103/451 (22.84%), Postives = 188/451 (41.69%), Query Frame = 2
Query:  179 SYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGE------KNGYTVLHLASM-IKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAV------CSNNL------------TKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL----DDYKFDLET----------------------------TDSNNCTALMYAC---SYNNVD-------------------VVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDS--NYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
             Y  L  A   G+ + VK LL    ++ +     +  L   C+  +       +VA +L++ G       K GYT LHLA++       L  L++   D+N+++ + +S L +A I+      ++L +N  +++  D  G +P+H AAK            +I+ L+ +GAD     ++   PL  AV      C   L               +H++  G  I + D+ G + LH A S GN+E + +LL    D  K D+                              +D   CT L Y+    ++  V+                    +E LL+ G++ +  +SK  +A H+A+  G+ +NL++L + + N       S    PLH A+  GH + +  L            +++ +++ G++ L+L+  K ++   ++LL  GA
Sbjct:  206 GYTPLHAAAASGHIEIVKYLLRMGAEIDEPNTFGNTALHMACYMGQE------AVATELVNHGANVNQPNKCGYTPLHLAAVSTNGALCLELLVNNGADVNQQSKEGKSPLHMAAIHGRFTRSQILIQNGGDIDCVDKYGNTPLHVAAKYG-------HELLISTLMTNGADTARRGIHGMFPLHLAVLYGFSDCCRKLLSSGQLYSIVSSMSKEHVLSAGFEINTPDNFGRTCLHAAASGGNVECLNLLLSSGADLNKRDIMGRTPLHYAAANGRYQCTVTLVSAGAEVNESDQTGCTPLHYSAASQAFGRVERHFSGNHQKEEEEEKGSYFCLEHLLDSGADPSMVNSKGYSAVHYAAYHGNKQNLELLLEMSFNALGDIESSIPVSPLHLAADNGHWQALRLLTETAA-------YVDMQDAAGRSVLYLAAQKGHVRCVEVLLAQGA 636          

HSP 7 Score: 79.7221 bits (195), Expect = 1.804e-14
Identity = 93/401 (23.19%), Postives = 175/401 (43.64%), Query Frame = 2
Query:  191 LLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHY--CFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYAC----------------------------------SYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNG 1285
            L++A    N ++V+ LL    DV +  D   +T LH   C      ++L++     + +  ++   T LH A+  +   ++  LL +  + N R+   ++ L +A         + L  + + +NI D  G + +H+AA+           E++ +LL  GA++  +D  +R P+  A    +L  +K L+ +      KD  G + LH A ++G++EI++ LL     +++  ++   TAL  AC                                  S N    +ELL+  G++VN +  + ++  H A+  G     Q+L Q   ++  ++   N PLH A+  GH  ++  L+TN     +       R  +G   LHL+ +    + C+ LL +G
Sbjct:   12 LVQAIFSRNAEEVQLLLHKTEDV-NALDQERRTPLHAAACVGDVHIIDLLIESGASV-NVKDQVWLTPLHRAAASRNERAVSLLLRRGAEANARDKFWQTPLHVASANRATRCAEALLSHLSNLNIADRTGRTALHHAAQ-------SGFQEMVKLLLNKGANLSAIDKKERQPIHCAAYLGHLEVVKLLLSRSNDKSCKDKLGYTPLHAAAASGHIEIVKYLLR-MGAEIDEPNTFGNTALHMACYMGQEAVATELVNHGANVNQPNKCGYTPLHLAAVSTNGALCLELLVNNGADVNQQSKEGKSPLHMAAIHGRFTRSQILIQNGGDIDCVDKYGNTPLHVAAKYGHELLISTLMTNGADTAR-------RGIHGMFPLHLAVLYGFSDCCRKLLSSG 395          

HSP 8 Score: 77.411 bits (189), Expect = 8.157e-14
Identity = 78/332 (23.49%), Postives = 145/332 (43.67%), Query Frame = 2
Query:  311 YESCVELILSVAPQ--LLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDG--LDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFD-LETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQV-LHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGA 1288
            +  C+ +++    +  L +  +K G T L LA +      +R+LL +    + ++    ++L  A +  + + V  L ++ A     D+ G +P+HYAA         + ++         AD     LD  + +PL WA    +   ++ L+E    I+ ++ +  + LH A  NG+    + LL+  +   +   D+   + L  A    +V  ++L+L  G+ +NA D+  R+A   A+ KG    + + LH+   +L  L+ + N  LH A  K H      ++  +         IN  NS  Q  LHL+       + + LL  GA
Sbjct:  658 HSDCLRMMIDYGEEGDLTNVADKFGQTPLMLAVLGGHTDCVRFLLERASSPDAQDKRGSTALHRAAVLGHDDCVTALLKHKASPLCRDIQGRTPLHYAASRGQTEILSSLMQAAV-----AADPQDQLLDNKQYTPLHWAAYKGHEDCLEVLLELKTFIH-EEGNPFTPLHCALMNGHCSAAERLLESARVHVINCRDAKGRSPLHAAAFAEDVAGLQLVLRHGAEINAVDNSGRSALMVAADKGHSGTVAILLHRAKADLTLLDENKNTALHLACSKAHEMCALLILGEIHSP----TLINATNSALQMPLHLAARNGLATVVQALLSRGA 979          

HSP 9 Score: 55.4546 bits (132), Expect = 5.026e-7
Identity = 45/148 (30.41%), Postives = 71/148 (47.97%), Query Frame = 2
Query: 2699 QLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINEL 3142
            QL + +  D N  D    TP+  A    +  I+  LIE  A +++ DQ   T  H+AA     + + LLL  G +  ++      PLH A+       AE LL   S + N+N  + +G+TALH AA      M  LL++K + ++ +
Sbjct:   25 QLLLHKTEDVNALDQERRTPLHAAACVGDVHIIDLLIESGASVNVKDQVWLTPLHRAAASRNERAVSLLLRRGAEANARDKFWQTPLHVASANRATRCAEALL---SHLSNLNIADRTGRTALHHAAQSGFQEMVKLLLNKGANLSAI 169          

HSP 10 Score: 52.373 bits (124), Expect = 3.702e-6
Identity = 80/344 (23.26%), Postives = 135/344 (39.24%), Query Frame = 2
Query:  260 GDVRDLTDK-----TLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVN----ITDVNGVSPMHYAA--------KVKAXXXXXXXXXXXXXXXKHGADIDG-------------------LDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLL---ERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYP-LHEASYKGHNEIVEFLITNMEP 1171
            GD+ ++ DK      +L     +  CV  +L  A    D  +K G T LH A+++     +  LL        R+   R+ L  A      E +  L +     +    + D    +P+H+AA        +V   L+     E       H A ++G                    D   RSPL  A  + ++  ++ ++  GA I + D+SG S L  A   G+   + +LL   K DL   D N  TAL  ACS  +     L+L      + +NA +S  +   H A+  G    +Q L      +  ++ + + P L  A  K   + +  +++ M+P
Sbjct:  672 GDLTNVADKFGQTPLMLAVLGGHTDCVRFLLERASSP-DAQDKRGSTALHRAAVLGHDDCVTALLKHKASPLCRDIQGRTPLHYAASRGQTEILSSLMQAAVAADPQDQLLDNKQYTPLHWAAYKGHEDCLEVLLELKTFIHEEGNPFTPLHCALMNGHCSAAERLLESARVHVINCRDAKGRSPLHAAAFAEDVAGLQLVLRHGAEINAVDNSGRSALMVAADKGHSGTVAILLHRAKADLTLLDENKNTALHLACSKAHEMCALLILGEIHSPTLINATNSALQMPLHLAARNGLATVVQALLSRGATVLAVDEEGHTPALACAPNKDVADCLALILSTMKP 1014          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000013802.1 (SMESG000013802.1)

HSP 1 Score: 2399.39 bits (6217), Expect = 0.000e+0
Identity = 1281/1305 (98.16%), Postives = 1287/1305 (98.62%), Query Frame = 2
Query:  173 MGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDLLKTSTINXXXXXXXXXXXXXXXXXXXXXFDSAGEIDENQKKIDSDAEEINSTYEQILNTQDEIDLRNEEVDDAHIQIHNTEEQVD--------------DTHIQINDTEVQVDHTHIQINDKLEQIDSAEINNSIETNNLKDTNEFDEVYWKETNQNFNNQLKTSELSPDFNNEPVKLTNSKKIKDSSEECQILPKFTENENEINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPDCKNTLKTFGGRSAKKVINCSNSELDYSTQYNAEVELVPQVNGYDISAPVSIRSTELALSTVPSAVYTYRTNEICSSKNIQSIQVLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFGEAKEGSCASVKINNPQVFESLPSSQLHRVDTGQDSKTYHETTSRCKSTHLIPSTNSIEFQKMSTCQTESILXXXXXXXXXXXXXXXXXXXXXXXXXXXDKNLQKKVQKSVINYEYIRLNCKVANDIARLKFREENIEKLINPKMTKLHKTGCKKTQNHKIAAV 4045
            MGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESC ELILSVAP+LLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKACLECENELEIINILLKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLL+DYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEK+LNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDLLKTSTINEEITGSISDESSSEEISENSSFDSAGEIDENQKKIDSDAEEINSTYEQILNTQDEIDLRNEEVD AHIQIHNTEEQVD              DTHIQINDTEVQVDHTHIQINDKLEQIDSAEINNSIETNNLKDTNEFDEVYW ETNQNFNNQLKTSELSPDFNNEPVKLTNSKKIKDSSEECQILPKFTENENEINSKRQIIEIT+SYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTAL+LAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPDCKNTLKTFGGRSAKKVINCSNSELDYSTQYNAE+ELVPQVNGYDISAPVSIRSTELALSTVPSAVYTYRTNEICSSKNIQSIQVLQNSKTTSKKSDNSSKKKISLSSSDKSSTNISFGEAKEGSCASVKINNPQVFESLPSSQLHRVDTGQDSKTYHETTSRCKSTHLIPSTNSIEFQKMSTCQTESILSSNRKKSTTQSKS NSSNKKQKKSPPSDKNLQKKVQKSVINYEYIRLNCKVANDIARLKFREENIEKLINPKMTKLHKTGCKKTQNHKIAAV
Sbjct:    1 MGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCAELILSVAPELLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKACLECENELEIINILLKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLEDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKLLNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDLLKTSTINEEITGSISDESSSEEISENSSFDSAGEIDENQKKIDSDAEEINSTYEQILNTQDEIDLRNEEVDYAHIQIHNTEEQVDHTHIQIHNTEEQVDDTHIQINDTEVQVDHTHIQINDKLEQIDSAEINNSIETNNLKDTNEFDEVYWNETNQNFNNQLKTSELSPDFNNEPVKLTNSKKIKDSSEECQILPKFTENENEINSKRQIIEITKSYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALHLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEELTAYDLATTPDCKNTLKTFGGRSAKKVINCSNSELDYSTQYNAEIELVPQVNGYDISAPVSIRSTELALSTVPSAVYTYRTNEICSSKNIQSIQVLQNSKTTSKKSDNSSKKKISLSSSDKSSTNISFGEAKEGSCASVKINNPQVFESLPSSQLHRVDTGQDSKTYHETTSRCKSTHLIPSTNSIEFQKMSTCQTESILSSNRKKSTTQSKSANSSNKKQKKSPPSDKNLQKKVQKSVINYEYIRLNCKVANDIARLKFREENIEKLINPKMTKLHKTGCKKTQNHKIAAV 1305          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000048145.1 (SMESG000048145.1)

HSP 1 Score: 159.844 bits (403), Expect = 3.459e-39
Identity = 120/426 (28.17%), Postives = 220/426 (51.64%), Query Frame = 2
Query:  182 YVELLKACKEGNNKKVKKLLENCTDVGDVRDLTD-----KTLLHYCFKYE--SCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVN-GVSPMHYAAK--VKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNI---P----LRVSNGKSMTALDLANKNETKLLIVKFNGKSSDDL 1408
            Y  ++ ACK  + + +  L+EN +D     ++       +T LH+C       C E +L +   L+   +KNG+TVLHLA++      ++ L+    +   ++ND  +SL  AV+    + + L  + + ++     N G S +HYA +  +      +  + I  +L  +  +++ +D   R+PL+WA         + L+E  A +  +D +GLS+LH A S G+ ++I ++++ +   ++  D+N CT L YA +  ++ ++  L+E+ SN N +D K R+  H A+ KG    L ++ +   +L   NN+ + PLHEA+  G  ++ E L+  ME   + L  IN  N  G T LH +   ++ +ICK+L+  GA+ NI   P     + +   ++T LDLA+ + T  ++  F GK + +L
Sbjct:  267 YSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNPDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVVCCATDLIDLFFKIDPDIIKIIDNHGASAIHYATQSFLSPEGSVQGPIVIEKLLKNNKENVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNE-LELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKPNQDITKETANFNLTPLDLASDSLTIDILKDFRGKKATEL 691          

HSP 2 Score: 159.844 bits (403), Expect = 3.769e-39
Identity = 129/426 (30.28%), Postives = 214/426 (50.23%), Query Frame = 2
Query: 2027 LFASCRIGNFEIVCSFIHDGGEVSEIR------DQSGKTLLHYSLKNKEL--FELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGD-IECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTP---SAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSD------NEELTAYDLATTPDCKNTLKTFGGRSAKKV 3250
            +  +C+  +F+++   I +  + SE +      D   +T LH+ + N +    E +LK    L+ K D+   T+LH+  ++  I+ + LL+KN +N    D +G T+L+ AV+     A + ++ +       I+I DN G   +HYA +     +   Q    +E LL+ N + + C D  SRTPLL A ++   +  + LL+N A+   RD   L  +H   S G+ ++ + +    +   ++ D N  TP+FYAV+  +  I+  LIE  +  +  D  GR++ H AA KG    L+L+   G     + ++G +PLHEAA  G  ++ E+LLN     + +E +NE N  G T LH AA  N   +C LLIS+ + +N L     D      N  LT  DLA+     + LK F G+ A ++
Sbjct:  270 VIIACKNSDFQMLSDLIENESD-SEAKLNMLKVDNELRTPLHHCVDNPDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGSNTKDQDNDGHTSLHWAVV---CCATDLIDLFFKIDPDIIKIIDNHGASAIHYATQSFLSPEGSVQGPIVIEKLLKNNKENVNCVDYDSRTPLLWAASLGITDCCQILLENSADLNHRDCNGLSVLHCAASRGHYDVIDLIVNTWSMPVDIEDNNLCTPLFYAVTLKHMSIIHFLIEQRSNPNQQDIKGRSVAHCAALKGYCDILDLIRKAGGSLTLRNNNGDLPLHEAAETGKFDVCELLLNKMEECNELELINEFNKKGMTPLHKAAHNNHHKICKLLISRGANVNILSKPNQDITKETANFNLTPLDLASDSLTIDILKDFRGKKATEL 691          

HSP 3 Score: 78.5666 bits (192), Expect = 3.126e-14
Identity = 82/308 (26.62%), Postives = 136/308 (44.16%), Query Frame = 2
Query: 2204 DETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRD--RVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVC---SEGNLEIFNQLAVFENFDPNVTDPN---GLTPIFYAVSNCNEKIVKRLIE----LNAKLDI--VDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKC-HDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAV 3082
            D    T  H  I+   ++ L + L    N    D  G T ++L++ YN+L ALE +N Y  + +      + SG  PL YA++I             ++ LL++N ++  ++  +  RT L  A+ +++ E    LLKN A    +D ++   +  V     +  L I    +  E F     +PN   G +P+  A  N + +++  LIE      AKL++  VD   RT  H   +    KC E LL        K   +G   LH A      ++ ++L+   S   N  +++N G T+LH A V
Sbjct:   85 DSMGRTFAHWSILLHCLDLLAVALGLGCNPMLQDSEGETIMHLSIRYNDLMALETINLYSNNPSVLESPSETSGATPLIYAVQIGAVD--------IVKKLLQLNVNVNAQENNKYKRTALHYALFIDNEEIFTLLLKNKAKSDIKDYKDKSVIDRVAEYPKDNFLRIITHYSSSEIFSTPSNNPNNPIGYSPVIIACKNSDFQMLSDLIENESDSEAKLNMLKVDNELRTPLHHCVDNPDTKCAEKLLKLDTSLIGKKDKNGFTVLHLATIANNIKLVQLLVKNGS---NTKDQDNDGHTSLHWAVV 381          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 133.265 bits (334), Expect = 7.549e-31
Identity = 108/395 (27.34%), Postives = 190/395 (48.10%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQL-LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMT--ALDLANKNETKLLI 1375
            ACK G  + ++ L+ N  D+ + RD  DK  +HY  K      L L +  +  ++  ++     +H A     P  L+ L++   DI+ R+ D +  +  A+   NPE V++L  N  +++  D  G  P+HYA K        ++ EI+ IL+ +  DID  D   + P+ +A+   N   ++ LI     I + D   +  +HYA   GN E++Q+L+++ K D+   D      + YAC     ++V++L+    +++A D   +   H++  +G+ + +Q+L     ++  L+ D   P+H A  +G  EIV+ LI N          IN R+  G+  +H +      EI +IL+ N  D N   R  +GK     A+D  N    ++LI
Sbjct:  909 ACKGGKPELLQLLINNKCDI-NARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACK-------GDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINN-KCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCD-------INARDELGKQPIHYACKGGKPEIVQILINNKCDIN--ARDEDGKQPIHYAIDRGNPEMVQILI 1285          

HSP 2 Score: 112.849 bits (281), Expect = 1.100e-24
Identity = 94/368 (25.54%), Postives = 171/368 (46.47%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPN 1297
            ACK+G  + V+ L+ N  D+ D  D   K  +HY         V+++++    + +  +K+G   +H A     P  ++ L++   DIN R+   +  +  A     PE V++L  N  ++N  D +G  P+HYA             E++ IL+ +  D+   D   + P+ +A        ++ LI     I ++D  G   +HYA   GN E++Q+L+++ K DL   D      + YAC     ++V++L+    ++NA D   +   H+A  +G+ + +Q+L     +L   +     P+H A   G  EIV+ LI N          I+ R+ +G+  +H +      E+ ++L+ N  D N
Sbjct: 1140 ACKDGKPEIVQILINNKCDI-DACDRDGKQPIHYSMDRGNPEMVQILINNKCDI-NALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAID-------RGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINN-KCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCD-------IHARDWDGKQPIHYACKGGKPELIQLLINNKCDIN 1490          

HSP 3 Score: 112.464 bits (280), Expect = 1.694e-24
Identity = 85/307 (27.69%), Postives = 146/307 (47.56%), Query Frame = 2
Query:  455 INKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            IN+R+ D +  +  A+   NPE V++L  N  ++N  D  G  P+HYA K           E++ IL+ +  DID  D   + P+ +A+   N   ++ LI     I ++D      +HYA   G  E++Q+L+++ K D+   D  +   + YAC     ++++LL+    ++NA D +     H+A   G  + L++L     ++   + D   P+H A  +G+ EIVE LI N          I+ R+  G+  +H +   D  EI +IL+ N  D +   R        A+D  N    ++LI
Sbjct:  796 INERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAG-------NPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINN-KCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCD-------IDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILI 1087          

HSP 4 Score: 112.079 bits (279), Expect = 2.129e-24
Identity = 95/366 (25.96%), Postives = 171/366 (46.72%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            A   GN + V+ L+ N  D+ D  D      +HY         V+++++    +    EK     +H A     P  ++ L++   DI+  + D +  +  ++   NPE V++L  N  ++N  D +G  P+HYA +         + EI+ IL+ +  DI+  D   + P+ +A        ++ LI     I ++D  G   +HYA   GN E++Q+L+++ K DL   D      + YAC     ++V++L+    ++NA D   +   H+A  +G+ + +Q+L     +L   +     P+H A   G  EIV+ LI N          IN R+ +G+  +H +  + N E+ +IL+ N  D
Sbjct: 1074 AIDRGNPEMVQILINNKCDI-DACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEK-WMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACE-------RGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINN-KCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCD-------INARDEDGKQPIHYAIDRGNPEMVQILINNKCD 1422          

HSP 5 Score: 110.153 bits (274), Expect = 7.974e-24
Identity = 97/393 (24.68%), Postives = 180/393 (45.80%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC-IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-----------MEP--------KEKILNF-------INHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            ACK G  + +K L+ N  D+ D RD   K  +HY         VE++++    + D  +  G   +H A     P  ++ L++   DI+ R+   +  +  A+   NPE V++L  N  +++  D   + P+HYA             E++ IL+ +  DI   D     P+ +A C +   ++  ++    C I + D  G   +HY+   GN E++Q+L+++ K D+   D +    + YAC     ++V++L+    ++NA D   +   H+A   G  + +Q+L     ++   + D   P+H A  +G+ E+V+ LI N            +P        K +I+         IN R+ +G+  +H +  + N E+ +IL+ N  D
Sbjct:  975 ACKGGKPELLKILINNKCDI-DARDEDGKQPIHYAIDRGNPEIVEILINNKCDI-DARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAID-------RGNPEMVQILINNKCDIHARDEKWMQPIHYA-CKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINN-KCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCD 1356          

HSP 6 Score: 106.686 bits (265), Expect = 9.203e-23
Identity = 94/359 (26.18%), Postives = 170/359 (47.35%), Query Frame = 2
Query: 1976 INSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN--KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIV--DQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNE 3040
            IN+K  I       K  +  S   GN E+V   I++  +++ + D+ GK  +HY+ +    E+ ++++    + +N  DE     +H      + E + +L+ N  ++N  D +G+  ++ A+   N   ++ +   I +K   +   D  G  P+HYA   CK  K        +++L+    DI  RD   + P+  AI+  + E V+ L+ N  + +  D      +HY C  G  EI  Q+ +    D N  D +G  PI YA+   N ++V+ LI  N K D+V  D+ G+   H A + G  + +++L++   D  ++  DG  P+H A   G  E+ ++L+N    I   +E
Sbjct: 1153 INNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINAL-DKDGKQPIHYACERGKPEIVQILINNKCD-INARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQIL---INNKCDLVAC-DRLGKQPIHYA---CKGGKP-----EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIV-QILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILI--NNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARDE 1494          

HSP 7 Score: 104.375 bits (259), Expect = 5.042e-22
Identity = 87/357 (24.37%), Postives = 162/357 (45.38%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLI-------SKDSKINELLH 3148
            RD+ GK  +HY++   N E  ++++    + +N  D+     +H    +   E L +L+ N  +++  D +G+  ++ A+   N   ++ + +   D    I   D     P+HYA   CK  K        ++LL+    DI  RDR+ + P+  A      E ++ L+ N  +   RD + +  +HY C  G  E+  ++ +    D +  D +G  PI YA+   N +IV+ LI     +D  D  G+   H A +    + +++L++   D  ++   G  P+H A  RG  E+ +IL+N    I+  + +       +H A  R +  M  +LI       ++D K  + +H
Sbjct:  799 RDEDGKHPIHYAIDRGNPETVQILINNKCD-INALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCD----INARDWLDKQPIHYA---CKGGKP-----ELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELL-KILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDRE---WMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIH 1138          

HSP 8 Score: 100.138 bits (248), Expect = 8.800e-21
Identity = 85/362 (23.48%), Postives = 155/362 (42.82%), Query Frame = 2
Query:  368 EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAA--------------KVKAXXXXXXXXXXXXXXXKHG------------ADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            +K G   +H A     P  L+ L++   DI+ R+ D +  +  A+   NPE V++L  N  ++N  D     P+HYA               K         + + I+   K G             DI+  D     P+ +A        +K LI     I ++D  G   +HYA   GN EI+++L+++ K D++  D      + YAC  +  ++V++L+    +++A D   +   H+A  +G+ + +Q+L     ++   + +   P+H A  +G+ E+V+ LI N          I+ R+      +H +      EI +IL+ N  D +   R        ++D  N    ++LI
Sbjct:  833 DKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINN-KCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCD-------IHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILI 1186          

HSP 9 Score: 98.9821 bits (245), Expect = 2.194e-20
Identity = 87/325 (26.77%), Postives = 154/325 (47.38%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN--KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIV--DQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLN 3010
            GN E+V   I++  ++   RD+     +HY+ K+   E+ ++++    + ++  D      +H  +     E + +L+ N  ++N  D +G+  ++ A         E +   I +K   I   D  G  P+HYA   CK  K        +++L+    DI  RD   + P+  AI+  + E V+ L+ N  + +  D      +HY C  G  EI  Q+ +    D N  D +G  PI YA+   N ++V+ LI  N K D+V  D+ G+   H A + G  + +++L++   D  ++  DG  P+H A  RG  E+ +IL+N
Sbjct: 1111 GNPEMVQILINNKCDIHA-RDEKWMQPIHYACKDGKPEIVQILINNKCD-IDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYAC---ERGKPEIVQILINNKCD-INARDELGKQPIHYA---CKGGKP-----EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIV-QILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILI--NNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN 1418          

HSP 10 Score: 93.9745 bits (232), Expect = 7.032e-19
Identity = 82/355 (23.10%), Postives = 162/355 (45.63%), Query Frame = 2
Query:  314 ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC-IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            ES  + I      L++  +++G   +H A     P +++ L++   DIN  +   +  +  A    NPE +++L  N  +++  D +G  P+HYA             E++ IL+ +  DI+  D   + P+ +A C     ++  L+    C I ++D      +HYA   G  E++Q+L+++ K D+   D      + YAC     +++++L+    +++A D   +   H+A  +G+ + +++L     ++   +     P+H A      EIV+ LI N          I+ R+  G+  +H +  + N E+ +IL+ N  D +   R        A+D  N    ++LI
Sbjct:  782 ESTEDFINYAQFSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAIN-------RGNPEMVQILINNKCDINARDWLDKQPIHYA-CKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINN-KCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCD-------IDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILI 1120          

HSP 11 Score: 93.2041 bits (230), Expect = 1.250e-18
Identity = 84/335 (25.07%), Postives = 155/335 (46.27%), Query Frame = 2
Query: 2018 KDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIV--DQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLN 3010
            K  +  +C+    EIV   I++  ++ + RD++GK  +HY++   N E+ ++++    + ++  D   +  +H  I     E + +L+ N  +++  D      ++ A         E +   I +K   I   D  G  P+HY+++              +++L+    DI   D+  + P+  A      E V+ L+ N  +   RD      +HY C  G  EI  Q+ +    D N  D +G  PI YA+   N ++V+ LI  N K D+V  D+ G+   H A + G  + +++L++   D  ++  DG  P+H A  RG  E+ +IL+N
Sbjct: 1035 KQPIHYACKGDKPEIVQILINNKCDI-DARDRAGKQPIHYAIDRGNPEMVQILINNKCD-IDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYAC---KDGKPEIVQILINNKCD-IDACDRDGKQPIHYSMDRGN--------PEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIV-QILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILI--NNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN 1352          

HSP 12 Score: 87.4261 bits (215), Expect = 6.315e-17
Identity = 72/265 (27.17%), Postives = 129/265 (48.68%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAED 988
            ACK G  + V+ L+ N  D+ + RD   K  +HY         V+++++    L+   ++ G   +H A     P  ++ L++   DIN R+ D +  +  A+   NPE V++L  N  ++   D  G  P+HYA K         + EI+ IL+ +  DI+  D   + P+ +A+   N   ++ LI     + + D  G   +HYA   G  EI+Q+L+++ K D+   D +    + YAC     ++++LL+    ++NA D
Sbjct: 1239 ACKGGKPEIVQILINNKCDI-NARDEDGKQPIHYAIDRGNPEMVQILINNKCDLV-ACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACK-------GGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINN-KCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARD 1493          

HSP 13 Score: 56.9954 bits (136), Expect = 1.193e-7
Identity = 38/136 (27.94%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 2729 NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            N  D +G  PI YA+   N + V+ LI     ++ +D++G+   H A + G  + L++L++   D  ++  DG  P+H A  RG  E+ +IL+N      ++N ++   +  +H A       +  LLI+    IN
Sbjct:  797 NERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKC---DINARDWLDKQPIHYACKGGKPELLQLLINNKCDIN 929          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 132.88 bits (333), Expect = 8.250e-31
Identity = 108/395 (27.34%), Postives = 190/395 (48.10%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQL-LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMT--ALDLANKNETKLLI 1375
            ACK G  + ++ L+ N  D+ + RD  DK  +HY  K      L L +  +  ++  ++     +H A     P  L+ L++   DI+ R+ D +  +  A+   NPE V++L  N  +++  D  G  P+HYA K        ++ EI+ IL+ +  DID  D   + P+ +A+   N   ++ LI     I + D   +  +HYA   GN E++Q+L+++ K D+   D      + YAC     ++V++L+    +++A D   +   H++  +G+ + +Q+L     ++  L+ D   P+H A  +G  EIV+ LI N          IN R+  G+  +H +      EI +IL+ N  D N   R  +GK     A+D  N    ++LI
Sbjct:  909 ACKGGKPELLQLLINNKCDI-NARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACK-------GDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINN-KCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCD-------INARDELGKQPIHYACKGGKPEIVQILINNKCDIN--ARDEDGKQPIHYAIDRGNPEMVQILI 1285          

HSP 2 Score: 112.079 bits (279), Expect = 1.917e-24
Identity = 85/307 (27.69%), Postives = 146/307 (47.56%), Query Frame = 2
Query:  455 INKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            IN+R+ D +  +  A+   NPE V++L  N  ++N  D  G  P+HYA K           E++ IL+ +  DID  D   + P+ +A+   N   ++ LI     I ++D      +HYA   G  E++Q+L+++ K D+   D  +   + YAC     ++++LL+    ++NA D +     H+A   G  + L++L     ++   + D   P+H A  +G+ EIVE LI N          I+ R+  G+  +H +   D  EI +IL+ N  D +   R        A+D  N    ++LI
Sbjct:  796 INERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAG-------NPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINN-KCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCD-------IDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILI 1087          

HSP 3 Score: 112.079 bits (279), Expect = 2.176e-24
Identity = 95/366 (25.96%), Postives = 171/366 (46.72%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            A   GN + V+ L+ N  D+ D  D      +HY         V+++++    +    EK     +H A     P  ++ L++   DI+  + D +  +  ++   NPE V++L  N  ++N  D +G  P+HYA +         + EI+ IL+ +  DI+  D   + P+ +A        ++ LI     I ++D  G   +HYA   GN E++Q+L+++ K DL   D      + YAC     ++V++L+    ++NA D   +   H+A  +G+ + +Q+L     +L   +     P+H A   G  EIV+ LI N          IN R+ +G+  +H +  + N E+ +IL+ N  D
Sbjct: 1074 AIDRGNPEMVQILINNKCDI-DACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEK-WMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACE-------RGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINN-KCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCD-------INARDEDGKQPIHYAIDRGNPEMVQILINNKCD 1422          

HSP 4 Score: 110.153 bits (274), Expect = 8.804e-24
Identity = 97/393 (24.68%), Postives = 180/393 (45.80%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC-IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-----------MEP--------KEKILNF-------INHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            ACK G  + +K L+ N  D+ D RD   K  +HY         VE++++    + D  +  G   +H A     P  ++ L++   DI+ R+   +  +  A+   NPE V++L  N  +++  D   + P+HYA             E++ IL+ +  DI   D     P+ +A C +   ++  ++    C I + D  G   +HY+   GN E++Q+L+++ K D+   D +    + YAC     ++V++L+    ++NA D   +   H+A   G  + +Q+L     ++   + D   P+H A  +G+ E+V+ LI N            +P        K +I+         IN R+ +G+  +H +  + N E+ +IL+ N  D
Sbjct:  975 ACKGGKPELLKILINNKCDI-DARDEDGKQPIHYAIDRGNPEIVEILINNKCDI-DARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAID-------RGNPEMVQILINNKCDIHARDEKWMQPIHYA-CKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINN-KCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCD 1356          

HSP 5 Score: 103.99 bits (258), Expect = 5.440e-22
Identity = 87/357 (24.37%), Postives = 162/357 (45.38%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLI-------SKDSKINELLH 3148
            RD+ GK  +HY++   N E  ++++    + +N  D+     +H    +   E L +L+ N  +++  D +G+  ++ A+   N   ++ + +   D    I   D     P+HYA   CK  K        ++LL+    DI  RDR+ + P+  A      E ++ L+ N  +   RD + +  +HY C  G  E+  ++ +    D +  D +G  PI YA+   N +IV+ LI     +D  D  G+   H A +    + +++L++   D  ++   G  P+H A  RG  E+ +IL+N    I+  + +       +H A  R +  M  +LI       ++D K  + +H
Sbjct:  799 RDEDGKHPIHYAIDRGNPETVQILINNKCD-INALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCD----INARDWLDKQPIHYA---CKGGKP-----ELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELL-KILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDRE---WMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIH 1138          

HSP 6 Score: 100.138 bits (248), Expect = 8.962e-21
Identity = 85/362 (23.48%), Postives = 155/362 (42.82%), Query Frame = 2
Query:  368 EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAA--------------KVKAXXXXXXXXXXXXXXXKHG------------ADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            +K G   +H A     P  L+ L++   DI+ R+ D +  +  A+   NPE V++L  N  ++N  D     P+HYA               K         + + I+   K G             DI+  D     P+ +A        +K LI     I ++D  G   +HYA   GN EI+++L+++ K D++  D      + YAC  +  ++V++L+    +++A D   +   H+A  +G+ + +Q+L     ++   + +   P+H A  +G+ E+V+ LI N          I+ R+      +H +      EI +IL+ N  D +   R        ++D  N    ++LI
Sbjct:  833 DKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINN-KCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCD-------IHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILI 1186          

HSP 7 Score: 98.5969 bits (244), Expect = 2.474e-20
Identity = 87/325 (26.77%), Postives = 154/325 (47.38%), Query Frame = 2
Query: 2048 GNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN--KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIV--DQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLN 3010
            GN E+V   I++  ++   RD+     +HY+ K+   E+ ++++    + ++  D      +H  +     E + +L+ N  ++N  D +G+  ++ A         E +   I +K   I   D  G  P+HYA   CK  K        +++L+    DI  RD   + P+  AI+  + E V+ L+ N  + +  D      +HY C  G  EI  Q+ +    D N  D +G  PI YA+   N ++V+ LI  N K D+V  D+ G+   H A + G  + +++L++   D  ++  DG  P+H A  RG  E+ +IL+N
Sbjct: 1111 GNPEMVQILINNKCDIHA-RDEKWMQPIHYACKDGKPEIVQILINNKCD-IDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYAC---ERGKPEIVQILINNKCD-INARDELGKQPIHYA---CKGGKP-----EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIV-QILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILI--NNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN 1418          

HSP 8 Score: 93.9745 bits (232), Expect = 6.164e-19
Identity = 92/401 (22.94%), Postives = 173/401 (43.14%), Query Frame = 2
Query: 2018 KDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELIL----------------------KKTPELVNKF----------DETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLIS 3118
            K  +  +C+    EIV   I++  ++ + RD++GK  +HY++   N E+ ++++                      +  PE+V             DE  +  +H      + E + +L+ N  +++  D +G+  ++ ++   N   ++ + +   D    I   D  G  P+HYA E  + K  + Q      +L+    DI  RD + + P+  A      E V+ L+ N  +   RD      +HY    GN E+  Q+ +    D    D  G  PI YA      +IV+ LI     ++  D+ G+   H A ++G  + +++L++   D  +    G  P+H A   G  EI +IL+N      ++N ++  G+  +H A  R +  M  +LI+
Sbjct: 1035 KQPIHYACKGDKPEIVQILINNKCDI-DARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCD----INALDKDGKQPIHYACE--RGKPEIVQ------ILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMV-QILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKC---DINARDEDGKQPIHYAIDRGNPEMVQILIN 1418          

HSP 9 Score: 93.9745 bits (232), Expect = 7.362e-19
Identity = 82/355 (23.10%), Postives = 162/355 (45.63%), Query Frame = 2
Query:  314 ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC-IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            ES  + I      L++  +++G   +H A     P +++ L++   DIN  +   +  +  A    NPE +++L  N  +++  D +G  P+HYA             E++ IL+ +  DI+  D   + P+ +A C     ++  L+    C I ++D      +HYA   G  E++Q+L+++ K D+   D      + YAC     +++++L+    +++A D   +   H+A  +G+ + +++L     ++   +     P+H A      EIV+ LI N          I+ R+  G+  +H +  + N E+ +IL+ N  D +   R        A+D  N    ++LI
Sbjct:  782 ESTEDFINYAQFSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAIN-------RGNPEMVQILINNKCDINARDWLDKQPIHYA-CKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINN-KCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCD-------IDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILI 1120          

HSP 10 Score: 56.9954 bits (136), Expect = 1.132e-7
Identity = 38/136 (27.94%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 2729 NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            N  D +G  PI YA+   N + V+ LI     ++ +D++G+   H A + G  + L++L++   D  ++  DG  P+H A  RG  E+ +IL+N      ++N ++   +  +H A       +  LLI+    IN
Sbjct:  797 NERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKC---DINARDWLDKQPIHYACKGGKPELLQLLINNKCDIN 929          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000032664.1 (SMESG000032664.1)

HSP 1 Score: 132.88 bits (333), Expect = 8.375e-31
Identity = 108/395 (27.34%), Postives = 190/395 (48.10%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESCVELILSVAPQL-LDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMT--ALDLANKNETKLLI 1375
            ACK G  + ++ L+ N  D+ + RD  DK  +HY  K      L L +  +  ++  ++     +H A     P  L+ L++   DI+ R+ D +  +  A+   NPE V++L  N  +++  D  G  P+HYA K        ++ EI+ IL+ +  DID  D   + P+ +A+   N   ++ LI     I + D   +  +HYA   GN E++Q+L+++ K D+   D      + YAC     ++V++L+    +++A D   +   H++  +G+ + +Q+L     ++  L+ D   P+H A  +G  EIV+ LI N          IN R+  G+  +H +      EI +IL+ N  D N   R  +GK     A+D  N    ++LI
Sbjct:  909 ACKGGKPELLQLLINNKCDI-NARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACK-------GDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINN-KCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCD-------INARDELGKQPIHYACKGGKPEIVQILINNKCDIN--ARDEDGKQPIHYAIDRGNPEMVQILI 1285          

HSP 2 Score: 119.013 bits (297), Expect = 1.537e-26
Identity = 100/391 (25.58%), Postives = 183/391 (46.80%), Query Frame = 2
Query: 1976 INSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKN--KELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINEL 3142
            IN+K  I       K  +  S   GN E+V   I++  +++ + D+ GK  +HY+ +    E+ ++++    + +N  DE     +H      + E + +L+ N  ++N  D +G+  ++ A+   N   ++ +   I +K   +   D  G  P+HYA   CK  K        +++L+    DI  RD   + P+  AI+  + E V+ L+ N  + +  D      +HY C  G  EI  Q+ +    D N  D +G  PI YA+   N ++V+ LI     L   D+ G+   H A + G  + +++L++   D  ++  DG  P+H A   G  E+ ++L+N      ++N ++  G+  +H A  R +  M  +LI+    IN L
Sbjct: 1153 INNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINAL-DKDGKQPIHYACERGKPEIVQILINNKCD-INARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQIL---INNKCDLVAC-DRLGKQPIHYA---CKGGKP-----EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIV-QILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKC---DINARDEDGKQPIHYAINRGNPEMVQILINNKCDINAL 1525          

HSP 3 Score: 114.39 bits (285), Expect = 3.739e-25
Identity = 101/396 (25.51%), Postives = 183/396 (46.21%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMT--ALDLANKNETKLLI 1375
            ACK+G  + V+ L+ N  D+ D  D   K  +HY         V+++++    + +  +K+G   +H A     P  ++ L++   DIN R+   +  +  A     PE V++L  N  ++N  D +G  P+HYA             E++ IL+ +  D+   D   + P+ +A        ++ LI     I ++D  G   +HYA   GN E++Q+L+++ K DL   D      + YAC     ++V++L+    ++NA D   +   H+A  +G+ + +Q+L     +L   +     P+H A   G  EIV+ LI N          I+ R+ +G+  +H +      E+ ++L+ N  D N   R  +GK     A++  N    ++LI
Sbjct: 1140 ACKDGKPEIVQILINNKCDI-DACDRDGKQPIHYSMDRGNPEMVQILINNKCDI-NALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAID-------RGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINN-KCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCD-------IHARDWDGKQPIHYACKGGKPELIQLLINNKCDIN--ARDEDGKQPIHYAINRGNPEMVQILI 1516          

HSP 4 Score: 112.079 bits (279), Expect = 1.980e-24
Identity = 85/307 (27.69%), Postives = 146/307 (47.56%), Query Frame = 2
Query:  455 INKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            IN+R+ D +  +  A+   NPE V++L  N  ++N  D  G  P+HYA K           E++ IL+ +  DID  D   + P+ +A+   N   ++ LI     I ++D      +HYA   G  E++Q+L+++ K D+   D  +   + YAC     ++++LL+    ++NA D +     H+A   G  + L++L     ++   + D   P+H A  +G+ EIVE LI N          I+ R+  G+  +H +   D  EI +IL+ N  D +   R        A+D  N    ++LI
Sbjct:  796 INERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAG-------NPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINN-KCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCD-------IDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILI 1087          

HSP 5 Score: 112.079 bits (279), Expect = 2.137e-24
Identity = 95/366 (25.96%), Postives = 171/366 (46.72%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            A   GN + V+ L+ N  D+ D  D      +HY         V+++++    +    EK     +H A     P  ++ L++   DI+  + D +  +  ++   NPE V++L  N  ++N  D +G  P+HYA +         + EI+ IL+ +  DI+  D   + P+ +A        ++ LI     I ++D  G   +HYA   GN E++Q+L+++ K DL   D      + YAC     ++V++L+    ++NA D   +   H+A  +G+ + +Q+L     +L   +     P+H A   G  EIV+ LI N          IN R+ +G+  +H +  + N E+ +IL+ N  D
Sbjct: 1074 AIDRGNPEMVQILINNKCDI-DACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEK-WMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINNKCDINALDKDGKQPIHYACE-------RGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINN-KCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCD-------INARDEDGKQPIHYAIDRGNPEMVQILINNKCD 1422          

HSP 6 Score: 109.768 bits (273), Expect = 9.396e-24
Identity = 97/393 (24.68%), Postives = 180/393 (45.80%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC-IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN-----------MEP--------KEKILNF-------INHRNSNGQTALHLSTVKDNLEICKILLQNGAD 1291
            ACK G  + +K L+ N  D+ D RD   K  +HY         VE++++    + D  +  G   +H A     P  ++ L++   DI+ R+   +  +  A+   NPE V++L  N  +++  D   + P+HYA             E++ IL+ +  DI   D     P+ +A C +   ++  ++    C I + D  G   +HY+   GN E++Q+L+++ K D+   D +    + YAC     ++V++L+    ++NA D   +   H+A   G  + +Q+L     ++   + D   P+H A  +G+ E+V+ LI N            +P        K +I+         IN R+ +G+  +H +  + N E+ +IL+ N  D
Sbjct:  975 ACKGGKPELLKILINNKCDI-DARDEDGKQPIHYAIDRGNPEIVEILINNKCDI-DARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAID-------RGNPEMVQILINNKCDIHARDEKWMQPIHYA-CKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILINN-KCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCD 1356          

HSP 7 Score: 104.375 bits (259), Expect = 4.265e-22
Identity = 87/357 (24.37%), Postives = 162/357 (45.38%), Query Frame = 2
Query: 2105 RDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLI-------SKDSKINELLH 3148
            RD+ GK  +HY++   N E  ++++    + +N  D+     +H    +   E L +L+ N  +++  D +G+  ++ A+   N   ++ + +   D    I   D     P+HYA   CK  K        ++LL+    DI  RDR+ + P+  A      E ++ L+ N  +   RD + +  +HY C  G  E+  ++ +    D +  D +G  PI YA+   N +IV+ LI     +D  D  G+   H A +    + +++L++   D  ++   G  P+H A  RG  E+ +IL+N    I+  + +       +H A  R +  M  +LI       ++D K  + +H
Sbjct:  799 RDEDGKHPIHYAIDRGNPETVQILINNKCD-INALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCD----INARDWLDKQPIHYA---CKGGKP-----ELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELL-KILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDRE---WMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIH 1138          

HSP 8 Score: 100.138 bits (248), Expect = 9.828e-21
Identity = 85/362 (23.48%), Postives = 155/362 (42.82%), Query Frame = 2
Query:  368 EKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAA--------------KVKAXXXXXXXXXXXXXXXKHG------------ADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGACIYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            +K G   +H A     P  L+ L++   DI+ R+ D +  +  A+   NPE V++L  N  ++N  D     P+HYA               K         + + I+   K G             DI+  D     P+ +A        +K LI     I ++D  G   +HYA   GN EI+++L+++ K D++  D      + YAC  +  ++V++L+    +++A D   +   H+A  +G+ + +Q+L     ++   + +   P+H A  +G+ E+V+ LI N          I+ R+      +H +      EI +IL+ N  D +   R        ++D  N    ++LI
Sbjct:  833 DKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKCDINARDWLDKQPIHYACKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINNKCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINN-KCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCDIDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILINNKCD-------IHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDACDRDGKQPIHYSMDRGNPEMVQILI 1186          

HSP 9 Score: 98.9821 bits (245), Expect = 1.853e-20
Identity = 90/345 (26.09%), Postives = 150/345 (43.48%), Query Frame = 2
Query: 1976 INSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLN 3010
            IN+K  I    E +   +  +C+ G  EIV   I++  ++    D+ GK  +HYS+          +  PE+V                        +L+ N  ++N  D +G+  ++ A         E +   I +K   I   D  G  P+HYA   CK  K        +++L+    DI  RD   + P+  AI+  + E V+ L+ N  + +  D      +HY C  G  EI  Q+ +    D N  D +G  PI YA+   N ++V+ LI     L   D+ G+   H A + G  + +++L++   D  ++  DG  P+H A  RG  E+ +IL+N
Sbjct: 1120 INNKCDIHARDEKWMQPIHYACKDGKPEIVQILINNKCDIDAC-DRDGKQPIHYSMD---------RGNPEMVQ-----------------------ILINNKCDINALDKDGKQPIHYAC---ERGKPEIVQILINNKCD-INARDELGKQPIHYA---CKGGKP-----EIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIV-QILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN 1418          

HSP 10 Score: 94.7449 bits (234), Expect = 3.954e-19
Identity = 77/324 (23.77%), Postives = 140/324 (43.21%), Query Frame = 2
Query:  200 ACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKY--ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC-IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITN 1162
            ACK G  + V+ L+ N  D+ + RD   K  +HY         V+++++    L+   ++ G   +H A     P  ++ L++   DIN R+ D +  +  A+   NPE V++L  N  ++   D  G  P+HYA                                         C     ++  ++    C I ++D  G   +HYA   GN E++Q+L+++ K DL   D      + YAC     ++V++L+    +++A D   +   H+A   G  + +Q+L     ++   + D   P+H A  +G+ E+V+ LI N
Sbjct: 1239 ACKGGKPEIVQILINNKCDI-NARDEDGKQPIHYAIDRGNPEMVQILINNKCDLV-ACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYA-----------------------------------------CKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINN-KCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDIHARDWDGKQPIHYACKGGKPELIQLLINNKCDINARDEDGKQPIHYAINRGNPEMVQILINN 1518          

HSP 11 Score: 93.9745 bits (232), Expect = 7.975e-19
Identity = 82/355 (23.10%), Postives = 162/355 (45.63%), Query Frame = 2
Query:  314 ESCVELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNNDSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKAXXXXXXXXXXXXXXXKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC-IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYACSYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVNLWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQTALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLLI 1375
            ES  + I      L++  +++G   +H A     P +++ L++   DIN  +   +  +  A    NPE +++L  N  +++  D +G  P+HYA             E++ IL+ +  DI+  D   + P+ +A C     ++  L+    C I ++D      +HYA   G  E++Q+L+++ K D+   D      + YAC     +++++L+    +++A D   +   H+A  +G+ + +++L     ++   +     P+H A      EIV+ LI N          I+ R+  G+  +H +  + N E+ +IL+ N  D +   R        A+D  N    ++LI
Sbjct:  782 ESTEDFINYAQFSLINERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAIN-------RGNPEMVQILINNKCDINARDWLDKQPIHYA-CKGGKPELLQLLINNKCDINARDRLDKQPIHYACKGGKPELLQLLINN-KCDINARDREWMQPIHYACKGGKPELLKILINNKCDIDARDEDGKQPIHYAIDRGNPEIVEILINNKCDIDARDWLGKQPIHYACKGDKPEIVQILINNKCD-------IDARDRAGKQPIHYAIDRGNPEMVQILINNKCDIDACDREWMQPIHYAIDRGNPEMVQILI 1120          

HSP 12 Score: 93.2041 bits (230), Expect = 1.054e-18
Identity = 81/333 (24.32%), Postives = 151/333 (45.35%), Query Frame = 2
Query: 2018 KDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGKTLLHYSL--KNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLLLKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNSGNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAINVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENFDPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLN 3010
            K  +  +C+    EIV   I++  ++ + RD++GK  +HY++   N E+ ++++    + ++  D   +  +H  I     E + +L+ N  +++  D      ++ A         E +   I +K   I   D  G  P+HY+++              +++L+    DI   D+  + P+  A      E V+ L+ N  +   RD      +HY C  G  EI  Q+ +    D N  D +G  PI YA+   N ++V+ LI     L   D+ G+   H A + G  + +++L++   D  ++  DG  P+H A  RG  E+ +IL+N
Sbjct: 1035 KQPIHYACKGDKPEIVQILINNKCDI-DARDRAGKQPIHYAIDRGNPEMVQILINNKCD-IDACDREWMQPIHYAIDRGNPEMVQILINNKCDIHARDEKWMQPIHYAC---KDGKPEIVQILINNKCD-IDACDRDGKQPIHYSMDRGN--------PEMVQILINNKCDINALDKDGKQPIHYACERGKPEIVQILINNKCDINARDELGKQPIHYACKGGKPEIV-QILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILINNKCDLVACDRLGKQPIHYACKGGKPEIVQILINNKCDINARDEDGKQPIHYAIDRGNPEMVQILIN 1352          

HSP 13 Score: 57.3806 bits (137), Expect = 1.069e-7
Identity = 38/136 (27.94%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 2729 NVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAAEKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSAIENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKIN 3136
            N  D +G  PI YA+   N + V+ LI     ++ +D++G+   H A + G  + L++L++   D  ++  DG  P+H A  RG  E+ +IL+N      ++N ++   +  +H A       +  LLI+    IN
Sbjct:  797 NERDEDGKHPIHYAIDRGNPETVQILINNKCDINALDKWGKQPIHYACKAGNPELLQILINNKCDIDARDRDGKQPIHYAINRGNPEMVQILINNKC---DINARDWLDKQPIHYACKGGKPELLQLLINNKCDIN 929          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD281.673e-2629.82ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKRD282.024e-2629.82ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKRD282.255e-2629.82ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
ANKRD282.255e-2629.82ankyrin repeat domain 28 [Source:HGNC Symbol;Acc:H... [more]
EHMT21.424e-2430.81euchromatic histone lysine methyltransferase 2 [So... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphp-21.628e-3229.49NePHronoPhthisis (Human kidney disease) homolog [... [more]
nphp-21.931e-3229.49NePHronoPhthisis (Human kidney disease) homolog [... [more]
unc-442.163e-2127.85AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.163e-2127.85AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.201e-2127.85AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG425344.576e-4629.56gene:FBgn0260487 transcript:FBtr0300898[more]
CG425344.214e-4530.26gene:FBgn0260487 transcript:FBtr0309307[more]
Ank22.598e-2526.98gene:FBgn0261788 transcript:FBtr0344222[more]
Ank23.076e-2526.98gene:FBgn0261788 transcript:FBtr0303118[more]
Ank23.538e-2526.98gene:FBgn0261788 transcript:FBtr0303122[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b3.786e-2428.46ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b4.152e-2428.46ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank2b4.423e-2425.19ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
ank1b4.675e-2428.46ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
espnlb2.645e-2326.83espin like b [Source:ZFIN;Acc:ZDB-GENE-070912-481][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo91.375e-2627.99F-box protein 9 [Source:Xenbase;Acc:XB-GENE-100244... [more]
rev15.507e-2629.27REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev16.073e-2629.04REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev11.389e-2528.76REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
rev11.450e-2528.76REV1, DNA directed polymerase [Source:Xenbase;Acc:... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ankrd282.922e-2629.05ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ankrd283.194e-2629.05ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ankrd284.094e-2629.53ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
Ehmt21.621e-2431.31euchromatic histone lysine N-methyltransferase 2 [... [more]
Ehmt21.726e-2431.31euchromatic histone lysine N-methyltransferase 2 [... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9XZC0|LCTA_LATTR4.325e-2827.93Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodec... [more]
sp|O15084|ANR28_HUMAN1.083e-2529.82Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q505D1|ANR28_MOUSE2.234e-2529.05Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q96KQ7|EHMT2_HUMAN9.463e-2430.81Histone-lysine N-methyltransferase EHMT2 OS=Homo s... [more]
sp|Q9Z148|EHMT2_MOUSE1.333e-2331.31Histone-lysine N-methyltransferase EHMT2 OS=Mus mu... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2J7QBR41.270e-5933.33ANK_REP_REGION domain-containing protein OS=Crypto... [more]
A0A067RB324.802e-5733.79ANK_REP_REGION domain-containing protein (Fragment... [more]
A0A2J7QBR73.008e-5633.00ANK_REP_REGION domain-containing protein OS=Crypto... [more]
A0A5E4MDK75.331e-5532.39ANK_REP_REGION domain-containing protein OS=Cinara... [more]
A0A5E4MI268.603e-5532.39Ankyrin repeat-containing domain,Ankyrin repeat OS... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANKRD504.152e-2426.11ankyrin repeat domain 50 [Source:NCBI gene;Acc:103... [more]
ank1b4.582e-2326.91ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3a2.367e-2225.49ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a3.522e-2225.56ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ENSAMXT00000016978.23.922e-2221.93serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.11.205e-2626.42pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.12.224e-2525.65pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
invs6.174e-2325.81inversin [Source:NCBI gene;Acc:245946][more]
ENSPMAT00000009528.11.253e-2230.57pep scaffold:Pmarinus_7.0:GL478737:432:18044:-1 ge... [more]
ENSPMAT00000007446.12.965e-2224.94pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AKR11.042e-826.40Palmitoyl transferase involved in protein palmitoy... [more]
PHO812.404e-822.06Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
NAS64.033e-828.10Evolutionarily conserved 19S regulatory particle a... [more]
AKR26.433e-826.32Ankyrin repeat-containing protein; member of a fam... [more]
HOS41.903e-730.92Subunit of the Set3 complex; complex is a meiotic-... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO299741.489e-1529.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494851.492e-1528.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391133.392e-1428.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359837.303e-1432.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387027.482e-1223.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b2.573e-2427.64ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
invs3.227e-2425.96inversin [Source:NCBI gene;Acc:101168237][more]
ankrd28b6.467e-2428.78ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd28b6.987e-2428.78ankyrin repeat domain 28 [Source:NCBI gene;Acc:101... [more]
ankrd52a4.250e-2325.38serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013802.10.000e+098.16SMESG000013802.1[more]
SMESG000048145.13.459e-3928.17SMESG000048145.1[more]
SMESG000032664.17.549e-3127.34SMESG000032664.1[more]
SMESG000032664.18.250e-3127.34SMESG000032664.1[more]
SMESG000032664.18.375e-3127.34SMESG000032664.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000370 ID=SMED30000370|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4190bp
TTAAATATATAATATTTAAACTTACTATATAATAATCGAGTTCAACATGA
CCTACATATCTCTGTAGAAATAAGCGCAAATCTCATAATGGTAAATCATT
TAAAATTATTCTACTGTCATTTATTATTTATGAAGTGAAAATTGCTGTTG
ATAATTGTTAGTATATTTTTCAATGGGTTCTTATGTCGAGCTATTAAAAG
CTTGCAAAGAAGGAAATAATAAGAAAGTGAAAAAGTTATTAGAGAACTGT
ACTGATGTAGGAGATGTGCGTGATTTGACTGATAAAACATTGCTTCATTA
TTGTTTCAAATATGAATCATGTGTGGAATTAATATTATCTGTCGCTCCGC
AATTGCTGGATACCGGAGAGAAGAACGGATATACTGTATTGCATTTAGCT
TCTATGATCAAACCACCAACTTCTCTCCGATATCTTTTATCAAAAAATCC
AGATATAAACAAGAGAAATAATGATTCAAGAAGTTCTTTGTTGCTCGCTG
TCATTTATGACAATCCAGAAGCGGTTAAATTGCTGTGTGAAAATAATGCC
GAAGTAAACATCACAGATGTAAATGGGGTATCTCCAATGCATTATGCCGC
CAAAGTGAAAGCTTGTCTTGAATGTGAAAACGAATTAGAAATTATCAATA
TTCTCTTGAAACATGGTGCAGATATAGATGGATTAGATTTATACAAAAGA
TCTCCGCTGATGTGGGCTGTTTGTTCCAATAATCTAACAAAAATGAAGCA
TCTCATTGAAAAAGGGGCCTGCATTTATTCAAAAGATTCCAGTGGATTAT
CCATTCTTCATTATGCTACTTCAAATGGCAATCTTGAAATCATCCAAATG
CTTCTTGATGACTACAAATTTGATTTGGAAACAACGGACTCGAATAACTG
TACAGCTCTGATGTATGCGTGTTCATACAACAATGTTGACGTGGTTGAAT
TGTTGTTGGAGAGAGGTTCAAATGTTAATGCTGAAGATTCTAAACGAAGG
AATGCGACTCATTTTGCTAGTGGGAAAGGAGATTTGAAAAATCTACAAGT
TCTCCACCAATACAATGTTAATCTTTGGAAATTAAATAACGATAGTAATT
ATCCTCTCCATGAGGCATCGTATAAAGGCCACAACGAAATTGTAGAGTTT
CTCATTACTAATATGGAACCAAAAGAAAAGATACTTAATTTCATCAATCA
TAGAAATTCCAATGGGCAAACAGCACTTCATTTGTCCACAGTAAAGGACA
ATTTAGAAATTTGTAAAATTCTTTTACAAAATGGAGCAGATCCTAACATT
CCTCTACGAGTTAGTAATGGGAAATCAATGACTGCTTTAGATTTAGCGAA
TAAGAATGAAACAAAACTTTTAATTGTCAAGTTCAATGGAAAATCATCAG
ATGACCTATTGAAAACGTCAACTATCAATGAAGAAATCACGGGATCAATC
AGCGACGAATCGAGTTCCGAAGAAATCAGTGAAAATAGCAGTTTCGATTC
AGCGGGTGAAATTGATGAAAATCAAAAAAAAATCGACAGTGATGCCGAAG
AAATTAATAGCACATATGAGCAAATACTTAATACACAAGACGAAATTGAT
TTAAGAAATGAGGAAGTCGATGATGCGCACATTCAAATTCACAACACGGA
AGAGCAAGTCGATGATACACACATCCAAATCAATGACACGGAAGTGCAAG
TCGATCATACACACATTCAAATTAATGACAAGTTAGAACAAATCGATAGT
GCAGAAATTAATAACTCAATAGAAACAAACAATTTGAAAGATACAAATGA
GTTTGATGAAGTTTACTGGAAAGAAACCAACCAAAACTTTAATAATCAAC
TTAAAACTTCTGAATTGTCTCCAGATTTCAACAATGAACCAGTTAAACTA
ACAAATTCAAAGAAAATCAAAGATTCATCAGAGGAATGCCAAATTCTACC
AAAATTTACAGAAAACGAAAATGAAATCAATTCTAAAAGGCAAATAATTG
AAATAACGGAAAGTTATAAAGATTATCTTTTTGCGTCGTGTCGCATTGGA
AACTTTGAAATCGTCTGTTCATTCATTCATGACGGAGGAGAAGTGTCGGA
AATAAGAGATCAATCGGGAAAAACTTTGCTGCACTATTCACTAAAAAACA
AAGAACTATTTGAGTTGATTTTAAAGAAAACTCCAGAATTAGTGAATAAA
TTTGATGAAACAAATCTCACGATTTTACACATGGTCATCATGTCAAAGGA
AATCGAACGGTTACCTTTGCTTTTAAAAAATAATGCCAATGTCAATTTTC
CCGATGGCAACGGAAGAACTGCACTGAATTTAGCTGTGATTTACAATAAT
TTAGCTGCGTTAGAGTGCATGAATGATTACATCACAGATAAAACCCGATT
TATTCAAATACCTGACAACTCCGGCAATTACCCCCTGCATTACGCAATTG
AAATATGTAAATACAAGAAATCAGTTTGTCAGTGCAAAACATATATGGAA
TTACTATTGGAAATGAATGGCGACATTGAATGTCGAGACCGAGTGAGTCG
GACGCCCTTATTATTAGCGATAAATGTTAATCACGTCGAGGCAGTTGAGA
CTCTACTCAAAAACGGAGCAAATTTCCTGACGAGAGATATCCAGAATTTA
TGCTCCGTTCATTATGTGTGTTCAGAAGGAAATTTAGAGATATTTAATCA
ATTAGCGGTCTTTGAAAATTTTGACCCGAATGTTACAGATCCAAATGGCT
TAACTCCAATCTTTTATGCCGTTTCTAATTGCAATGAAAAAATTGTCAAA
AGACTTATCGAATTGAATGCCAAACTGGATATCGTTGACCAATATGGCAG
GACCCTATGTCATAAAGCTGCAGAAAAGGGAGCTTTTAAGTGCCTAGAAC
TTTTATTGTCTTATGGAGTTGATCCATGGTCCAAATGTCACGATGGTACA
ATGCCATTACACGAAGCTGCTTATAGAGGATATAAAGAAATAGCGGAAAT
ATTATTAAATACGCCATCAGCAATTGAAAATGTTAATGAGAAGAACAACA
GTGGACAAACGGCATTGCACTTAGCTGCAGTTAGAAATGATTGTCCGATG
TGCTTCTTGTTGATTTCTAAAGATAGCAAAATCAACGAGCTATTACATAA
CACGAGTGATAATGAAGAATTGACAGCCTATGATTTAGCGACAACTCCCG
ATTGTAAGAATACACTAAAAACATTTGGAGGTCGTTCAGCGAAAAAAGTT
ATCAATTGTTCTAATTCAGAATTGGACTACAGTACTCAATACAATGCCGA
AGTTGAGCTTGTTCCCCAAGTCAATGGCTATGATATAAGCGCTCCTGTAT
CAATAAGAAGCACCGAATTAGCATTGTCAACAGTTCCAAGTGCAGTTTAT
ACGTATCGTACCAATGAGATTTGTAGTAGTAAAAACATCCAAAGTATTCA
AGTTTTGCAAAATTCCAAAACCACTTCGAAGAAATCTGACAATTCAAGTA
AAAAGAAAATATCATTGTCAAGCTCTGATAAATCGTCGACGAACATATCA
TTTGGTGAAGCTAAAGAAGGATCGTGCGCTTCAGTCAAAATTAACAATCC
ACAGGTTTTTGAAAGCCTGCCCTCATCTCAATTGCACCGAGTTGACACTG
GACAAGATTCTAAAACTTATCATGAAACCACTTCCAGATGCAAATCCACT
CATTTAATTCCATCAACAAATTCAATCGAATTCCAGAAAATGTCAACATG
TCAAACCGAGTCCATATTATCATCAAATAGAAAAAAATCAACAACCCAGT
CCAAATCGACAAATTCATCAAACAAAAAGCAGAAAAAGAGCCCACCGTCC
GATAAAAACTTGCAAAAAAAAGTGCAAAAATCTGTAATAAATTACGAATA
CATCCGGCTCAACTGTAAAGTAGCCAATGATATCGCTAGACTAAAGTTCC
GGGAGGAAAACATCGAGAAATTGATCAACCCAAAAATGACAAAACTCCAC
AAAACTGGATGTAAAAAAACGCAAAATCATAAAATTGCGGCGGTTTAAAA
CCAACAATTTCTGTCAGCTAGAGAAATTATAAATTAGAATTTCCTCAAAA
TTTCAGTTTGATTTAGTATTTCTATTTTATTTACTTTTTATTTGGAAAAT
ATTTTTATGTTGAGACTTTCTTTTCAGTGCTTATTTGTCC
back to top

protein sequence of SMED30000370-orf-1

>SMED30000370-orf-1 ID=SMED30000370-orf-1|Name=SMED30000370-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1292bp
MGSYVELLKACKEGNNKKVKKLLENCTDVGDVRDLTDKTLLHYCFKYESC
VELILSVAPQLLDTGEKNGYTVLHLASMIKPPTSLRYLLSKNPDINKRNN
DSRSSLLLAVIYDNPEAVKLLCENNAEVNITDVNGVSPMHYAAKVKACLE
CENELEIINILLKHGADIDGLDLYKRSPLMWAVCSNNLTKMKHLIEKGAC
IYSKDSSGLSILHYATSNGNLEIIQMLLDDYKFDLETTDSNNCTALMYAC
SYNNVDVVELLLERGSNVNAEDSKRRNATHFASGKGDLKNLQVLHQYNVN
LWKLNNDSNYPLHEASYKGHNEIVEFLITNMEPKEKILNFINHRNSNGQT
ALHLSTVKDNLEICKILLQNGADPNIPLRVSNGKSMTALDLANKNETKLL
IVKFNGKSSDDLLKTSTINEEITGSISDESSSEEISENSSFDSAGEIDEN
QKKIDSDAEEINSTYEQILNTQDEIDLRNEEVDDAHIQIHNTEEQVDDTH
IQINDTEVQVDHTHIQINDKLEQIDSAEINNSIETNNLKDTNEFDEVYWK
ETNQNFNNQLKTSELSPDFNNEPVKLTNSKKIKDSSEECQILPKFTENEN
EINSKRQIIEITESYKDYLFASCRIGNFEIVCSFIHDGGEVSEIRDQSGK
TLLHYSLKNKELFELILKKTPELVNKFDETNLTILHMVIMSKEIERLPLL
LKNNANVNFPDGNGRTALNLAVIYNNLAALECMNDYITDKTRFIQIPDNS
GNYPLHYAIEICKYKKSVCQCKTYMELLLEMNGDIECRDRVSRTPLLLAI
NVNHVEAVETLLKNGANFLTRDIQNLCSVHYVCSEGNLEIFNQLAVFENF
DPNVTDPNGLTPIFYAVSNCNEKIVKRLIELNAKLDIVDQYGRTLCHKAA
EKGAFKCLELLLSYGVDPWSKCHDGTMPLHEAAYRGYKEIAEILLNTPSA
IENVNEKNNSGQTALHLAAVRNDCPMCFLLISKDSKINELLHNTSDNEEL
TAYDLATTPDCKNTLKTFGGRSAKKVINCSNSELDYSTQYNAEVELVPQV
NGYDISAPVSIRSTELALSTVPSAVYTYRTNEICSSKNIQSIQVLQNSKT
TSKKSDNSSKKKISLSSSDKSSTNISFGEAKEGSCASVKINNPQVFESLP
SSQLHRVDTGQDSKTYHETTSRCKSTHLIPSTNSIEFQKMSTCQTESILS
SNRKKSTTQSKSTNSSNKKQKKSPPSDKNLQKKVQKSVINYEYIRLNCKV
ANDIARLKFREENIEKLINPKMTKLHKTGCKKTQNHKIAAV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016491oxidoreductase activity
GO:00324402-alkenal reductase [NAD(P)] activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 257..271
score: 39.84
coord: 208..223
score: 36.67
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 68..97
e-value: 0.02
score: 24.0
coord: 2..31
e-value: 1100.0
score: 4.6
coord: 101..130
e-value: 0.13
score: 21.4
coord: 714..743
e-value: 0.17
score: 21.0
coord: 36..63
e-value: 3000.0
score: 1.5
coord: 681..710
e-value: 30.0
score: 13.5
coord: 241..270
e-value: 2.5E-7
score: 40.4
coord: 859..888
e-value: 0.0041
score: 26.3
coord: 174..203
e-value: 0.0091
score: 25.2
coord: 892..921
e-value: 2.0
score: 17.5
coord: 134..170
e-value: 0.018
score: 24.2
coord: 307..336
e-value: 0.86
score: 18.6
coord: 207..237
e-value: 0.096
score: 21.8
coord: 961..990
e-value: 0.075
score: 22.2
coord: 751..788
e-value: 160.0
score: 11.0
coord: 347..376
e-value: 1.2E-5
score: 34.8
coord: 925..954
e-value: 0.85
score: 18.6
coord: 649..677
e-value: 570.0
score: 6.8
coord: 792..821
e-value: 0.4
score: 19.7
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 134..169
e-value: 0.01
score: 16.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 681..713
score: 8.683
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 241..273
score: 13.01
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 925..957
score: 10.232
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 207..229
score: 9.778
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 68..100
score: 10.099
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 134..173
score: 9.938
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 101..133
score: 9.137
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 859..891
score: 10.419
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 792..824
score: 10.446
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 961..993
score: 8.523
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 347..379
score: 12.289
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 5..149
e-value: 1.3E-25
score: 91.9
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 532..766
e-value: 1.6E-23
score: 85.3
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 952..1025
e-value: 4.4E-6
score: 28.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 338..410
e-value: 4.8E-10
score: 41.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 768..951
e-value: 1.3E-42
score: 147.7
coord: 150..337
e-value: 1.4E-50
score: 173.7
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 620..1019
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 7..396
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 7..99
e-value: 1.6E-8
score: 35.0
coord: 831..921
e-value: 1.8E-14
score: 54.1
coord: 280..376
e-value: 5.8E-12
score: 46.0
coord: 686..761
e-value: 1.3E-6
score: 28.9
coord: 179..272
e-value: 9.3E-18
score: 64.6
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 2..993
score: 110.946
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1148..1175
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1197..1221
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 424..445
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1097..1117
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 424..448
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1197..1234
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 497..1266
coord: 9..261
coord: 193..656