Phosphodiesterase

Overview
NamePhosphodiesterase
Smed IDSMED30000345
Length (bp)3064
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphodiesterase (SMED30000345) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30000345) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphodiesterase (SMED30000345) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30000345) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000345

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000345SMESG000075722.1 dd_Smed_v4_8076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000345SMESG000075722.1 dd_Smed_v4_8076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000345SMESG000075722.1 dd_Smed_v4_8076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000345SMESG000075722.1 dd_Smed_v4_8076_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000345SMESG000075722.1 dd_Smed_v6_8076_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000345SMESG000075722.1 dd_Smed_v4_8076_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 361/794 (45.47%), Postives = 514/794 (64.74%), Query Frame = 3
Query:  567 ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG--------SLMSPSISSAE------ISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVK-KVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            A L    A     + +P+ D E     A +  +C Q       +L  +EK   +  +R+ V+          ++ +P   +AE         +    IL LCGELYD D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +   + + +  +  ++ K  +SE      D++ LQS+ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T+ VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F SF   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  124 ARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSE------DVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 891          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 361/794 (45.47%), Postives = 514/794 (64.74%), Query Frame = 3
Query:  567 ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG--------SLMSPSISSAE------ISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVK-KVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            A L    A     + +P+ D E     A +  +C Q       +L  +EK   +  +R+ V+          ++ +P   +AE         +    IL LCGELYD D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +   + + +  +  ++ K  +SE      D++ LQS+ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T+ VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F SF   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  126 ARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSE------DVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 893          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 361/794 (45.47%), Postives = 514/794 (64.74%), Query Frame = 3
Query:  567 ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG--------SLMSPSISSAE------ISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVK-KVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            A L    A     + +P+ D E     A +  +C Q       +L  +EK   +  +R+ V+          ++ +P   +AE         +    IL LCGELYD D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +   + + +  +  ++ K  +SE      D++ LQS+ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T+ VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F SF   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  112 ARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSE------DVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 879          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 361/794 (45.47%), Postives = 514/794 (64.74%), Query Frame = 3
Query:  567 ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG--------SLMSPSISSAE------ISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVK-KVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            A L    A     + +P+ D E     A +  +C Q       +L  +EK   +  +R+ V+          ++ +P   +AE         +    IL LCGELYD D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +   + + +  +  ++ K  +SE      D++ LQS+ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T+ VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F SF   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  133 ARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSE------DVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 900          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 355/765 (46.41%), Postives = 504/765 (65.88%), Query Frame = 3
Query:  654 LTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG--------SLMSPSISSAE------ISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVK-KVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            L  +C Q       +L  +EK   +  +R+ V+          ++ +P   +AE         +    IL LCGELYD D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +   + + +  +  ++ K  +SE      D++ LQS+ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T+ VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F SF   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:   47 LQVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSE------DVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 785          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-2 (Probable 3',5'-cyclic phosphodiesterase pde-2 [Source:UniProtKB/Swiss-Prot;Acc:P30645])

HSP 1 Score: 337.035 bits (863), Expect = 4.169e-101
Identity = 197/548 (35.95%), Postives = 306/548 (55.84%), Query Frame = 3
Query: 1338 VAMNIFRKL----DNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANE--LMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTS--NSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKD 2957
            V M+IF +     +NL+ L+  I+ EAKK T AE  +VFL +E+  ++V  +F+           ++ +T  G++++           GI GKVA+T   +NI D    P F   +DE    + RN++ FP+ D    ++GV  L NK NG  F+  DE   K FS +   SI H+++ K ++E + R  +  E  +      I E + + L   P+ +   F  +F  F   PR + E++   A++  F  L F   +++ +  L+  +L V  GYR  PYHNW+HA +V HF +L  +   +   L+++E  S  +A LCHDIDHRGT NSFQ+ S   + L+ LYS+EGSVLERHHF QTI +L  E  ++ ENL   +++  ++ IR++ILATD++ H R   + + MI  GY+  + DHR LL+ L+MT +DLSDQ K++ NA+ +A  IY EFF QGDLE  +G KP E MDR  A +P++QI FL  + +P FQ  A +  + G +  + +  N   W  L+ ++R+     N  +  + +
Sbjct:  160 VPMSIFDQFLCLTNNLSALISCIIAEAKKNTEAEDYAVFLHDEDNKQMV--LFNN---------ETMLMT--GKKFDM--------GYGIVGKVASTMRTMNIRDVSRCPFFNEEIDEQFSIKARNLIAFPLIDSSCSLIGVIVLYNKENG--FSRHDEKYIKRFSYFVANSIAHAILAKQIEEVRTRIHMVEEFKIQGEDAVIEEVDIMRLVNDPLRDWRYFSQNFADFSFPPRSVGENHFHRASMMFFEDLGFSMLYKLNKRKLSYLVLRVSAGYRPVPYHNWSHAFAVTHFCWLTLRTDAIRRALSDMERLSLLIACLCHDIDHRGTTNSFQMQSLQKTPLSVLYSTEGSVLERHHFAQTIKLLQQEECSILENLPAADFRTIVNTIREVILATDISAHLRKQERIKTMISEGYNPMSFDHRYLLMCLVMTASDLSDQAKNFHNAKRIAENIYLEFFAQGDLELQLGVKPLEMMDRTNAYVPTVQIDFLFKIGVPVFQLLASVVPE-GRTTSEAIDANHLCWVALDEEVRNNPSATNTLEYLRDE 683          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-2 (Probable 3',5'-cyclic phosphodiesterase pde-2 [Source:UniProtKB/Swiss-Prot;Acc:P30645])

HSP 1 Score: 337.035 bits (863), Expect = 5.241e-101
Identity = 197/548 (35.95%), Postives = 306/548 (55.84%), Query Frame = 3
Query: 1338 VAMNIFRKL----DNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANE--LMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTS--NSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKD 2957
            V M+IF +     +NL+ L+  I+ EAKK T AE  +VFL +E+  ++V  +F+           ++ +T  G++++           GI GKVA+T   +NI D    P F   +DE    + RN++ FP+ D    ++GV  L NK NG  F+  DE   K FS +   SI H+++ K ++E + R  +  E  +      I E + + L   P+ +   F  +F  F   PR + E++   A++  F  L F   +++ +  L+  +L V  GYR  PYHNW+HA +V HF +L  +   +   L+++E  S  +A LCHDIDHRGT NSFQ+ S   + L+ LYS+EGSVLERHHF QTI +L  E  ++ ENL   +++  ++ IR++ILATD++ H R   + + MI  GY+  + DHR LL+ L+MT +DLSDQ K++ NA+ +A  IY EFF QGDLE  +G KP E MDR  A +P++QI FL  + +P FQ  A +  + G +  + +  N   W  L+ ++R+     N  +  + +
Sbjct:  163 VPMSIFDQFLCLTNNLSALISCIIAEAKKNTEAEDYAVFLHDEDNKQMV--LFNN---------ETMLMT--GKKFDM--------GYGIVGKVASTMRTMNIRDVSRCPFFNEEIDEQFSIKARNLIAFPLIDSSCSLIGVIVLYNKENG--FSRHDEKYIKRFSYFVANSIAHAILAKQIEEVRTRIHMVEEFKIQGEDAVIEEVDIMRLVNDPLRDWRYFSQNFADFSFPPRSVGENHFHRASMMFFEDLGFSMLYKLNKRKLSYLVLRVSAGYRPVPYHNWSHAFAVTHFCWLTLRTDAIRRALSDMERLSLLIACLCHDIDHRGTTNSFQMQSLQKTPLSVLYSTEGSVLERHHFAQTIKLLQQEECSILENLPAADFRTIVNTIREVILATDISAHLRKQERIKTMISEGYNPMSFDHRYLLMCLVMTASDLSDQAKNFHNAKRIAENIYLEFFAQGDLELQLGVKPLEMMDRTNAYVPTVQIDFLFKIGVPVFQLLASVVPE-GRTTSEAIDANHLCWVALDEEVRNNPSATNTLEYLRDE 686          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-5 (Probable 3',5'-cyclic phosphodiesterase pde-5 [Source:UniProtKB/Swiss-Prot;Acc:P91119])

HSP 1 Score: 328.176 bits (840), Expect = 6.898e-99
Identity = 191/534 (35.77%), Postives = 309/534 (57.87%), Query Frame = 3
Query: 1329 MLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLP--DFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAH--FAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERA-CIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIR 2912
            +L VA +IF  + ++  ++ ++M  A+KL +A+R S+FL++ +  ++ +++FD    V       V +  EG+     KEIR   S+GIAG VA+TGE LNI +AY    F   VD  TGY T+ ILC PI   +  ++GV Q+ NK +G  FT  DED  + F+VYC +++ H+ +Y  ++ ++ + ++A E++ YH   + +    L    I    V L   DFN       +++E    L  + MF TL F    R     L RF+L V++ YR   YHNW H  SVAH  FA L    ++  +   +LE  + +V+ LCHD+DHRG NN++  T ++ LA++YS+  SV+ERHHFNQT+ IL  +G N+ ++L+ ++Y+K L LI+  ILATDLA  F    +   ++++  +D +  +HR L   ++MT  DL    K W       ++I+EEF+ QGD E+  G++P   MDR++A  +P +Q+ F+ G+ +PC+   A+++ +  + M +  + N KKWE+L  + R
Sbjct:  201 LLDVARSIFHDIVSMDAVIIKVMNFAQKLVDADRASLFLVDSKNAQIYARIFD----VGTGDEEHVRVNSEGQ-----KEIRFDMSKGIAGYVASTGEGLNIENAYEDERFNADVDSKTGYTTKTILCMPILI-RGIVIGVVQMVNKHDGV-FTRQDEDAFEIFAVYCGLALHHAKLYDKIRRSEQKYRVALEVLAYHSVCNADEVNKLKKIEINNRIVELETIDFNGM-----RLSELEKPLYAVYMFKTL-FADTLRFDTEDLIRFVLTVRKNYRRVAYHNWAHGWSVAHAMFATL----MNSPDAFTKLEALALYVSCLCHDLDHRGKNNAYMKTMSTPLASIYST--SVMERHHFNQTVTILQQDGHNILKSLSSEDYKKTLSLIKHCILATDLALFFSNKAKLNVILDNNTFDINRQEHRLLTQAVMMTGCDLVASAKPWNIQTETVKVIFEEFYDQGDAERLSGKEPIPMMDRQQAHMLPQMQVGFMRGICMPCYDLIARIFPK-NDKMRERCEYNAKKWEELAEEQR 710          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-1 (Probable 3',5'-cyclic phosphodiesterase pde-1 [Source:UniProtKB/Swiss-Prot;Acc:O18696])

HSP 1 Score: 145.591 bits (366), Expect = 2.251e-36
Identity = 88/291 (30.24%), Postives = 145/291 (49.83%), Query Frame = 3
Query: 1962 CPIP-EVSVFLPDFNSFDSIPRQMNE----HNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGY--RDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIE--SGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIP 2807
            CPIP E++  + +  ++   P Q+NE    H        +F+   F+ R+++P + L  ++  ++ GY   + PYHN  HA  V   ++       L N L +LE+ +     L HD +H G  N+F + S S  A LY ++ SVLE HH +    ++  +  N+  +L R EY++  +++ +I+LATD++ HF  I   + M+    G DK+     K L  ++  C D+S   K W         + EEFF QGDLE ++G   +   DR    +   QI F+D +  P
Sbjct:  127 CPIPPEIAELMKEVCTWSFSPFQLNEVSEGHALKYVGFELFNRYGFMDRFKVPLTALENYLSALEVGYSKHNNPYHNVVHAADVTQSSHFMLSQTGLANSLGDLELLAVLFGALIHDYEHTGHTNNFHIQSQSQFAMLY-NDRSVLENHHVSSCFRLMKEDDKNILTHLTRDEYKELRNMVIEIVLATDMSTHFMQIKTMKSMLSLPEGIDKN-----KALCLIVHAC-DISHPAKPWNLHERWTEGVLEEFFRQGDLEASMGLPYSPLCDRHTVHVADSQIGFIDFIVEP 410          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-1 (Probable 3',5'-cyclic phosphodiesterase pde-1 [Source:UniProtKB/Swiss-Prot;Acc:O18696])

HSP 1 Score: 145.591 bits (366), Expect = 8.113e-36
Identity = 88/291 (30.24%), Postives = 145/291 (49.83%), Query Frame = 3
Query: 1962 CPIP-EVSVFLPDFNSFDSIPRQMNE----HNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGY--RDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIE--SGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIP 2807
            CPIP E++  + +  ++   P Q+NE    H        +F+   F+ R+++P + L  ++  ++ GY   + PYHN  HA  V   ++       L N L +LE+ +     L HD +H G  N+F + S S  A LY ++ SVLE HH +    ++  +  N+  +L R EY++  +++ +I+LATD++ HF  I   + M+    G DK+     K L  ++  C D+S   K W         + EEFF QGDLE ++G   +   DR    +   QI F+D +  P
Sbjct:  258 CPIPPEIAELMKEVCTWSFSPFQLNEVSEGHALKYVGFELFNRYGFMDRFKVPLTALENYLSALEVGYSKHNNPYHNVVHAADVTQSSHFMLSQTGLANSLGDLELLAVLFGALIHDYEHTGHTNNFHIQSQSQFAMLY-NDRSVLENHHVSSCFRLMKEDDKNILTHLTRDEYKELRNMVIEIVLATDMSTHFMQIKTMKSMLSLPEGIDKN-----KALCLIVHAC-DISHPAKPWNLHERWTEGVLEEFFRQGDLEASMGLPYSPLCDRHTVHVADSQIGFIDFIVEP 541          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde6 (gene:FBgn0038237 transcript:FBtr0300330)

HSP 1 Score: 327.791 bits (839), Expect = 2.247e-95
Identity = 202/612 (33.01%), Postives = 331/612 (54.08%), Query Frame = 3
Query: 1173 VAIVGLVDKINS-ESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLE-------------EETNELVSKVFDGLPTVSENSPTSVFIT--PEGEEYEQP-------KEIRISTSQGIAGKVATTGEILNILDAYSHPLFY---RGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEK-AIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESML-KIMQENRKKWEKLNNDIRDG 2918
            + +  +++K N    F+  D+E+ +    F    + ++  + +  +   + + +L +A +IF + +NL  L+ +IMTEA++L   ERCSVFL++             E+ N+  ++      +  E    + F      G EY+          E+  ST   IA  VATTG+ +NI D       +   R  DE     T+ ILC PI + + K++GVAQL NK NG  FT SD  + +AF+++C + I ++ MY+N  +   + K+A E ++YH   S++    L+   I E   +  +  SF     ++ + ++  A L MF     +S+++IP  VL R++L V++ YR   YHNW HAL+VA   +   K   +   + +LEI    VA LCHD+DHRGTNN+FQ  + S LA LY++  S +E HHF+Q + ILNSEG+N+F+ L+ ++Y+  +  +   IL+TDLA +F+  N   E++E+G +D    + + LL  ++MT  D+S   K WE    VA+L+ +EFF QGDLEK  +  +P   MDRER   +P +Q+ F+D + +P ++     +  P  + L +   ENR+ W+ L   +  G
Sbjct:  365 IGVAQIINKTNGCMEFDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQILLNLARSIFEEQNNLECLVTKIMTEARELLKCERCSVFLVDLDCCEASHLEKIIEKPNQPATRAIKSADSFEEKKMRNRFTVLFELGGEYQAANVSRPSVSELSSSTLAQIAQFVATTGQTVNICDVIEWVRDHNQIRAEDEIDS--TQAILCMPIMNAQKKVIGVAQLINKANGVPFTDSDASIFEAFAIFCGLGIHNTQMYENACKLMAKQKVALECLSYHATASQDQTEKLTQDVIAEAESY--NLYSFTFTDFELVDDDTCRAVLRMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVKYHNWRHALNVAQTMFAMLKTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYTT--STMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVENGEFDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLEKLQLNTQPVAMMDRERKDELPKMQVGFIDVICLPLYRVLCDTF--PWITPLYEGTLENRRNWQDLAEKVEMG 968          

HSP 2 Score: 86.6557 bits (213), Expect = 7.495e-17
Identity = 63/197 (31.98%), Postives = 108/197 (54.82%), Query Frame = 3
Query: 1317 QTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLE-EETNE-LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGP-HFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKL 1898
            + E  +++  ++  +LD + +L  +I+     LT+A+R S+FL +   TN+ LV+K+FD    V++ +     +T    E     EI I    GIAG VA T +++NI +AY    F   +D  TGY+T  ILC PI + +  I+GVAQ+ NK NG   F   D ++ + +  +C I I ++ +++   +   RN++
Sbjct:  231 EGELFMELIRDVANELD-IDVLCHKILVNVGLLTHADRGSLFLAKGTPTNKYLVAKLFD----VTQKTALKDAVTRASAE-----EIIIPFGIGIAGMVAQTKQMINIKEAYKDARFNCEIDLKTGYKTNAILCMPICNYEGDIIGVAQIINKTNGCMEFDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQI 417          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde6 (gene:FBgn0038237 transcript:FBtr0345168)

HSP 1 Score: 327.791 bits (839), Expect = 2.247e-95
Identity = 202/612 (33.01%), Postives = 331/612 (54.08%), Query Frame = 3
Query: 1173 VAIVGLVDKINS-ESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLE-------------EETNELVSKVFDGLPTVSENSPTSVFIT--PEGEEYEQP-------KEIRISTSQGIAGKVATTGEILNILDAYSHPLFY---RGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEK-AIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESML-KIMQENRKKWEKLNNDIRDG 2918
            + +  +++K N    F+  D+E+ +    F    + ++  + +  +   + + +L +A +IF + +NL  L+ +IMTEA++L   ERCSVFL++             E+ N+  ++      +  E    + F      G EY+          E+  ST   IA  VATTG+ +NI D       +   R  DE     T+ ILC PI + + K++GVAQL NK NG  FT SD  + +AF+++C + I ++ MY+N  +   + K+A E ++YH   S++    L+   I E   +  +  SF     ++ + ++  A L MF     +S+++IP  VL R++L V++ YR   YHNW HAL+VA   +   K   +   + +LEI    VA LCHD+DHRGTNN+FQ  + S LA LY++  S +E HHF+Q + ILNSEG+N+F+ L+ ++Y+  +  +   IL+TDLA +F+  N   E++E+G +D    + + LL  ++MT  D+S   K WE    VA+L+ +EFF QGDLEK  +  +P   MDRER   +P +Q+ F+D + +P ++     +  P  + L +   ENR+ W+ L   +  G
Sbjct:  365 IGVAQIINKTNGCMEFDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQILLNLARSIFEEQNNLECLVTKIMTEARELLKCERCSVFLVDLDCCEASHLEKIIEKPNQPATRAIKSADSFEEKKMRNRFTVLFELGGEYQAANVSRPSVSELSSSTLAQIAQFVATTGQTVNICDVIEWVRDHNQIRAEDEIDS--TQAILCMPIMNAQKKVIGVAQLINKANGVPFTDSDASIFEAFAIFCGLGIHNTQMYENACKLMAKQKVALECLSYHATASQDQTEKLTQDVIAEAESY--NLYSFTFTDFELVDDDTCRAVLRMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVKYHNWRHALNVAQTMFAMLKTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYTT--STMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVENGEFDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLEKLQLNTQPVAMMDRERKDELPKMQVGFIDVICLPLYRVLCDTF--PWITPLYEGTLENRRNWQDLAEKVEMG 968          

HSP 2 Score: 86.6557 bits (213), Expect = 7.495e-17
Identity = 63/197 (31.98%), Postives = 108/197 (54.82%), Query Frame = 3
Query: 1317 QTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLE-EETNE-LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGP-HFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKL 1898
            + E  +++  ++  +LD + +L  +I+     LT+A+R S+FL +   TN+ LV+K+FD    V++ +     +T    E     EI I    GIAG VA T +++NI +AY    F   +D  TGY+T  ILC PI + +  I+GVAQ+ NK NG   F   D ++ + +  +C I I ++ +++   +   RN++
Sbjct:  231 EGELFMELIRDVANELD-IDVLCHKILVNVGLLTHADRGSLFLAKGTPTNKYLVAKLFD----VTQKTALKDAVTRASAE-----EIIIPFGIGIAGMVAQTKQMINIKEAYKDARFNCEIDLKTGYKTNAILCMPICNYEGDIIGVAQIINKTNGCMEFDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQI 417          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde6 (gene:FBgn0038237 transcript:FBtr0330048)

HSP 1 Score: 327.791 bits (839), Expect = 2.370e-95
Identity = 202/612 (33.01%), Postives = 331/612 (54.08%), Query Frame = 3
Query: 1173 VAIVGLVDKINS-ESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLE-------------EETNELVSKVFDGLPTVSENSPTSVFIT--PEGEEYEQP-------KEIRISTSQGIAGKVATTGEILNILDAYSHPLFY---RGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEK-AIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESML-KIMQENRKKWEKLNNDIRDG 2918
            + +  +++K N    F+  D+E+ +    F    + ++  + +  +   + + +L +A +IF + +NL  L+ +IMTEA++L   ERCSVFL++             E+ N+  ++      +  E    + F      G EY+          E+  ST   IA  VATTG+ +NI D       +   R  DE     T+ ILC PI + + K++GVAQL NK NG  FT SD  + +AF+++C + I ++ MY+N  +   + K+A E ++YH   S++    L+   I E   +  +  SF     ++ + ++  A L MF     +S+++IP  VL R++L V++ YR   YHNW HAL+VA   +   K   +   + +LEI    VA LCHD+DHRGTNN+FQ  + S LA LY++  S +E HHF+Q + ILNSEG+N+F+ L+ ++Y+  +  +   IL+TDLA +F+  N   E++E+G +D    + + LL  ++MT  D+S   K WE    VA+L+ +EFF QGDLEK  +  +P   MDRER   +P +Q+ F+D + +P ++     +  P  + L +   ENR+ W+ L   +  G
Sbjct:  365 IGVAQIINKTNGCMEFDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQILLNLARSIFEEQNNLECLVTKIMTEARELLKCERCSVFLVDLDCCEASHLEKIIEKPNQPATRAIKSADSFEEKKMRNRFTVLFELGGEYQAANVSRPSVSELSSSTLAQIAQFVATTGQTVNICDVIEWVRDHNQIRAEDEIDS--TQAILCMPIMNAQKKVIGVAQLINKANGVPFTDSDASIFEAFAIFCGLGIHNTQMYENACKLMAKQKVALECLSYHATASQDQTEKLTQDVIAEAESY--NLYSFTFTDFELVDDDTCRAVLRMFMQCNLVSQFQIPYDVLCRWVLSVRKNYRPVKYHNWRHALNVAQTMFAMLKTGKMERFMTDLEILGLLVACLCHDLDHRGTNNAFQTKTESPLAILYTT--STMEHHHFDQCVMILNSEGNNIFQALSPEDYRSVMKTVESAILSTDLAMYFKKRNAFLELVENGEFDWQGEEKKDLLCGMMMTACDVSAIAKPWEVQHKVAKLVADEFFDQGDLEKLQLNTQPVAMMDRERKDELPKMQVGFIDVICLPLYRVLCDTF--PWITPLYEGTLENRRNWQDLAEKVEMG 968          

HSP 2 Score: 86.6557 bits (213), Expect = 8.112e-17
Identity = 63/197 (31.98%), Postives = 108/197 (54.82%), Query Frame = 3
Query: 1317 QTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLE-EETNE-LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGP-HFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKL 1898
            + E  +++  ++  +LD + +L  +I+     LT+A+R S+FL +   TN+ LV+K+FD    V++ +     +T    E     EI I    GIAG VA T +++NI +AY    F   +D  TGY+T  ILC PI + +  I+GVAQ+ NK NG   F   D ++ + +  +C I I ++ +++   +   RN++
Sbjct:  231 EGELFMELIRDVANELD-IDVLCHKILVNVGLLTHADRGSLFLAKGTPTNKYLVAKLFD----VTQKTALKDAVTRASAE-----EIIIPFGIGIAGMVAQTKQMINIKEAYKDARFNCEIDLKTGYKTNAILCMPICNYEGDIIGVAQIINKTNGCMEFDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQI 417          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0303163)

HSP 1 Score: 308.916 bits (790), Expect = 1.180e-88
Identity = 191/588 (32.48%), Postives = 316/588 (53.74%), Query Frame = 3
Query: 1173 VAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFD-GLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVF-LPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSN----PDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIR 2912
            + +  +++K+N E F+  D ++     +F    L ++  Y   +    + + +L +A  IF +   +  ++  I+T  + L   +R  + L+ E      S+VFD     +SE   TS            P E R   + GI G VATTGE +N+ +AY    F   VDE++ ++ R+ILC  IK+   +I+GV QL NK N   FT +DE+  +AF+++C + I ++ MY+    A  +  +  E+++YH   + +    L    +P    F L DF  FD I     + +++ A L MF  L F+ R+ I   VL R++L VK+ YR+  YHNW HA +VA   +             E+E  +  +  LCHD+DHRGTNNSFQ+ ++S LA LYS+  S +E HHF+Q + ILNS G+ +  NL+  +Y + + ++ D IL+TDLA +F+   ++   +ES    ++     + R LL  + MT  DLS   K WE  + VA L+  EFF QGD+EK  +   P + M+RE+   +P +Q++F+D + +P ++ FA L  +  E +++ +++NR  W  L + ++
Sbjct:  495 IGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILLVHEADKGSFSRVFDFEANDLSEEEATS---------RTSPYESRFPINIGITGHVATTGETVNVPNAYEDDRFDASVDENSCFKHRSILCMAIKNSLGQIIGVIQLINKFNELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVHFRLHDFK-FDDI--HFEDDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYRNVTYHNWRHAFNVAQMMFAILTTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLAQLYST--STMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTDLAVYFK---KRGPFLESVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQELNITPIDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSDKL-EPLVEGVRDNRGHWIDLADVVK 1064          

HSP 2 Score: 113.62 bits (283), Expect = 4.128e-25
Identity = 72/207 (34.78%), Postives = 111/207 (53.62%), Query Frame = 3
Query: 1299 EKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE-------LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKL 1898
            E K   + E + ++  +I  +L+  T+  K I+     L NA+R S+FL++   N        LVSK+FD  P  +             EE EQ  E+R++   GIAG VA +GE +NI DAY    F   +D  TGYRT+ +LC PIKD    ++GVAQ+ NK+NG  F+  DE +  ++  +C I + ++ +Y+  Q    RN++
Sbjct:  353 ELKQLDEKELIFELVKDICNELEVRTLCHK-ILQNVSILLNADRGSLFLVQGRCNGPDGLKKCLVSKLFDVCPRSTV------------EEMEQQDEVRVAWGTGIAGHVAESGEPVNIPDAYQDERFNCEIDSLTGYRTKALLCMPIKDSSGDVIGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQV 546          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0303162)

HSP 1 Score: 308.531 bits (789), Expect = 2.724e-88
Identity = 191/588 (32.48%), Postives = 316/588 (53.74%), Query Frame = 3
Query: 1173 VAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFD-GLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVF-LPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSN----PDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIR 2912
            + +  +++K+N E F+  D ++     +F    L ++  Y   +    + + +L +A  IF +   +  ++  I+T  + L   +R  + L+ E      S+VFD     +SE   TS            P E R   + GI G VATTGE +N+ +AY    F   VDE++ ++ R+ILC  IK+   +I+GV QL NK N   FT +DE+  +AF+++C + I ++ MY+    A  +  +  E+++YH   + +    L    +P    F L DF  FD I     + +++ A L MF  L F+ R+ I   VL R++L VK+ YR+  YHNW HA +VA   +             E+E  +  +  LCHD+DHRGTNNSFQ+ ++S LA LYS+  S +E HHF+Q + ILNS G+ +  NL+  +Y + + ++ D IL+TDLA +F+   ++   +ES    ++     + R LL  + MT  DLS   K WE  + VA L+  EFF QGD+EK  +   P + M+RE+   +P +Q++F+D + +P ++ FA L  +  E +++ +++NR  W  L + ++
Sbjct:  539 IGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILLVHEADKGSFSRVFDFEANDLSEEEATS---------RTSPYESRFPINIGITGHVATTGETVNVPNAYEDDRFDASVDENSCFKHRSILCMAIKNSLGQIIGVIQLINKFNELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVHFRLHDFK-FDDI--HFEDDDTLKACLRMFLDLDFVERFHIDYEVLCRWLLSVKKNYRNVTYHNWRHAFNVAQMMFAILTTTQWWKIFGEIECLALIIGCLCHDLDHRGTNNSFQIKASSPLAQLYST--STMEHHHFDQCLMILNSPGNQILANLSSDDYCRVIRVLEDAILSTDLAVYFK---KRGPFLESVSQPTSYWVAEEPRALLRAMSMTVCDLSAITKPWEIEKRVADLVSSEFFEQGDMEKQELNITPIDIMNREKEDELPMMQVNFIDSICLPIYEAFATLSDKL-EPLVEGVRDNRGHWIDLADVVK 1108          

HSP 2 Score: 113.62 bits (283), Expect = 4.749e-25
Identity = 72/207 (34.78%), Postives = 111/207 (53.62%), Query Frame = 3
Query: 1299 EKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE-------LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKL 1898
            E K   + E + ++  +I  +L+  T+  K I+     L NA+R S+FL++   N        LVSK+FD  P  +             EE EQ  E+R++   GIAG VA +GE +NI DAY    F   +D  TGYRT+ +LC PIKD    ++GVAQ+ NK+NG  F+  DE +  ++  +C I + ++ +Y+  Q    RN++
Sbjct:  397 ELKQLDEKELIFELVKDICNELEVRTLCHK-ILQNVSILLNADRGSLFLVQGRCNGPDGLKKCLVSKLFDVCPRSTV------------EEMEQQDEVRVAWGTGIAGHVAESGEPVNIPDAYQDERFNCEIDSLTGYRTKALLCMPIKDSSGDVIGVAQVINKMNGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQV 590          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 328.946 bits (842), Expect = 2.887e-98
Identity = 196/530 (36.98%), Postives = 296/530 (55.85%), Query Frame = 3
Query: 1329 MLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKL 2897
            +L V+   F  +  +  LL+ IM  AK L NA+RC++F ++    EL S +FD      EN    VF         + KEIR S  +GIAG+VA TGE+LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK+ G  FT +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + E +  L+   +P     E+ +F  D   F+ +   +         + M H     + + + +  L RF + V++ YR  PYHNW HA++VAH  Y   +    +    ELE     +A LCHD+DHRG +NS+    +  LAALYS+  S +E+HHF+QT+ IL  EG N+F NL   EY++ L++IR  I+ATDLA +F    Q  E++ +G  D +N  HR  ++ L+MT  DL    K W   R  A  IY EF+ +GD  K IG +P   MDR++   +P  Q+ F + VAIPC+   ++L+  P   +L+  +EN  +WE++
Sbjct:  263 LLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD---IGEENEGKPVF--------RKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVS-RGTVIGVVQMVNKLGGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLTLPSAIYKEIELFHFDIAPFEELWPAI--------FVYMVHNSCGKTSFELEK--LCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTTGI--FTELERKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQ-EGHNIFSNLTSGEYEQVLEIIRKAIIATDLALYFGNRKQLAELLSTGALDLNNRAHRDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKIGMQPISMMDRDKKDEVPQGQVGFYNAVAIPCYTTLSELF-PPSVPLLEACRENLSQWERI 764          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 328.561 bits (841), Expect = 1.399e-97
Identity = 205/583 (35.16%), Postives = 318/583 (54.55%), Query Frame = 3
Query: 1173 VAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMS-SLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKL 2897
            +AI+ L   +  E FN    E+      + +  +    +   + K+T++  + +L V+   F  +  +  LL+ IM  AK L NA+RC++F ++    EL S +FD      EN    VF         + KEIR S  +GIAG+VA TGE+LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK+ G  FT +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + E +  L+   +P     E+ +F  D   F+ +   +         + M H     + + + +  L RF + V++ YR  PYHNW HA++VAH  Y   +    +    ELE     +A LCHD+DHRG +NS+    +  LAALYS+  S +E+HHF+QT+ IL  EG N+F NL   EY++ L++IR  I+ATDLA +F    Q  E++ +G  D +N  HR  ++ L+MT  DL    K W   R  A  IY EF+ +GD  K IG +P   MDR++   +P  Q+ F + VAIPC+   ++L+  P   +L+  +EN  +WE++
Sbjct:  211 IAILELHRHLGREPFNLSHQEVATANLAWASVAIHQVQVCRGLAKQTELN-DFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD---IGEENEGKPVF--------RKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIV-SRGTVIGVVQMVNKLGGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLTLPSAIYKEIELFHFDIAPFEELWPAI--------FVYMVHNSCGKTSFELEK--LCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTTGI--FTELERKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQ-EGHNIFSNLTSGEYEQVLEIIRKAIIATDLALYFGNRKQLAELLSTGALDLNNRAHRDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKIGMQPISMMDRDKKDEVPQGQVGFYNAVAIPCYTTLSELF-PPSVPLLEACRENLSQWERI 764          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 321.627 bits (823), Expect = 6.110e-96
Identity = 190/509 (37.33%), Postives = 284/509 (55.80%), Query Frame = 3
Query: 1329 MLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLY 2834
            +L V+   F  +  +  LL+ IM  AK L NA+RC++F ++    EL S +FD      EN    VF         + KEIR S  +GIAG+VA TGE+LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK+ G  FT +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + E +  L+   +P     E+ +F  D   F+ +   +         + M H     + + + +  L RF + V++ YR  PYHNW HA++VAH  Y   +    +    ELE     +A LCHD+DHRG +NS+    +  LAALYS+  S +E+HHF+QT+ IL  EG N+F NL   EY++ L++IR  I+ATDLA +F    Q  E++ +G  D +N  HR  ++ L+MT  DL    K W   R  A  IY EF+ +GD  K IG +P   MDR++   +P  Q+ F + VAIPC+   ++L+
Sbjct:  263 LLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD---IGEENEGKPVF--------RKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIV-SRGTVIGVVQMVNKLGGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLTLPSAIYKEIELFHFDIAPFEELWPAI--------FVYMVHNSCGKTSFELEK--LCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTTGI--FTELERKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLTSGEYEQVLEIIRKAIIATDLALYFGNRKQLAELLSTGALDLNNRAHRDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKIGMQPISMMDRDKKDEVPQGQVGFYNAVAIPCYTTLSELF 745          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 324.709 bits (831), Expect = 1.023e-95
Identity = 193/585 (32.99%), Postives = 321/585 (54.87%), Query Frame = 3
Query: 1179 IVGLVDKINSES----FNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELV--SKVFDGL-PTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            ++G+   IN       F   D +++Q+   F    + ++  +   +K   ++ A+L+V  ++F +  +L  ++++IM  A+ L   ERCSV LLE+  + +V  +K F+ L P  S +   S   + +   Y    +  I+ S  IA  VA+TG  +NI DAY  P F    D+ +G+  R++LC PI +   +I+GVAQ+ N+++G  F  +D+ L +AF ++C + I +++MY  V+++  +  +A ++++YH   S+          IP V     D  SFD     ++    V A L MF  L  + +++I    L R++L V++ YR   YHNW HA +V    +           L E+E  +  V  +CHD+DHRGTNN+FQ  + S L+ LY +  + LE HHFN  + IL SEG N+F NL+  EY + + L++  ILATDL  +F+  N   E++  G Y+ +  +HR++   +LMT  DL    K WE +  VA L+  EFF QGD E++ +   P+   DR R   +P LQ+ ++DG+  P ++ FAKL  +  + M+ +++ NR KWE+L++
Sbjct:  285 VIGVAQAINKSPNGALFTQDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVKFTKSFELLSPKCSADMENSFKDSMDKSSY---SDWLINNS--IAELVASTGLPVNISDAYQDPRFDAEADQFSGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKTEVDKFKAANIPLVCELGIDKLSFDDFSLDVDA--MVTAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQCMFSMLTTAGFQETLTEMETLALIVGCICHDLDHRGTNNAFQAKTGSALSLLYGTSAT-LEHHHFNHAVMILQSEGHNIFSNLSSHEYGELMQLLKQSILATDLTLYFQNRNSFFELVNKGEYNWNVKEHREMCRSMLMTACDLGAVTKPWEISHKVAELVTSEFFEQGDRERSELKLTPSAIFDRNRKDELPGLQLEWIDGICAPLYETFAKLNPKL-QPMMDLIKANRAKWEELHH 860          

HSP 2 Score: 101.679 bits (252), Expect = 2.334e-21
Identity = 68/213 (31.92%), Postives = 116/213 (54.46%), Query Frame = 3
Query: 1266 PVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE--LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKV-NGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNK 1895
            P       YY+++    + E  L++  +I   LD LT L  +I+     + +A+RCS+FL+E  TN+  LVSK FD       ++ T+V  +    +     E+++   +GI G VA  GE +NI DAY    F   +D+ TGY+T+++LC PI +   +++GVAQ  NK  NG  FT  DE + + +  +C I+I ++ ++   ++   R++
Sbjct:  139 PSTAVDYKYYLKEHN--EREFFLELVKDISNDLD-LTSLSYKILVFVCIMVDADRCSLFLVEGPTNKKTLVSKFFDV------HAGTTVLPSLSNSD-----EVQVPWGKGIIGYVAEHGETVNIPDAYQDHRFSDEIDKLTGYKTKSLLCMPIHNSDGEVIGVAQAINKSPNGALFTQDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSR 337          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde11al (phosphodiesterase 11a, like [Source:ZFIN;Acc:ZDB-GENE-031118-106])

HSP 1 Score: 310.457 bits (794), Expect = 2.012e-90
Identity = 190/586 (32.42%), Postives = 315/586 (53.75%), Query Frame = 3
Query: 1179 IVGLVDKIN----SESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELV--SKVFDGL-PTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP---EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKL 2897
            ++G+V  IN       F   D +++Q+   F    + ++  +   +K   ++ A+L+V  ++F +  +L  ++++IM  A  L   ERCSV LLE+  + +V  S+ F+ + P  S +   S+       E     +  I+ S  IA  VA+TG  +NI D    P F    D+++G+  R++LC PI +   +I+GVAQ+ N+++   F  +D+ L +AF ++C + I +++MY  V++   +  +A ++++YH   S+     L    IP   E+ +    FN F      ++    + A+L MF  L  + +++I   VL R++L V++ YR   YHNW HA +V+   ++          L E E  +  V   CHD+DHRGTNN+FQ  S S LA LY +  + LE HHFN  + IL SEG N+F NL  +EY   + L++  IL+TDL  +F+      + + SG +  S+ +HR +   +LMT  DL    + WE ++ VA L+  EFF QGD E++ +   PA   DR R   +P LQ+ ++DG+  P ++   KL R+  + M+  +  NRKKWE+L
Sbjct:  291 VIGVVQAINKNPSGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYERSRALLEVVNDLFEEQTDLEKIVRKIMQRALTLLQCERCSVLLLEDIHSPVVKFSQTFELMSPLCSVDRDISM-------EKVSCSDWLINNS--IAELVASTGLPVNISDVCQDPRFDAEADQASGFHIRSVLCVPIWNRTHQIIGVAQILNRLDRKTFNDADQRLFEAFVIFCGLGINNTMMYNQVKKTWAKQSVALDMLSYHATCSKAEVDRLKAAKIPLSSELGIDEFHFNDF-----SLDNDAMITASLRMFLELGVVQKFKIDYEVLCRWLLTVRKNYRTVAYHNWRHAFNVSQCMFIMITTAAFQEVLTETETLALMVGCFCHDLDHRGTNNAFQAKSGSALALLYGTSAT-LEHHHFNHAVMILQSEGHNIFANLCSKEYCNMMQLLKQAILSTDLTLYFKKRTTFFDCVLSGQFSWSDEEHRDMFRSMLMTACDLGAVTRPWEISKQVAELVTSEFFEQGDRERSELKLTPAAIFDRNRKDELPVLQLEWIDGICKPLYEALVKLNRKL-QPMVDGIDANRKKWEEL 860          

HSP 2 Score: 93.2041 bits (230), Expect = 7.982e-19
Identity = 65/209 (31.10%), Postives = 114/209 (54.55%), Query Frame = 3
Query: 1278 SSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE--LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNK-VNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNK 1895
            S++ Y    K   + E  L++  +I  +LD +T L  +I+     + NA+RCS+FL+E  +++  LVSK FD       +S T+V   P     +   E+++   +GI G VA  GE +N  +AY    F   +D+ TGY+T++ILC  I++   +++GV Q  NK  +G  FT  DE + + +  +C ISI ++ ++   ++   R++
Sbjct:  145 SAIDYKYRLKESNEREFFLELVKDISNELD-MTNLSYKILINVCIMVNADRCSLFLVEGPSHKRTLVSKFFDV------HSGTTV--RPSSSTLDS-NEVQVPWGKGIIGYVAEHGETVNTPNAYEDHRFSDEIDKLTGYKTQSILCMAIRNSDGEVIGVVQAINKNPSGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYERSR 343          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE10A (phosphodiesterase 10A [Source:NCBI gene;Acc:100485841])

HSP 1 Score: 323.168 bits (827), Expect = 6.903e-96
Identity = 192/533 (36.02%), Postives = 301/533 (56.47%), Query Frame = 3
Query: 1329 MLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQ--LNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLN 2900
            +L V+   F  +  +  LL+ IM  AK L NA+RC++F ++ +  EL S +FD +    E  P           +++ KEIR S  +GIAG+VA TGE+LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK++G  F+ +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + + +  L  C +P     E+ ++  D   F+ +   +         + M H     + + + +  L RF + VK+ YR  PYHNW HA++V+H  Y+  +N    NQ    +LE     VA LCHD+DHRG  NS+    +  LAALYS+  S +E+HHF+QT+ IL  EG N+F NL+  EY++ L++IR  I+ATDLA +F       ++ + G  + +N  HR  L+ L+MT  DL    K W   R +A  IY EF+T+GD  K +G  P   MDR++   IP  Q+ F + VA+PC+   ++++      +L+  +EN  +WEK++
Sbjct:  261 LLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFD-IGEEDEGKPV----------FKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDVYTGYTTRNILCMPIV-IRGSVIGVVQMVNKLSGSAFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTLEKLSYHSICTSDEWQNLMNCTLPVSLCREIELYHFDIQPFEDLWPAI--------YVYMIHQSCGKNCFELEK--LCRFTMSVKKNYRRVPYHNWKHAVTVSHCMYVILQN----NQEIFTDLERKGLLVACLCHDLDHRGYTNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLSSNEYEQVLEIIRKAIIATDLALYFGNRKHLEDLHQMGALNLNNQAHRDRLIGLMMTACDLCSVTKLWPVTRLIADDIYAEFWTEGDEMKRLGISPIPMMDRDKQDEIPQGQMGFYNAVAVPCYTTLSEIFPST-RPLLQACKENLSQWEKVS 764          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: pde2a (phosphodiesterase 2A [Source:NCBI gene;Acc:780063])

HSP 1 Score: 313.538 bits (802), Expect = 1.254e-94
Identity = 183/465 (39.35%), Postives = 277/465 (59.57%), Query Frame = 3
Query:  606 IFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMN-------------------GSLMSPSISSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEEN 1943
            + LP+ D + +   + +  +C+Q      + L  LEK   +  +R+  +                     SL  PS ++ E  +E    IL LCGELYD D   LQ+K+I++L+         +L VS +  +  CQV+   ++  E+   +    +  +V +   K +   +I ++  + + L ++ GF+  S+L +P++S   + +VA+    +K   + +   D   IQ  F +T+ VL S+LA+  E+K K + +++ +V  ++   LD++++LL+EI+TEA+ L+NAE CSVFLLE +++ELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAYSHPLFYRGVD+STG+RTRNILCFPIK+E ++++GVA+L NK+NGP FT  DEDLA AFS+YC ISI HSL+YK V+EAQ R+ LANE+M YHM+I  + 
Sbjct:  142 LILPLLDQDTARVVSVILLHCSQLSDSDEQNLRTLEKHTLVACKRVLAIQKLQPSPQVPPSPLSPRTYQNSLPKPSPTANESYDELDRKILQLCGELYDLDAASLQIKVIHYLEQQTQSPCCCLLLVSEDSHQLFCQVVGGKVLEEEISFPLTFGHLGQVVDKK--KSITLQDISSE--EHRQLNNMLGFEVHSMLCVPVISRATSQVVALACAFNKQGGK-YTEVDEHKIQHCFCYTSTVLTSTLAFQKEQKLKCECQSLRRVRKSLITYLDDVSVLLQEIITEARNLSNAEICSVFLLERQSHELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIKDAYSHPLFYRGVDDSTGFRTRNILCFPIKNESNEVIGVAELVNKINGPGFTKFDEDLATAFSIYCGISIAHSLLYKQVREAQFRSHLANEMMMYHMKICRDR 584          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: ENSXETT00000053056.1 (phosphodiesterase 11A [Source:NCBI gene;Acc:100379882])

HSP 1 Score: 319.701 bits (818), Expect = 9.802e-94
Identity = 192/584 (32.88%), Postives = 311/584 (53.25%), Query Frame = 3
Query: 1179 IVGLVDKIN----SESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELV--SKVFDGL-PTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEK-AIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLN 2900
            I+G+   IN       F   D +++Q+   F    + ++  +   +K   ++ A+L+V  ++F +  +L  ++K+IM  A+ L   ERCSV LLE+  + +V  +K F+ L P  S ++  S   + E   Y          +  IA  VA+TG  +NI DAY  P F    D+ +G+  R++LC PI +   +I+GVAQ+ N+++G  F  +D+ L +AF ++C + I +++MY  V+++  +  +A ++++YH   S+          IP VS        FD     ++   S  A L MF  L  + +++I    L R++L +++ YR   YHNW HA +V    +           L++ E  +  V  LCHD+DHRGTNN+FQ  S S L+ LY +  + LE HHFN  + IL SEG N+F NL+ QEY   + L++  ILATD+  HF   N+  E++  G Y+ +   HR +   +LMT  DL    K WE +R VA L+  EFF QGD E+  +   P+   DR R   +P LQ+ ++D +  P +++  K+  +  + ML  +  NR KWE+L+
Sbjct:  290 IIGVAQAINKTPGGAPFIEDDEKVMQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKVVKKIMHRAQNLLKCERCSVLLLEDIESPVVKFTKSFELLSPKCSADTENSFKDSVEKSSYSD-----WLVNNSIAELVASTGLPVNISDAYQDPRFDVEADQFSGFHIRSVLCVPIWNSSHQIIGVAQVLNRIDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIPLVSELSIADIHFDDFCLDVDAMIS--AALRMFMELGMVQKFKIDYETLCRWLLTIRKNYRMVLYHNWRHAFNVCQLMFAMLTTAGFQEVLSDTETLALIVGCLCHDLDHRGTNNAFQAKSGSALSQLYGTSAT-LEHHHFNHAVMILQSEGHNIFANLSSQEYSDLMQLLKQSILATDITLHFERRNEFFELVNKGDYNWNVKSHRVIFRSMLMTACDLGAATKPWEISRQVAELVTSEFFEQGDRERLELKMTPSAIFDRNRKDELPRLQLEWIDNICFPLYESLVKINGKL-KPMLDSVTTNRGKWEELH 864          

HSP 2 Score: 97.4413 bits (241), Expect = 7.121e-20
Identity = 61/185 (32.97%), Postives = 97/185 (52.43%), Query Frame = 3
Query: 1368 NLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE--LVSKVFDG------LPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKV-NGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNK 1895
            NLT L  +I+     + +A+RCS+FL+E   N+  LVSK FD       LP+ S                E   E+++   +GI G VA  GE +NI DAY    F   +D+ TGY+T+++LC PI+    +I+GVAQ  NK   G  F   DE + + +  +C I+I ++ ++   ++   R++
Sbjct:  173 NLTSLCYKILIFVCIMVDADRCSLFLVEGTANKKSLVSKFFDVHAGTTLLPSCST---------------ENSNEVQVPWGKGIIGYVAEHGETVNIPDAYQDRRFSDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKTPGGAPFIEDDEKVMQMYLPFCGIAISNAQLFAASRKEYDRSR 342          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: PDE10A (phosphodiesterase 10A [Source:NCBI gene;Acc:100485841])

HSP 1 Score: 304.294 bits (778), Expect = 4.676e-90
Identity = 179/486 (36.83%), Postives = 277/486 (57.00%), Query Frame = 3
Query: 1404 AKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQ--LNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLY 2834
            AK L NA+RC++F ++ +  EL S +FD +    E  P           +++ KEIR S  +GIAG+VA TGE+LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK++G  F+ +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + + +  L  C +P     E+ ++  D   F+ +   +         + M H     + + + +  L RF + VK+ YR  PYHNW HA++V+H  Y+  +N    NQ    +LE     VA LCHD+DHRG  NS+    +  LAALYS+  S +E+HHF+QT+ IL  EG N+F NL+  EY++ L++IR  I+ATDLA +F       ++ + G  + +N  HR  L+ L+MT  DL    K W   R +A  IY EF+T+GD  K +G  P   MDR++   IP  Q+ F + VA+PC+   ++++
Sbjct:  220 AKNLVNADRCALFQVDHKNKELYSDLFD-IGEEDEGKPV----------FKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDVYTGYTTRNILCMPIVI-RGSVIGVVQMVNKLSGSAFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTLEKLSYHSICTSDEWQNLMNCTLPVSLCREIELYHFDIQPFEDLWPAI--------YVYMIHQSCGKNCFELEK--LCRFTMSVKKNYRRVPYHNWKHAVTVSHCMYVILQN----NQEIFTDLERKGLLVACLCHDLDHRGYTNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLSSNEYEQVLEIIRKAIIATDLALYFGNRKHLEDLHQMGALNLNNQAHRDRLIGLMMTACDLCSVTKLWPVTRLIADDIYAEFWTEGDEMKRLGISPIPMMDRDKQDEIPQGQMGFYNAVAVPCYTTLSEIF 677          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: pde2a (phosphodiesterase 2A [Source:NCBI gene;Acc:780063])

HSP 1 Score: 301.212 bits (770), Expect = 6.111e-90
Identity = 180/461 (39.05%), Postives = 269/461 (58.35%), Query Frame = 3
Query:  606 IFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMN-------------------GSLMSPSISSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQI 1931
            + LP+ D + +   + +  +C+Q      + L  LEK   +  +R+  +                     SL  PS ++ E  +E    IL LCGELYD D   LQ+K+I++L+         +L VS +  +  CQV+   ++  E+   +    +  +V +   K +   +I ++  + + L ++ GF+  S+L +P++S   + +VA+    +K   + +   D   IQ  F +T+ VL S+LA+  E+K K + +             D++++LL+EI+TEA+ L+NAE CSVFLLE +++ELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAYSHPLFYRGVD+STG+RTRNILCFPIK+E ++++GVA+L NK+NGP FT  DEDLA AFS+YC ISI HSL+YK V+EAQ R+ LANE+M YHM++
Sbjct:  140 LILPLLDQDTARVVSVILLHCSQLSDSDEQNLRTLEKHTLVACKRVLAIQKLQPSPQVPPSPLSPRTYQNSLPKPSPTANESYDELDRKILQLCGELYDLDAASLQIKVIHYLEQQTQSPCCCLLLVSEDSHQLFCQVVGGKVLEEEISFPLTFGHLGQVVDKK--KSITLQDISSE--EHRQLNNMLGFEVHSMLCVPVISRATSQVVALACAFNKQGGK-YTEVDEHKIQHCFCYTSTVLTSTLAFQKEQKLKCECQV---------GPTDDVSVLLQEIITEARNLSNAEICSVFLLERQSHELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIKDAYSHPLFYRGVDDSTGFRTRNILCFPIKNESNEVIGVAELVNKINGPGFTKFDEDLATAFSIYCGISIAHSLLYKQVREAQFRSHLANEMMMYHMKV 569          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Gm45837 (predicted gene 45837 [Source:MGI Symbol;Acc:MGI:5804952])

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 354/779 (45.44%), Postives = 512/779 (65.73%), Query Frame = 3
Query:  606 IFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG----SLMSPSISSAEISNETRN------AILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKE-NCV--KKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            + +P+ D E     A +  +C Q      ++L  +EK   +  +R+  +      ++ + S+ ++E   + +        IL LCGEL+D D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +    +  +V++  C+  K + S ++Q        LQ++ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T  VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F +F   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  170 LVIPLLDKETGSVAAVILVHCGQLSDSEEQSLQVVEKHALVALRRVQALQQRRPEAVQNTSVDASEDQKDEKGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTMGRLGQVVEDKQCIQLKDLTSDDVQQ-------LQNMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 921          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde2a (phosphodiesterase 2A, cGMP-stimulated [Source:MGI Symbol;Acc:MGI:2446107])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 354/779 (45.44%), Postives = 512/779 (65.73%), Query Frame = 3
Query:  606 IFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG----SLMSPSISSAEISNETRN------AILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKE-NCV--KKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            + +P+ D E     A +  +C Q      ++L  +EK   +  +R+  +      ++ + S+ ++E   + +        IL LCGEL+D D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +    +  +V++  C+  K + S ++Q        LQ++ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T  VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F +F   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  144 LVIPLLDKETGSVAAVILVHCGQLSDSEEQSLQVVEKHALVALRRVQALQQRRPEAVQNTSVDASEDQKDEKGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTMGRLGQVVEDKQCIQLKDLTSDDVQQ-------LQNMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 895          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde2a (phosphodiesterase 2A, cGMP-stimulated [Source:MGI Symbol;Acc:MGI:2446107])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 354/779 (45.44%), Postives = 512/779 (65.73%), Query Frame = 3
Query:  606 IFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG----SLMSPSISSAEISNETRN------AILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKE-NCV--KKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            + +P+ D E     A +  +C Q      ++L  +EK   +  +R+  +      ++ + S+ ++E   + +        IL LCGEL+D D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +    +  +V++  C+  K + S ++Q        LQ++ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T  VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F +F   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  144 LVIPLLDKETGSVAAVILVHCGQLSDSEEQSLQVVEKHALVALRRVQALQQRRPEAVQNTSVDASEDQKDEKGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTMGRLGQVVEDKQCIQLKDLTSDDVQQ-------LQNMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 895          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde2a (phosphodiesterase 2A, cGMP-stimulated [Source:MGI Symbol;Acc:MGI:2446107])

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 354/779 (45.44%), Postives = 512/779 (65.73%), Query Frame = 3
Query:  606 IFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG----SLMSPSISSAEISNETRN------AILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKE-NCV--KKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            + +P+ D E     A +  +C Q      ++L  +EK   +  +R+  +      ++ + S+ ++E   + +        IL LCGEL+D D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +    +  +V++  C+  K + S ++Q        LQ++ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T  VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F +F   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  154 LVIPLLDKETGSVAAVILVHCGQLSDSEEQSLQVVEKHALVALRRVQALQQRRPEAVQNTSVDASEDQKDEKGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTMGRLGQVVEDKQCIQLKDLTSDDVQQ-------LQNMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 905          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde2a (phosphodiesterase 2A, cGMP-stimulated [Source:MGI Symbol;Acc:MGI:2446107])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 358/796 (44.97%), Postives = 516/796 (64.82%), Query Frame = 3
Query:  567 ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG----SLMSPSISSAEISNETRN------AILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKE-NCV--KKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSE----SFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            A L    A     + +P+ D E     A +  +C Q      ++L  +EK   +  +R+  +      ++ + S+ ++E   + +        IL LCGEL+D D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +    +  +V++  C+  K + S ++Q        LQ++ G +  ++L +P++S   + +VA+    +K+  +    SF  +D  +IQ  F +T  VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F +F   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  131 ARLVAPLAPDMQVLVIPLLDKETGSVAAVILVHCGQLSDSEEQSLQVVEKHALVALRRVQALQQRRPEAVQNTSVDASEDQKDEKGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTMGRLGQVVEDKQCIQLKDLTSDDVQQ-------LQNMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDFPTSSFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 899          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|P14099|PDE2A_BOVIN (cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Bos taurus OX=9913 GN=PDE2A PE=1 SV=2)

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 360/794 (45.34%), Postives = 515/794 (64.86%), Query Frame = 3
Query:  567 ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG--SLMSPSIS-------------SAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            A L    A     + +P+ D E     A +  +C Q       +L  +EK   +  +R+  +    S ++P  +                 +N+ R  IL LCGELYD D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +    +  +V++   K ++  ++ ++  D++ LQS+ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T+ VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F SF   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H  LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  112 ARLVAPLAPDTQVLVIPLVDKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALKRVQALQQRESSVAPEATQNPPEEAAGDQKGGVAYTNQDRK-ILQLCGELYDLDASSLQLKVLQYLQQETQASRCCLLLVSEDNLQLSCKVIGDKVLEEEISFPLTTGRLGQVVEDK--KSIQLKDLTSE--DMQQLQSMLGCEVQAMLCVPVISRATDQVVALACAFNKLGGDLFTDQDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVEDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDMEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRTNKQHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 880          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q01062|PDE2A_RAT (cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde2a PE=1 SV=2)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 359/792 (45.33%), Postives = 512/792 (64.65%), Query Frame = 3
Query:  567 ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG----SLMSPSISSAEISNETRN------AILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKE-NCV--KKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            A L    A     + +P+ D E     A +  +C Q      ++L  +EK   +  QR+  +      ++ + S   +E   + +        IL LCGELYD D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +    +  +V++  C+  K + S ++Q        LQ++ G +  ++L +P++S   + +VA+    +K+  + F  +D   IQ  F +T  VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F +F   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  124 ARLVAPLAPDTQVLVIPLLDKETGTVAAVILVHCGQLSDSEEQSLQVVEKHALVALQRVQALQQRRPEAVQNTSADPSEDQKDEKGYTAHDRKILQLCGELYDLDATSLQLKVLRYLQQETQATHCCLLLVSEDNLQLSCKVIGEKVLGEEVSFPLTMGRLGQVVEDKQCIQLKDLTSDDVQQ-------LQNMLGCELRAMLCVPVISRATDQVVALACAFNKLGGDFFTDEDERAIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 888          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|O00408|PDE2A_HUMAN (cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE2A PE=1 SV=1)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 361/794 (45.47%), Postives = 514/794 (64.74%), Query Frame = 3
Query:  567 ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG--------SLMSPSISSAE------ISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVK-KVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            A L    A     + +P+ D E     A +  +C Q       +L  +EK   +  +R+ V+          ++ +P   +AE         +    IL LCGELYD D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +   + + +  +  ++ K  +SE      D++ LQS+ G +  ++L +P++S   + +VA+    +K+  + F  +D  +IQ  F +T+ VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F SF   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  133 ARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSE------DVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 900          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q922S4|PDE2A_MOUSE (cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde2a PE=1 SV=4)

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 358/796 (44.97%), Postives = 516/796 (64.82%), Query Frame = 3
Query:  567 ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNG----SLMSPSISSAEISNETRN------AILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKE-NCV--KKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSE----SFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNN 2903
            A L    A     + +P+ D E     A +  +C Q      ++L  +EK   +  +R+  +      ++ + S+ ++E   + +        IL LCGEL+D D   LQ+K++ +L+         +L VS +  +  C+VI   ++  E+   +    +  +V++  C+  K + S ++Q        LQ++ G +  ++L +P++S   + +VA+    +K+  +    SF  +D  +IQ  F +T  VL S+LA+  E+K K + +A+LQVA N+F  LD++++LL+EI+TEA+ L+NAE CSVFLL++  NELV+KVFDG                 G   ++  EIRI   QGIAG VATTG+ILNI DAY+HPLFYRGVD+STG+RTRNILCFPIK+E  +++GVA+L NK+NGP F+  DEDLA AFS+YC ISI HSL+YK V EAQ+R+ LANE+M YHM++S++ +  L    I  V+    +F +F   PR + E ++ +A LSM   + FI+ ++I    LARF LMVK+GYRDPPYHNW HA SV+HF YL  KNL+L N L ++EIF+ F++ +CHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I ILN+ G N+F++ +R++YQ+ LDL+RDIILATDLAHH RI    ++M E GYD++N  H +LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P E MDRE+A IP LQISF++ +A+P ++    L+ +  E + + +  NR+ W K+++
Sbjct:  131 ARLVAPLAPDMQVLVIPLLDKETGSVAAVILVHCGQLSDSEEQSLQVVEKHALVALRRVQALQQRRPEAVQNTSVDASEDQKDEKGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTMGRLGQVVEDKQCIQLKDLTSDDVQQ-------LQNMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDFPTSSFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNAEICSVFLLDQ--NELVAKVFDG-----------------GVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAE-LYERVASNREHWTKVSH 899          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|P30645|PDE2_CAEEL (Probable 3',5'-cyclic phosphodiesterase pde-2 OS=Caenorhabditis elegans OX=6239 GN=pde-2 PE=3 SV=4)

HSP 1 Score: 337.035 bits (863), Expect = 6.667e-100
Identity = 197/548 (35.95%), Postives = 306/548 (55.84%), Query Frame = 3
Query: 1338 VAMNIFRKL----DNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANE--LMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTS--NSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKD 2957
            V M+IF +     +NL+ L+  I+ EAKK T AE  +VFL +E+  ++V  +F+           ++ +T  G++++           GI GKVA+T   +NI D    P F   +DE    + RN++ FP+ D    ++GV  L NK NG  F+  DE   K FS +   SI H+++ K ++E + R  +  E  +      I E + + L   P+ +   F  +F  F   PR + E++   A++  F  L F   +++ +  L+  +L V  GYR  PYHNW+HA +V HF +L  +   +   L+++E  S  +A LCHDIDHRGT NSFQ+ S   + L+ LYS+EGSVLERHHF QTI +L  E  ++ ENL   +++  ++ IR++ILATD++ H R   + + MI  GY+  + DHR LL+ L+MT +DLSDQ K++ NA+ +A  IY EFF QGDLE  +G KP E MDR  A +P++QI FL  + +P FQ  A +  + G +  + +  N   W  L+ ++R+     N  +  + +
Sbjct:  163 VPMSIFDQFLCLTNNLSALISCIIAEAKKNTEAEDYAVFLHDEDNKQMV--LFNN---------ETMLMT--GKKFDM--------GYGIVGKVASTMRTMNIRDVSRCPFFNEEIDEQFSIKARNLIAFPLIDSSCSLIGVIVLYNKENG--FSRHDEKYIKRFSYFVANSIAHAILAKQIEEVRTRIHMVEEFKIQGEDAVIEEVDIMRLVNDPLRDWRYFSQNFADFSFPPRSVGENHFHRASMMFFEDLGFSMLYKLNKRKLSYLVLRVSAGYRPVPYHNWSHAFAVTHFCWLTLRTDAIRRALSDMERLSLLIACLCHDIDHRGTTNSFQMQSLQKTPLSVLYSTEGSVLERHHFAQTIKLLQQEECSILENLPAADFRTIVNTIREVILATDISAHLRKQERIKTMISEGYNPMSFDHRYLLMCLVMTASDLSDQAKNFHNAKRIAENIYLEFFAQGDLELQLGVKPLEMMDRTNAYVPTVQIDFLFKIGVPVFQLLASVVPE-GRTTSEAIDANHLCWVALDEEVRNNPSATNTLEYLRDE 686          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A267FW74 (Phosphodiesterase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000567g2 PE=3 SV=1)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 387/823 (47.02%), Postives = 528/823 (64.16%), Query Frame = 3
Query:  588 AGSNYGIFLPIFDDENSMFNAYLTFY-CNQWDSKSTKTLDHLEKQIKIMFQRLTVM-------------------NGSLMSP--SISSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKE------NCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPT--SVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDMSP 2966
             G   G+ +P+ D   S  +  LT Y   +   +   +++ L +Q+     RL  +                    G+L S   +  SA +     + IL LCGELYD+D   LQ+K+I +LK  I+ +TGF+L VS + +   CQV+  +I+  ++      +  E++++       + + + + ++IQ+ LGD   ++SL            + S   + +VAI  +V+K++S  F+  D+++I   FR+T+ VL S++A+  E+  K QT+A+LQVA NIFRKLD+LT+LL+EIM EA+ LT AERCSVFLL+ ETNELV+KVFDGLPT S          +  +G E EQP EIRI  + G+AG VAT GE+LNI DAYSHPLFY  VDE TG+RTRNILCFPI+DE   IVGVAQLCNK+   HF++ DEDLA+AFSVYCCI+I+HSLMYK VQ AQ R++LA ELMTYHM + E     L+   +  +  F P F+ F S+PR + E +S  A + MF  LK    WRI R+ LARF+L+ ++GYRDPPYHNW+HA SVAHF YLC KNL L   L  LE FSF VA LCHDIDHRGTNNSF+ +S S L+ LYSSEGSVLERHHF+QT+CILN EG N+FENL+ +EY   LD+IRDIILATDLAHH +I ++   + ESG D S   HR L+L LLMT +DLSDQ K W+N R VA+LIY+EFF+ GD EK++G++PAE MDR++A IP LQ++FL+ +A P ++   K++      +   +  N   W  +   +  G++      +F+  + P
Sbjct:   96 GGCTQGLVIPVGDRSTS--HCLLTAYPAEEVTERHRASMESLRRQLDATCSRLIRLASMGFSGSGGRAPATAAADGGALASTPTAAGSAPLLQSDCHPILALCGELYDQDSEHLQLKVIKYLKNRINCETGFLLLVSQDRAHVFCQVVGDSILPDQIHIGAHMNFFETMIESSKSHYLDDLPQEQLADIQSVLGDSVSIRSLLCVP--------VTSRGASQVVAIACMVNKLSSADFSPVDVDVIHECFRYTSTVLTSTIAFQTERMLKNQTQALLQVAQNIFRKLDDLTVLLREIMAEARNLTQAERCSVFLLDRETNELVAKVFDGLPTTSNEKEVVQRKILLSDGTEIEQPVEIRIPATHGVAGYVATKGELLNIKDAYSHPLFYSKVDEDTGFRTRNILCFPIQDEHGTIVGVAQLCNKIKAAHFSTFDEDLARAFSVYCCIAIIHSLMYKRVQAAQARHQLATELMTYHMHVPERAVYDLANAAVRRLDEFCPHFDQFVSVPRDIVEADSCSAVVQMFDDLKLTKTWRIRRTTLARFVLLARKGYRDPPYHNWSHAFSVAHFTYLCLKNLRLDKCLTPLEYFSFLVASLCHDIDHRGTNNSFENSSGSALSGLYSSEGSVLERHHFSQTVCILNREGCNVFENLSEKEYSAVLDIIRDIILATDLAHHLKIKSEIDAVAESGPDWSKQQHRYLMLCLLMTASDLSDQTKVWKNTRQVAKLIYQEFFSLGDKEKSLGKQPAEGMDRDKADIPQLQVNFLNIIAAPVYKAMVKVWPAQCSVLTSQIDRNVSNWRIIGQKLSSGEVQRCDATIFESRLVP 908          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A3Q0KMK5 (Phosphodiesterase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 382/743 (51.41%), Postives = 504/743 (67.83%), Query Frame = 3
Query:  780 SSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXV--------------AIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMN-EHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMN-QLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDM 2960
            +S  IS E    IL LC  L+D +   LQ K++ ++    + + GFI+  + + SE  C    + I       E  +S    I++     K      + +   L +L     +  +   +    + +    V              A+V L++K +S+ F   D  +I+  FRF  P+L+SSLAY  E+  + +TE ML+VA NIF  + +LT LL +IM EA+ LT AERCSVFLL+ ETN LV+KV DGLPT    +  + F T +G+    P+EIR+S +QGIAG VATTGE+LNI DAY+HPLFYRGVD+ TG+RTRNILCFPIK+EKD IVGVAQLCNK+N P FT +DED+AK FS+YCCISIVHSLMYKNVQ+AQHR KLANELM YHM++ E+   WL+TC I +++ FLP+ +SF+S+PR +  E+ + L TLSMFH+L  I+RWRI R  LA+FILMV+RGYR+P YHNW HA SVAHF Y+C KNL L N QL+++EI + FVA LCHDIDHRGTNNSFQV S SVLAALYSSEGSVLERHHF+QTIC+LN+EG N+FEN+++++Y + LD IRDII+ATDL+HH RI+ +  E+   GYD +  +   LLL LLMT ADLSDQ KSW N   VA+LIYEEFF QGD+EK++G  P + MDRERAC+P+LQISFLD +  P ++    LY Q   S+L  +++NR  W+ +   +  G I  N  ++F  ++
Sbjct:  189 ASTWISREDNMLILKLCESLWDTEANRLQHKVLRYVMERTNSENGFIVMRNIDTSELVCHCTGNEIFEESTYIE-NDSFFNEIMQSGKTFKATHLNSEQEHTLLSILSVHNAYMNNENYVTNQNADIQIHSVLCSPVFTRSCDSPIAVVCLINKRDSQ-FTQSDERIIEECFRFVAPILLSSLAYQNERYIRGRTEDMLKVARNIFTHMMDLTNLLLKIMQEAQNLTKAERCSVFLLDSETNVLVAKVLDGLPTAP--NKNTRFTTADGKIVTLPEEIRLSLNQGIAGYVATTGELLNIKDAYAHPLFYRGVDKETGFRTRNILCFPIKNEKDGIVGVAQLCNKINHPFFTRADEDVAKTFSIYCCISIVHSLMYKNVQDAQHRTKLANELMMYHMKVDEDKKNWLTTCEIKDINTFLPNASSFESLPRNIQPENETYLCTLSMFHSLNLINRWRISRRTLAQFILMVRRGYRNPAYHNWMHAFSVAHFVYVCIKNLPLANNQLDDIEILALFVASLCHDIDHRGTNNSFQVQSKSVLAALYSSEGSVLERHHFSQTICVLNTEGCNIFENVSKEDYGQLLDHIRDIIVATDLSHHLRIMPKLEELSHRGYDGTKSEDHYLLLCLLMTSADLSDQTKSWNNTVYVAKLIYEEFFQQGDMEKSLGHNPIDSMDRERACVPNLQISFLDYIITPLYKVLNNLYPQ-CSSILDTIEKNRDNWKIILELVEKGYIKGNGSEIFNHNL 926          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A5K4ENT0 (Phosphodiesterase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 382/743 (51.41%), Postives = 504/743 (67.83%), Query Frame = 3
Query:  780 SSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXV--------------AIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMN-EHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMN-QLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDM 2960
            +S  IS E    IL LC  L+D +   LQ K++ ++    + + GFI+  + + SE  C    + I       E  +S    I++     K      + +   L +L     +  +   +    + +    V              A+V L++K +S+ F   D  +I+  FRF  P+L+SSLAY  E+  + +TE ML+VA NIF  + +LT LL +IM EA+ LT AERCSVFLL+ ETN LV+KV DGLPT    +  + F T +G+    P+EIR+S +QGIAG VATTGE+LNI DAY+HPLFYRGVD+ TG+RTRNILCFPIK+EKD IVGVAQLCNK+N P FT +DED+AK FS+YCCISIVHSLMYKNVQ+AQHR KLANELM YHM++ E+   WL+TC I +++ FLP+ +SF+S+PR +  E+ + L TLSMFH+L  I+RWRI R  LA+FILMV+RGYR+P YHNW HA SVAHF Y+C KNL L N QL+++EI + FVA LCHDIDHRGTNNSFQV S SVLAALYSSEGSVLERHHF+QTIC+LN+EG N+FEN+++++Y + LD IRDII+ATDL+HH RI+ +  E+   GYD +  +   LLL LLMT ADLSDQ KSW N   VA+LIYEEFF QGD+EK++G  P + MDRERAC+P+LQISFLD +  P ++    LY Q   S+L  +++NR  W+ +   +  G I  N  ++F  ++
Sbjct:   57 ASTWISREDNMLILKLCESLWDTEANRLQHKVLRYVMERTNSENGFIVMRNIDTSELVCHCTGNEIFEESTYIE-NDSFFNEIMQSGKTFKATHLNSEQEHTLLSILSVHNAYMNNENYVTNQNADIQIHSVLCSPVFTRSCDSPIAVVCLINKRDSQ-FTQSDERIIEECFRFVAPILLSSLAYQNERYIRGRTEDMLKVARNIFTHMMDLTNLLLKIMQEAQNLTKAERCSVFLLDSETNVLVAKVLDGLPTAPNKN--TRFTTADGKIVTLPEEIRLSLNQGIAGYVATTGELLNIKDAYAHPLFYRGVDKETGFRTRNILCFPIKNEKDGIVGVAQLCNKINHPFFTRADEDVAKTFSIYCCISIVHSLMYKNVQDAQHRTKLANELMMYHMKVDEDKKNWLTTCEIKDINTFLPNASSFESLPRNIQPENETYLCTLSMFHSLNLINRWRISRRTLAQFILMVRRGYRNPAYHNWMHAFSVAHFVYVCIKNLPLANNQLDDIEILALFVASLCHDIDHRGTNNSFQVQSKSVLAALYSSEGSVLERHHFSQTICVLNTEGCNIFENVSKEDYGQLLDHIRDIIVATDLSHHLRIMPKLEELSHRGYDGTKSEDHYLLLCLLMTSADLSDQTKSWNNTVYVAKLIYEEFFQQGDMEKSLGHNPIDSMDRERACVPNLQISFLDYIITPLYKVLNNLYPQ-CSSILDTIEKNRDNWKIILELVEKGYIKGNGSEIFNHNL 794          
BLAST of Phosphodiesterase vs. TrEMBL
Match: R7VEB4 (Phosphodiesterase (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_109907 PE=3 SV=1)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 369/692 (53.32%), Postives = 485/692 (70.09%), Query Frame = 3
Query:  834 ELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDI 2909
            ELYD+D   LQ+K+I+FL G    +TGFI  V  +  E  CQ I   I+  E+R  I    +  ++  N    V   ++Q    +   L+      +  LL +P+ S    +++AI  + +K+++E+FN  D ++I L F++T  VL S+L+   E+K K QT+A+LQ+A N+F  LD+LT LL+EIM EA+ LT AERCSVFLLE ETNELV+KVFDG                 G+E E  +E+RI   QG+AG+VA TG++LNI DAYSHPLFYRGVD++TG++TRNILCFP+KDEKD ++GVAQLCNK+NG  F++ DE++AKAFSVYCCISIVHSL+Y+ V++AQHR+KL+NELM YHM +S E    L + P+P  +   PD  SF   PR +    + LA LSMF  +   +R+RI + VL+RF LMV++GYR+PPYHNW HA +VAHF YL  KN  L+N L+E+E+F+ F A LCHDIDHRGT NSFQV S SVLAALY SEGSV+ERHHF Q++CILN+EG N+F +L R+EY+KALDL+RDIILATDL+HH RI+     M E GYDK NP HR LLLFLLMT  DLSDQ K+W N++ +A LIY+EFF+QGDLEKA G+   E MDR+RACIP LQI FL+ +A+P F+  AK++    E +L+ +  NR KWE LN  +
Sbjct:    1 ELYDQDAASLQVKVIHFLLGQTQAETGFIFIVDKDRGELFCQAIGDKILEEEVRMPIERCPLNKVI--NTKSPVSLDDLQK--SEQAELEEHLSLSFRCLLAVPVCSKTEGNVIAIACIANKLHNETFNESDEDVIHLCFKYTATVLHSTLSVQNERKLKNQTQALLQIAKNLFTHLDDLTKLLREIMQEARNLTKAERCSVFLLERETNELVAKVFDG-------------DVRSGKE-ELEREVRIPIGQGVAGQVAITGQLLNIDDAYSHPLFYRGVDDTTGFKTRNILCFPLKDEKDDVIGVAQLCNKLNGVSFSTFDEEVAKAFSVYCCISIVHSLLYQKVRDAQHRSKLSNELMNYHMMVSNEEVFHLFSMPVPRPTEMHPDMASFSFTPRSIPYDQTALAVLSMFEDMGLTARFRINKDVLSRFALMVRKGYREPPYHNWAHAFAVAHFCYLMFKNTQLLNYLDEIELFALFAACLCHDIDHRGTTNSFQVASGSVLAALYCSEGSVMERHHFAQSMCILNTEGCNIFIDLPRKEYEKALDLMRDIILATDLSHHLRIMKDLETMAEEGYDKKNPRHRSLLLFLLMTSCDLSDQTKNWTNSKKIAELIYQEFFSQGDLEKATGRDVQEMMDRDRACIPLLQIDFLNKIALPVFRLLAKIFPDASE-VLQAVLSNRDKWECLNTKL 673          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A4Z2CV85 (Phosphodiesterase OS=Schistosoma japonicum OX=6182 GN=EWB00_007250 PE=3 SV=1)

HSP 1 Score: 740.339 bits (1910), Expect = 0.000e+0
Identity = 383/743 (51.55%), Postives = 509/743 (68.51%), Query Frame = 3
Query:  780 SSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGF--------------KWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMN-EHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMN-QLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDM 2960
            +S  I+ +    IL LC  L+D     LQ K++ +L    + + GFI+  +T+ SE  C  I   I +     E  +S+   I++        +   + K   L VL     +              + +S L  P+ +  +   + +V L++K +S+ F   D  +I+  FR+T P+L+SSL+   E+  + +TE ML+VA NIF  + +LT LL +IM EA+ LT AERCSVFLL+ ETN LV+KV DGLPT    +  + F T +G+    P+EIR+S +QGIAG VATTGE+LNI DAY+HPLFYRGVD+ TG+RTRNILCFPIK+EKD IVGVAQLCNK+N P FT +DED+AK FS+YCCISIVHSLMYKNVQ+AQHR KLANELM YHM++ E+   WLSTC I +++ FLP+ +SF+S+PR +  E+ + L TLSMFH L  I+RWRI R  LA+FILMV+RGYR+P YHNW HA +VAHF Y+C KNL L N QL ++EI + FVA LCHDIDHRGTNNSFQV S SVLAALYSSEGSVLERHHF+QTIC+LN++G N+FEN+++++Y + LD IRDIILATDL+HH RI+++  EM   GYD +  +   LLL LLMT ADLSDQ K W N   VA+LIYEEFF QGD+EK++G  P + MDRERAC+P+LQISFLD + +P ++    LY Q   S+L  +++NR  W+ +   +  G+I  N  ++F  ++
Sbjct:  189 ASTWINRKDNELILKLCESLWDTQTNRLQHKVLRYLMQRTNSENGFIVMRNTDTSELVCYCIGDEIFDESTYIE-NDSLFNEIMQSGKTFTSTTPNSEQKQVLLSVLSIHNAYMNNEHPITNLHEEMEINSFLCSPVFTRSSEYPIGVVCLINKKDSQ-FTQSDEFIIEECFRYTAPILLSSLSCQNERYIRDRTEDMLKVARNIFTHMMDLTNLLLKIMQEAQNLTKAERCSVFLLDSETNVLVAKVLDGLPTAP--NKNTHFTTTDGKIVTLPEEIRLSLNQGIAGHVATTGELLNIKDAYAHPLFYRGVDKETGFRTRNILCFPIKNEKDGIVGVAQLCNKINHPFFTRADEDVAKTFSIYCCISIVHSLMYKNVQDAQHRTKLANELMMYHMKVDEDKKNWLSTCEIKDINSFLPNTSSFESLPRNIQPENETYLCTLSMFHNLNLINRWRISRRTLAQFILMVRRGYRNPAYHNWMHAFTVAHFIYVCIKNLPLANKQLEDIEILALFVASLCHDIDHRGTNNSFQVQSKSVLAALYSSEGSVLERHHFSQTICVLNTDGCNIFENVSKEDYSQLLDHIRDIILATDLSHHLRIMSKLEEMSHRGYDVTKSEDHYLLLCLLMTSADLSDQTKPWNNTVYVAKLIYEEFFQQGDMEKSLGHNPIDSMDRERACVPNLQISFLDYIILPLYRVLNNLYPQCS-SILDTIEKNRDNWKTILELVEKGEIKGNGSEIFNHNL 926          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 332.028 bits (850), Expect = 3.371e-99
Identity = 197/530 (37.17%), Postives = 297/530 (56.04%), Query Frame = 3
Query: 1329 MLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKL 2897
            +L V+   F  +  +  LL+ IM  AK L NA+RC++F ++    EL S +FD      EN    VF         + KEIR S  +GIAG+VA TGE+LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK++G  FT +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + E +  L+   +P     E+ +F  D + ++ +   +         + M H     S + + +  L RF + V++ YR  PYHNW HA++VAH  Y   +    +    ELE     +A LCHD+DHRG +NS+    +  LAALYS+  S +E+HHF+QT+ IL  EG N+F NL   EY++ L++IR  I+ATDLA +F    Q  E++ +G  D +N  HR  ++ L+MT  DL    K W   R  A  IY EF+++GD  K IG +P   MDR++   +P  Q+ F + VAIPC+    +L+  P   +L   +EN  +WEK+
Sbjct:  286 LLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD---IGEENEGKPVF--------RKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDHYTGYTTRNILCMPIV-SRGTVIGVVQMVNKLSGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLSLPDPIYKEIELFHFDISPYEELWPAV--------FVYMIHNSCGKSSFELEK--LCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTSGI--FTELEKKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYST--STMEQHHFSQTVSILQ-EGHNIFSNLTSSEYEQVLEIIRKAIIATDLALYFGNRKQIAELLSTGALDLNNHAHRDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWSEGDEMKKIGMQPIPMMDRDKKDEVPQGQVGFYNAVAIPCYTTLVELF-PPSAPLLSACRENLGQWEKI 787          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 327.791 bits (839), Expect = 7.044e-97
Identity = 196/585 (33.50%), Postives = 323/585 (55.21%), Query Frame = 3
Query: 1179 IVGLVDKINSES----FNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELV--SKVFDGL-PTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPG-ESMLKIMQENRKKWEKLN 2900
            I+G+   IN       F   D +++Q+   F    + ++  +   +K   ++ A+L+V  ++F +  +L  ++++IM  A+ L   ERCSV LLE+  + +V  +K F+ L P  S ++  S   + E   Y    +  I+ S  IA  VA+TG  +NI DAY  P F    D+ +G+  R++LC PI +   +I+GVAQ+ N+++G  F  +D+ L +AF ++C + I +++MY  V+++  +  +A ++++YH   S+          IP V     D  SFD     ++    + A L MF  L  + +++I    L R++L V++ YR   YHNW HA +V    +           L+ELEI +  V  +CHD+DHRGTNN+FQ  + S L+ LY +  + LE HHFN  + IL SEG N+F NL+ ++Y   + L++  ILATDL  +F   N   E+++ G Y+ +  +HR +   +LMT  DL    K W+ +R VA L+  EFF QGD E++ +   P+   DR R   +PSLQ+ ++DG+  P ++  AKL   P  + M+ ++Q NR KW++L+
Sbjct:  313 IIGVAQAINKSPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVKFTKSFELLSPKCSADTENSFKDSMEKSSYS---DWLINNS--IAELVASTGLPVNISDAYQDPRFDAEADQFSGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKTEVDKFKAANIPLVCELGIDKLSFDDF--SLDVDAMITAALRMFMELGMLQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQCMFSLLTTAGFQETLSELEILALIVGCVCHDLDHRGTNNAFQAKTGSALSLLYGTSAT-LEHHHFNHAVMILQSEGHNIFSNLSSRDYGDLMQLLKQSILATDLTLYFENRNSFFELVKKGEYNWNVKEHRDMFRSMLMTACDLGAVTKPWDISRKVAELVTSEFFEQGDRERSELKLTPSAIFDRNRKDELPSLQLEWIDGICSPLYETLAKL--NPKLQPMVDVIQANRAKWDELH 887          

HSP 2 Score: 100.138 bits (248), Expect = 4.882e-21
Identity = 67/213 (31.46%), Postives = 115/213 (53.99%), Query Frame = 3
Query: 1266 PVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE--LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKV-NGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNK 1895
            P       YY+++    + E  L++  +I   LD LT L  +I+     + +A+RCS+FL+E   N+  LVSK FD       ++ T+V  +    +     E+++   +GI G VA  GE +NI DAY    F   +D+ TGY+T+++LC PI++   +I+GVAQ  NK   G  FT  DE + + +  +C I+I ++ ++   ++   R++
Sbjct:  167 PSTAVDFKYYLKEHN--EREFFLELVKDISNDLD-LTSLSYKILVFVCIMVDADRCSLFLVEGTANKKTLVSKFFD------VHAGTTVLPSLSNSD-----EVQVPWGKGIIGYVAEHGETVNIPDAYQDHRFSDEIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKSPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSR 365          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11al (dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A-like [Source:NCBI gene;Acc:103024879])

HSP 1 Score: 313.923 bits (803), Expect = 8.800e-92
Identity = 195/588 (33.16%), Postives = 318/588 (54.08%), Query Frame = 3
Query: 1179 IVGLVDKIN----SESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELV--SKVFDGL-PTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP---EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYR--QPGESMLKIMQENRKKWEKL 2897
            ++G+V  IN       F   D +++Q+   F    + ++  +   +K   ++ A+L+V  ++F +  +L  ++++IM  A  L   ERCSV LLE+  + +V  SK F+ + P  S +   S+       E     +  I+ S  IA  VA+TG  +NI D    P F    D+++G+  R++LC PI +   +I+GVAQ+ N+++   F  +D+ L +AF ++C + I +++MY  V++   +  +A ++++YH   S+     L    IP   E+ +    FN F      ++    + A+L MF  L  + +++I   VL R++L V++ YR   YHNW HA +V+   ++          L + E  +  V  LCHD+DHRGTNN+FQ  S S LA LY +  + LE HHFN  + IL SEG N+F NL  +EY   + L++  IL+TDL  +F+   +  E + SG +  S  +HR +L  +LMT  DL    + WE ++ VA L+  EFF QGD E+A +   P+   DR R   +P+LQ+ ++DG+  P ++   KL R  QP   M+  +  NRKKWE+L
Sbjct:  288 VIGVVQAINKNPKGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMQRALTLLQCERCSVLLLEDIHSPVVKFSKTFELMSPLCSVDHDISM-------EKVSCSDWLINNS--IAELVASTGLPVNISDVCQDPRFDAEADQASGFHIRSVLCVPIWNRTHQIIGVAQILNRLDRKTFNDADQRLFEAFVIFCGLGINNTMMYNQVKKTWAKQSVALDMLSYHATCSKVEVDRLKAAKIPLSSELGIDKFHFNDF-----SLDNDAMITASLRMFLELGVVQKFKIDYEVLCRWLLTVRKNYRTVAYHNWRHAFNVSQCMFVMITTAGFQEVLTDTETLALMVGCLCHDLDHRGTNNAFQAKSGSALALLYGTSAT-LEHHHFNHAVMILQSEGHNIFANLCSKEYSHMMQLLKQAILSTDLTLYFQRRTKFFECVLSGEFSWSIQEHRDVLRSMLMTACDLGAVTRPWEISKQVAELVTSEFFEQGDRERAELKLTPSAIFDRNRKDELPALQLEWIDGICKPLYEALVKLNRKLQP---MVDGIDANRKKWEEL 857          

HSP 2 Score: 91.2781 bits (225), Expect = 3.074e-18
Identity = 63/209 (30.14%), Postives = 110/209 (52.63%), Query Frame = 3
Query: 1278 SSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE--LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNK-VNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNK 1895
            S+L Y    K   + E  L++  +I  +LD +T L  +I+     + +A+RCS+FL+E  +++  LVSK FD     +    +S+             E+++   +GI G VA  GE +NI +AY    F   +D+ TGY+T++ILC  I +   +++GV Q  NK   G  FT  DE + + +  +C ISI ++ ++   ++   R++
Sbjct:  143 SALDYKCRLKENNEREFFLELVKDISNELD-MTNLSYKILINVCIMVSADRCSLFLVEGPSHKRTLVSKFFDVHSGTTVRPSSSM----------NSSEVQVPWGKGIIGYVAEHGETVNIPNAYEDHRFSDEIDKLTGYKTQSILCMAICNSDGEVIGVVQAINKNPKGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYDRSR 340          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11al (dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A-like [Source:NCBI gene;Acc:103024879])

HSP 1 Score: 298.13 bits (762), Expect = 1.650e-86
Identity = 182/559 (32.56%), Postives = 302/559 (54.03%), Query Frame = 3
Query: 1179 IVGLVDKIN----SESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELV--SKVFDGL-PTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP---EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQ 2816
            ++G+V  IN       F   D +++Q+   F    + ++  +   +K   ++ A+L+V  ++F +  +L  ++++IM  A  L   ERCSV LLE+  + +V  SK F+ + P  S +   S+       E     +  I+ S  IA  VA+TG  +NI D    P F    D+++G+  R++LC PI +   +I+GVAQ+ N+++   F  +D+ L +AF ++C + I +++MY  V++   +  +A ++++YH   S+     L    IP   E+ +    FN F      ++    + A+L MF  L  + +++I   VL R++L V++ YR   YHNW HA +V+   ++          L + E  +  V  LCHD+DHRGTNN+FQ  S S LA LY +  + LE HHFN  + IL SEG N+F NL  +EY   + L++  IL+TDL  +F+   +  E + SG +  S  +HR +L  +LMT  DL    + WE ++ VA L+  EFF QGD E+A +   P+   DR R   +P+LQ+ ++DG+  P ++
Sbjct:  288 VIGVVQAINKNPKGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMQRALTLLQCERCSVLLLEDIHSPVVKFSKTFELMSPLCSVDHDISM-------EKVSCSDWLINNS--IAELVASTGLPVNISDVCQDPRFDAEADQASGFHIRSVLCVPIWNRTHQIIGVAQILNRLDRKTFNDADQRLFEAFVIFCGLGINNTMMYNQVKKTWAKQSVALDMLSYHATCSKVEVDRLKAAKIPLSSELGIDKFHFNDF-----SLDNDAMITASLRMFLELGVVQKFKIDYEVLCRWLLTVRKNYRTVAYHNWRHAFNVSQCMFVMITTAGFQEVLTDTETLALMVGCLCHDLDHRGTNNAFQAKSGSALALLYGTSAT-LEHHHFNHAVMILQSEGHNIFANLCSKEYSHMMQLLKQAILSTDLTLYFQRRTKFFECVLSGEFSWSIQEHRDVLRSMLMTACDLGAVTRPWEISKQVAELVTSEFFEQGDRERAELKLTPSAIFDRNRKDELPALQLEWIDGICKPLYE 831          

HSP 2 Score: 91.6633 bits (226), Expect = 2.475e-18
Identity = 64/215 (29.77%), Postives = 113/215 (52.56%), Query Frame = 3
Query: 1278 SSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE--LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNK-VNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELM 1913
            S+L Y    K   + E  L++  +I  +LD +T L  +I+     + +A+RCS+FL+E  +++  LVSK FD     +    +S+             E+++   +GI G VA  GE +NI +AY    F   +D+ TGY+T++ILC  I +   +++GV Q  NK   G  FT  DE + + +  +C ISI ++ ++   ++   R++   E++
Sbjct:  143 SALDYKCRLKENNEREFFLELVKDISNELD-MTNLSYKILINVCIMVSADRCSLFLVEGPSHKRTLVSKFFDVHSGTTVRPSSSM----------NSSEVQVPWGKGIIGYVAEHGETVNIPNAYEDHRFSDEIDKLTGYKTQSILCMAICNSDGEVIGVVQAINKNPKGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYDRSRALLEVV 346          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 286.96 bits (733), Expect = 3.274e-82
Identity = 185/587 (31.52%), Postives = 312/587 (53.15%), Query Frame = 3
Query: 1179 IVGLVDKINSES----FNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELV--SKVFDGL-PTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFR-IINQQR--EMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLN 2900
            I+G+   IN       F   D +++Q+   F    + ++  +   +K   ++ A+L+V  ++F +  +L  ++++IM  A+ L   ERCSV LLE+  + +V  +K F+ L P  S ++  S   + E   Y    +  I+ S  IA  VA+TG  +NI DAY  P F    D+ +G+  R++LC PI +   +I+GVAQ+ N+++G  F  +D+ L +AF ++C + I +++MY  V+++  +  +A ++++YH   S+          IP V     D  SFD     ++    + A L MF  L  + +++I    L R++L V++ YR   YHNW HA +V    +           L+ELEI +  V  +CHD+DHRGTNN+FQ  + S L+ LY +  + LE HHFN  + IL SE   +  NL              + + + L   F+  +N+    E+++ G Y+ +  +HR +   +LMT  DL    K W+ +R VA L+  EFF QGD E++ +   P+   DR R   +PSLQ+ ++DG+  P ++  AKL  +  + M+ ++Q NR KW++L+
Sbjct:  291 IIGVAQAINKSPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVKFTKSFELLSPKCSADTENSFKDSMEKSSYS---DWLINNS--IAELVASTGLPVNISDAYQDPRFDAEADQFSGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKTEVDKFKAANIPLVCELGIDKLSFDDFSLDVDAM--ITAALRMFMELGMLQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQCMFSLLTTAGFQETLSELEILALIVGCVCHDLDHRGTNNAFQAKTGSALSLLYGTSAT-LEHHHFNHAVMILQSEVGTV-NNLQ-------------MFMHSRLHSCFKGQLNRNSFFELVKKGEYNWNVKEHRDMFRSMLMTACDLGAVTKPWDISRKVAELVTSEFFEQGDRERSELKLTPSAIFDRNRKDELPSLQLEWIDGICSPLYETLAKLNPKL-QPMVDVIQANRAKWDELH 854          

HSP 2 Score: 100.138 bits (248), Expect = 5.765e-21
Identity = 67/213 (31.46%), Postives = 115/213 (53.99%), Query Frame = 3
Query: 1266 PVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE--LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKV-NGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNK 1895
            P       YY+++    + E  L++  +I   LD LT L  +I+     + +A+RCS+FL+E   N+  LVSK FD       ++ T+V  +    +     E+++   +GI G VA  GE +NI DAY    F   +D+ TGY+T+++LC PI++   +I+GVAQ  NK   G  FT  DE + + +  +C I+I ++ ++   ++   R++
Sbjct:  145 PSTAVDFKYYLKEHN--EREFFLELVKDISNDLD-LTSLSYKILVFVCIMVDADRCSLFLVEGTANKKTLVSKFFD------VHAGTTVLPSLSNSD-----EVQVPWGKGIIGYVAEHGETVNIPDAYQDHRFSDEIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKSPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSR 343          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 316/603 (52.40%), Postives = 428/603 (70.98%), Query Frame = 3
Query: 1098 LQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESML-KIMQENRKKWEKLNN 2903
            L SL GF+ +S+L +PI++   + +V +  + +K++ +S+   D   IQ  F FT+ VL S++A+  E+K K + +A+LQVA N+F  LD++++LL EI+ EA+ L+NAERCSVFLL+  ++ELV+KVFDG                 G   ++  E+RI   QGIAG VATTGE+LNI DAYSHPLFYRGVD+STG+RTR+ILCFPIKDE ++++GVA+LCNK+NGP F+  DEDLA AFS+YC ISI +SL+YK V EAQ R++L+NE+M YHM++S E    +    I  V+   PDF  F   PR + E  ++ A L M   + FI+ +++    L R+ LMV++GYRDPPYHNW HA SV+HF YL  KNLDL   L ++EIF+ FV+ LCHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I I+NS G N+ ENL+R+EYQ+ LDL+RDIILATDLAHH RI    R++ ++GY+  N     LLL LLMT  DLSDQ K W+  R +A LIY+EFF+QGDLEKA+G +P+E MDRE+A IP LQISF++ +A+P F+    +   PG + L + +  N++ W ++++
Sbjct:    1 LNSLLGFRVNSMLSVPIVARATSQVVTLACVFNKLHGQSYTETDERKIQHCFCFTSTVLTSTIAFQKEQKLKFECQALLQVAKNLFTHLDDVSVLLHEIIQEARNLSNAERCSVFLLDRSSHELVAKVFDG-----------------GVVSDESYEVRIPADQGIAGHVATTGEVLNIKDAYSHPLFYRGVDDSTGFRTRSILCFPIKDENEEVIGVAELCNKINGPWFSKFDEDLATAFSIYCGISIANSLLYKKVAEAQQRSQLSNEMMMYHMKVSPEEMNKVLNSRIQTVTDIHPDFAKFTYTPRSLGEDQTITAILGMVEDMGFINNYKLDLRTLTRWCLMVRKGYRDPPYHNWMHAYSVSHFCYLLYKNLDLGKYLQDMEIFALFVSCLCHDLDHRGTNNSFQVDSKSVLAALYSSEGSVMERHHFAQAIAIINSAGCNILENLSRKEYQRMLDLMRDIILATDLAHHLRIFKDLRKIADAGYNPDNGHQHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPSEMMDREKAYIPELQISFMEHIAMPLFKLLKDML--PGAAELYERVAANKEHWMRVSH 584          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: PDE2A (phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:8777])

HSP 1 Score: 479.945 bits (1234), Expect = 1.912e-161
Identity = 231/402 (57.46%), Postives = 294/402 (73.13%), Query Frame = 3
Query: 1365 DNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHM----QISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIES 2558
            D++++LL EI+ EA+ L+NAERCSVFLL+  ++ELV+KVFDG   VS+             E+ +  E+RI   QGIAG VATTGE+LNI DAYSHPLFYRGVD+STG+RTR+ILCFPIKDE ++++GVA+LCNK+NGP F+  DEDLA AFS+YC ISI +SL+YK V EAQ R++L+NE+M YHM    Q+S E    +    I  V+   PDF  F   PR + E  ++ A L M   + FI+ +++    L R+ LMV++GYRDPPYHNW HA SV+HF YL  KNLDL   L ++EIF+ FV+ LCHD+DHRGTNNSFQV S SVLAALYSSEGSV+ERHHF Q I I+NS G N+ ENL+R+EYQ+ LDL+RDIILATDLAHH RI    R++ + 
Sbjct:    5 DDVSVLLHEIIQEARNLSNAERCSVFLLDRSSHELVAKVFDG-GVVSD-------------EFMKSYEVRIPADQGIAGHVATTGEVLNIKDAYSHPLFYRGVDDSTGFRTRSILCFPIKDENEEVIGVAELCNKINGPWFSKFDEDLATAFSIYCGISIANSLLYKKVAEAQQRSQLSNEMMMYHMKVGTQVSPEEMNKVLNSRIQTVTDIHPDFAKFTYTPRSLGEDQTITAILGMVEDMGFINNYKLDLRTLTRWCLMVRKGYRDPPYHNWMHAYSVSHFCYLLYKNLDLGKYLQDMEIFALFVSCLCHDLDHRGTNNSFQVDSKSVLAALYSSEGSVMERHHFAQAIAIINSAGCNILENLSRKEYQRMLDLMRDIILATDLAHHLRIFKDLRKIADG 392          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde5ab (phosphodiesterase 5A, cGMP-specific, b [Source:ZFIN;Acc:ZDB-GENE-060824-4])

HSP 1 Score: 247.284 bits (630), Expect = 2.215e-69
Identity = 181/598 (30.27%), Postives = 302/598 (50.50%), Query Frame = 3
Query: 1179 IVGLVDKINSES-----FNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDG---LPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKD-EKDKIVGVAQLCNKVNGPH-----FTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFL-----WLSTCPIPEV-SVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYR-DPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSF-QVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMI-ESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRE-RACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKL 2897
            IVG+   IN +      F  KD         F   VL ++  Y        + + +L++A  +  +  +L  L+  I+         +RC+VF+ ++++  + S+VF     +P V+EN       T + E    P       S   A  V     +LNI D +    F   V+E   YRT+++LC PI++ +K++++GV QL NK+         F  +DE   +AF+++C ++I ++ MY+ V  A  +  +  E+++YH    E+         L+T  +P   S+ L DF   D     M E  + + +L M   L  +  + IP  V  R+IL V++ YR +  YHNW HA +     +         N L  LE+    +A L HD+DHRG NNS+ +  S+  LA LY    S+LE HHF+Q + +LNS G+ +  +L+ QEY+ A+ +I   IL+TDLA + +   +   ++ +  ++  +  HRKLL  ++MT  D+S   K W   + +A L+  EFF QGD E+  +  +P + M+RE R  IP++Q+ F+DG+ +P ++  + ++      +L   Q NR+ WEKL
Sbjct:  232 IVGVAQAINKKGNNEGKFTEKDEREFGAYLAFCGIVLHNAQLYEDSLLENRRNQVLLELASLVCEEQSSLEELVGRIIDIILSFMPCQRCAVFIADKDSPNIFSRVFHKSLEVPGVAEN-------TSQSESRSHP------VSFIYAEFVMKMLTLLNIPDVHRDNRFNLPVEERGDYRTKSLLCAPIQNRKKNEVIGVCQLVNKLEEGAGEVRPFNRNDEQFVEAFAIFCGMAIRNTRMYEAVARAVAKQTVTLEVLSYHAIAHEDECAKLQSQHLTTTSVPSAQSLNLLDFTFSDF---GMAEELTAVGSLRMLLDLSLLQTFSIPNEVACRWILSVRKNYRRNIAYHNWRHAFNTGQCMFTVLVTGQAQNVLTPLEMLCLIIAALSHDLDHRGFNNSYIKNRSDHPLATLYGH--SMLEHHHFDQCLMLLNSPGNEMLSSLSVQEYRSAVGMIEHAILSTDLATYCKNRGEFFSLVKDRTFNLEDQHHRKLLRAMMMTACDVSAITKPWPVQQKIAELVASEFFDQGDRERQELHVEPTDMMNREKRDKIPTIQVGFIDGICLPLYEALSCVF-PACAPLLSGCQSNRQNWEKL 810          

HSP 2 Score: 107.842 bits (268), Expect = 4.703e-24
Identity = 81/243 (33.33%), Postives = 127/243 (52.26%), Query Frame = 3
Query: 1317 QTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE---LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKV--NGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANEL--MTYHMQISEENFLW------LSTCPIPEVSVFLPDFNS 2006
            + E  L++  +I  +LD +T L   I+    ++  A+RCS+F++ E++++   LVS +FD           S+  TPE     +   +R++  +GI G VA TG  +NI +AY  P F   VD  TGY+T+++LC PIKD K +IVGVAQ  NK   N   FT  DE    A+  +C I + ++ +Y++      RN++  EL  +    Q S E  +       LS  P    +VF+ D +S
Sbjct:  102 ERERFLELVKDIACRLDVVT-LCHRILLHVNQVLTADRCSLFIVREDSSQERCLVSTLFD----------VSLGSTPE---QARTSWLRLAWGKGIVGYVAATGNGVNIPNAYQDPRFNVEVDLMTGYKTQSVLCLPIKDNKGEIVGVAQAINKKGNNEGKFTEKDEREFGAYLAFCGIVLHNAQLYEDSLLENRRNQVLLELASLVCEEQSSLEELVGRIIDIILSFMPCQRCAVFIADKDS 330          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 140.969 bits (354), Expect = 4.829e-36
Identity = 86/252 (34.13%), Postives = 142/252 (56.35%), Query Frame = 3
Query: 1284 LAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEI--RISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSI 2018
            +++ + K+T++  + +L V+   F  +  +  LL+ IM  AK L NA+RC++F ++ + NEL S +FD +    E  P           + + KEI  R S  +GIAG+VA TG +LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK++G  FT +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + E    L  C +P     E+ ++  D   F+ +
Sbjct:  186 VSHGLAKQTEL-NDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNNELYSDLFD-IGEEKEGQPV----------FRKTKEITCRFSIEKGIAGQVAKTGMVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIV-SRGSVIGVVQMVNKLSGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIFRVTLEKLSYHSVCTAEESQSLMQCTLPTPIVKEIELYHFDIGPFEDM 424          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde1a (phosphodiesterase 1A, calmodulin-dependent [Source:ZFIN;Acc:ZDB-GENE-090831-2])

HSP 1 Score: 133.265 bits (334), Expect = 7.015e-33
Identity = 83/269 (30.86%), Postives = 134/269 (49.81%), Query Frame = 3
Query: 2046 VLATLSMFHTLKF-----------ISRWRIPRSVLARFILMVKRGY--RDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCF 2813
            VL   S  H LKF           ISR++IP + L  F+  ++ GY     PYHN  HA  V    +       LM+ L+ELE  +   A   HD++H GT N+F + + S +A LY ++ +VLE HH +    ++  +  N+F NL++ ++++   L+ +++LATD++ HF    QQ + ++S   +     +   + LL+   D+S   K W   +     + EEFF QGD E  +G   +   DR    +   QI F+D +  P F
Sbjct:  159 VLNEASGEHALKFVMHELLTRYELISRYKIPVAALVSFVEALEAGYSKHKNPYHNLAHAADVTQTVHYLLLQSGLMHWLSELETLAVIFAAAIHDLEHTGTTNNFHIQTRSDVALLY-NDRAVLENHHVSAAYRLMQDDDMNIFINLSKDDWRELRALVVEMVLATDMSCHF----QQIKTMKSALQQPESIDKSKAMSLLLHAGDISHPTKEWPLHQRWTEALMEEFFRQGDREAKLGLPFSPLCDRNSTMVAQSQIGFMDFIVEPTF 422          
BLAST of Phosphodiesterase vs. Ensembl Yeast
Match: PDE2 (High-affinity cyclic AMP phosphodiesterase; component of the cAMP-dependent protein kinase signaling system, protects the cell from extracellular cAMP, contains readthrough motif surrounding termination codon [Source:SGD;Acc:S000005887])

HSP 1 Score: 47.3654 bits (111), Expect = 9.255e-6
Identity = 51/184 (27.72%), Postives = 82/184 (44.57%), Query Frame = 3
Query: 2163 YHNWTHALSVAHFAY-LCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEY-------QKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEF 2690
            +HN+ HA+ V    + LC   L    + N ++     +A + HD+ H GTNN       S +A  + +  S+LE  H              LF+ L  + +       +K  D I + ILATD+A H +   + R M E      NP  +  L+ L++  AD+S+  ++   +   A LI  EF
Sbjct:  264 FHNFRHAIDVMQATWRLCTYLL----KDNPVQTLLLCMAAIGHDVGHPGTNNQLLCNCESEVAQNFKN-VSILENFH------------RELFQQLLSEHWPQLLSISKKKFDFISEAILATDMALHSQY--EDRLMHE------NPMKQITLISLIIKAADISNVTRTLSISARWAYLITLEF 422          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO38644 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC93])

HSP 1 Score: 477.633 bits (1228), Expect = 4.190e-159
Identity = 240/490 (48.98%), Postives = 325/490 (66.33%), Query Frame = 3
Query: 1431 CSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLP-DFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKL 2897
            CS+FLL+ E +ELV+KVFDG                E    +  +++RI T+QGI G+VA TG++LNI DAY+HPLFYRG+D  TG++TRNILCFPIKD+ D ++GVA+LCNK NG  FT  DEDL +AF++YC ISI HS++YK    A HR+++ +ELM YHM +SEE    L+   I      +P  F+ F   PR +    +V A L MF  L  I RW+IPR  L RF LMV++GYRDPPYHNWTHA +VAHF YL  KN  + ++L ++E  + FVA LCHD+DHRGTNN+FQV+SNS LAALYSSEGSV+ERHHF QT+CILNS G N+F+NL   E++K LDLIR IILATDL+HH RI+     M + G +K+  +    L+  ++   DLS  ++  ++  N+A+   +        EK +G  P E MDRERACIP LQI FL+ +A+P ++   +L  +  E ++  + +N + W+ +
Sbjct:    1 CSLFLLDRERDELVAKVFDG----------------EIPSNQASRDLRIPTNQGIVGQVAMTGKLLNIKDAYTHPLFYRGLDVKTGFKTRNILCFPIKDD-DGVIGVAELCNKANGKCFTKFDEDLTRAFAIYCGISIFHSMLYKRAATAWHRSQVCSELMIYHMHVSEEELQRLTAHEISSPDEEIPHGFDKFSFAPRTIQMEETVRAALYMFDDLGIIDRWKIPRDTLIRFTLMVRKGYRDPPYHNWTHAFTVAHFCYLLLKNSHMESKLQDIERMALFVACLCHDLDHRGTNNAFQVSSNSTLAALYSSEGSVMERHHFAQTVCILNSSGCNIFKNLTESEFEKVLDLIRYIILATDLSHHLRILKDINNMAK-GRNKNEFEKVLDLIRYIILATDLSHHLRILKDINNMAKGRNKN--VPSLFEKVMGFTPMEMMDRERACIPKLQIDFLENIALPVYKVLHELLPETKE-VIDTVHKNMECWQAI 469          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO44626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVE3])

HSP 1 Score: 343.199 bits (879), Expect = 6.431e-106
Identity = 202/568 (35.56%), Postives = 316/568 (55.63%), Query Frame = 3
Query: 1173 VAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFT--SSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLS--TCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESML 2858
            V  + L   +  + F+ +D E+      +    L  +  Y    K +  TE +L V  +IF+ + ++  ++ +IM  A+ L +A+R S+FL++ +TNEL +++FD +    E+S +S          +  KEIR   ++G+AG VAT+GE LNI DAY    F R +D  TGY TR +LC PI   +  I+GV Q+ NK +G      SSDE   + F++YC +++ H+ +Y  ++ ++ ++++A E+++YH + SE     L    CP P      PD  +++     ++  + V+  L +F T    S  R     L RF+L V++ YR  PYHNWTHA +VAH  YL  ++    N    LE  + F A LCHD+DHRG  NS+     + LAA+YS+  S +E HHFNQTI IL  EG N+F  LN  EY+  L  +++ ILATDLA  F    + +++++ G +   + +HR+LL  + MT  DLS   K W     +  +IY+EF+ +GDLEKA G++P    DR  A  +P+ Q+ FL G+ +PC++   K+   PG   L
Sbjct:   69 VGTIELSRMVGRDPFDEEDEEVFNSYLVWGGISLYYAEMYLHMHKHRKLTEFLLNVTRSIFQDIVSMDTVIMKIMNYAQTLVDADRTSLFLVDNKTNELYARIFD-IGGSLEDSRSS----------QLQKEIRFPKTKGVAGYVATSGETLNISDAYHDDRFNREIDIQTGYTTRTLLCMPIFI-RGNIIGVVQMVNKKSGVLIMCFSSDEKSFQTFAIYCGLALHHAKLYDKIRRSEQKHRVALEVLSYHSKCSEGELHRLKELDCPDP-----YPDLETYEFDSYSLD--SEVMPKLVIFQTRNLFSLSRFDLDELYRFVLTVRKNYRKVPYHNWTHAFAVAHCMYLVIRSGH--NNFTGLEALAMFFACLCHDLDHRGRTNSWMKNEGTPLAAVYST--STMEHHHFNQTITILQHEGHNIFSQLNSAEYKTVLGYMKECILATDLALFFGNKAKLKDVVDKGTFSWDDQEHRRLLRAICMTACDLSACTKPWRIQYKIVEVIYQEFYAEGDLEKAQGKQPIPMKDRNTAHELPAHQVGFLVGICLPCYELLGKVI--PGTKPL 611          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO39522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9Q1])

HSP 1 Score: 333.183 bits (853), Expect = 7.074e-100
Identity = 195/544 (35.85%), Postives = 309/544 (56.80%), Query Frame = 3
Query: 1317 QTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEY------EQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEV-SVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEK-AIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQ----ENRKKWEKLNND 2906
            + + +L +A  IF +  +L  ++ +IM   + L   ERCSV L++  +  L ++ FD                 E ++Y      ++  E+R   + GI G VATTGE LNI DAY+   F   VD+ +G+ T+ ILC PIK+    I+GV QL NKV+G  F  +DE+L +AF+++C ++I  ++MY+NV +A  + K+A E+++YH     E  + L   P+P + S+ L DF +FD +   +++ +++   L+M   LK +  ++I    L RF+L +K+ YR   YHNW HA +VA   Y   K   +      +E ++  VA L HD+DHRGTNNSFQ+ S + LA LYS+  S +E HHF+Q I I+NS+G+ +F  L+  EY K + L+   I+ATDLA +F+      + +E+   D S+   + LL  ++MT  DLS   K W   +  A L+ EEFF QGDLE+  +   P   MDR +   +P +Q+ F+D V +P ++ F++      +  LK+++    ENR++W+KL  D
Sbjct:  301 RNQVLLDLARTIFEEQTSLHNIVHKIMMITQSLLQCERCSVLLVDPTSKTLFAQAFD----------------LEAKDYLQNDDDDKTVEVRFPINIGITGHVATTGETLNIPDAYADERFDPTVDQVSGFTTKTILCMPIKNASGDIIGVVQLLNKVDGTPFNKNDENLFEAFAIFCGMAIHSTVMYENVNKAMAKRKVALEVLSYHAVSPLEEAIKLKEEPLPPITSLRLIDF-AFDDM--SISDDDTLKGCLAMLCDLKIVETFQIDYLTLCRFVLTIKKNYRPVMYHNWRHAFNVAQTMYAMLKKPSIGKYFTVIEQYALIVACLSHDLDHRGTNNSFQIKSATPLAQLYST--STMEHHHFDQCIMIINSQGNEIFNTLSADEYNKIIKLLEASIIATDLALYFQRRGDFFKKVENRELDWSDDSSKDLLRAMMMTACDLSAITKPWLVQKRTAHLVAEEFFQQGDLEQEELHSTPLPTMDRRKKDELPQMQVGFIDAVCLPLYKAFSQF-----DDNLKVLKDGCRENRRQWQKLAED 818          

HSP 2 Score: 110.153 bits (274), Expect = 1.314e-24
Identity = 73/204 (35.78%), Postives = 109/204 (53.43%), Query Frame = 3
Query: 1317 QTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLE---EETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVN---GPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANEL 1910
            + E ++++  +I   LD +  L  +I+     L NA+RCS+FL +   E    LVSKVFD            V    + E+ +  +EIRI    GI G VA TGE +NI +AY    F + +D+ TGY TR+ILC PIKD   +++GVAQ+ NK        FT  DE +   + V+C I I ++ +Y+  Q    RN++  +L
Sbjct:  118 EKEVLMELVKDISNDLD-VQSLCHKILQNVSILLNADRCSLFLCQGPKEGPRFLVSKVFD------------VNAESKLEDVQCLEEIRIPWGTGIVGYVAETGETVNIPNAYEDARFNKEIDKKTGYTTRSILCMPIKDHDGEVIGVAQVINKTGKSTDSAFTIDDEQIFLKYLVFCGIGINNAELYERAQLEIRRNQVLLDL 308          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW30])

HSP 1 Score: 305.834 bits (782), Expect = 3.384e-92
Identity = 192/550 (34.91%), Postives = 293/550 (53.27%), Query Frame = 3
Query: 1173 VAIVGLVDKINSESFNSKDIELIQLVFRFTN-PVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIES-GYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERA-CIPSLQISFLDGVAIPCF 2813
            V +V LV  + S  F  +D E++     + +  +  + ++  + K+  + T  +L V  +IF ++  +  ++++IM  AKKL NA+RCS+FLL++ + EL + +FD                 E   +    EIR   S+GIAG VA TG ILNI DAY    F R VD  TGY T  ILC P++  K  I+GV Q+ N  NG  F+ +D    + F+ YC +++ +S MY ++  AQ ++++A E+++YH   SE+           E   FL   NS D +              S    L F+  +R+    +ARF L V++ YRD PYHNW HA SVAH  ++  ++      L + E  S F+AG+CHD+DHRG NN+F +   + LA LY++  S +E HHF Q + IL SEG N+F  L+ + Y++ L+LI++ I+ATDL   F    +   + E+  +      HR L+  LLMT  DL    K W+        ++EEF+ QGD E+ +G  P   MDR +   +P  Q+ FL G+  PC+
Sbjct:   74 VGVVELVKALGSMPFEKEDEEILNSYLVWGSIAIHHAEISKQITKQKDLNT-FLLNVVRSIFDEVCTMDTVIEKIMAFAKKLVNADRCSLFLLDQASEELFANLFDD--------------GNEDGSFRCGNEIRFPVSKGIAGYVACTGSILNIRDAYRDERFNREVDMKTGYTTHTILCVPVRC-KGSIIGVCQMVNSHNG-FFSPNDMQSFEMFAGYCGLALHYSKMYNSLFCAQQKHQVALEVISYHCCASEK-----------ETEEFL---NSADLVMLP-----PAYYPFSYLSALIFVLIFRVDLETIARFSLSVRKCYRDIPYHNWCHAFSVAHSLWIVIRD---NKSLTDYEKLSLFIAGICHDVDHRGKNNAFMLHCKTPLANLYTT--STMEWHHFKQGVFILESEGQNVFGQLDAESYRRVLELIQEAIIATDLMLFFGNKKELETLQENKAFRWEEEKHRSLIRCLLMTACDLCTSAKPWDIQVVAVNKVFEEFYIQGDEERKMGLDPLPMMDRSKHDDLPENQVGFLKGIVRPCY 582          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO43657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY89])

HSP 1 Score: 279.256 bits (713), Expect = 2.983e-81
Identity = 182/587 (31.01%), Postives = 309/587 (52.64%), Query Frame = 3
Query: 1179 IVGLVDKINSES----FNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTS----VFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVD-ESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPE-VSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKA-IGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLN 2900
            +VG+   IN       F  +D ++  +   F    + ++  + +      +  A+L++  +IF +  +L  ++ +IM  A  L   E+CSV LL +      S+VF+   T    S T     + +  EG           S +  +A  VA TG+ +NI DA          + E  G+    ILC PI++ K +I+GVA+L N+++   F  +DE L +AF+++C + I ++++Y  +  A+ + ++A E+++YH+   +     +    +P+ V + L  F  FD     +   + ++A+L MF    FI  + I   VL+R+IL VK  YR+  YHNW HA +VA   +       + + + +LE     V  LCHD+DHRGTNN+FQ  ++S L+ LY +  S LE HHFN  + IL++EG   F  +   EY++ +  I+  IL+TDLA +F+   +   ++ESG +D  N DHR +L  ++MT  DL+   K WE  + V  L+  EFF QGD+E+     +P   MDR++   +P LQ+ F +   +P F+  AKL  +  + ++   + N+++W+KL+
Sbjct:  151 VVGVAQIINKNPGGVPFTKEDEKVCDMYLTFCGIGITNAKLFELSAIEFNRNRALLELVHDIFEEQTSLEKVVHKIMKRALGLLKCEKCSVLLLTQPELRF-SRVFNLKTTGRITSNTRYGFILLLVSEGHNDR-------SFTSRVAKLVAATGKTMNIPDASQDTRLADSSNVEKKGFSP--ILCMPIRNNKFEIIGVAELINRLDNKPFDENDETLFEAFAIFCGLGIHNTMIYDQMARAKAKQQVALEVLSYHVAAKKTEVEKIRDTQVPKAVDINLHSF-KFDDF--SLAADDMLIASLRMFKDCGFIEEFHIDYEVLSRWILTVKNNYRNVIYHNWRHAFNVAQSMFCMLTTGGMASVITKLECLGLIVGCLCHDLDHRGTNNAFQAKTDSPLSKLYGT--STLEHHHFNHAVIILSTEG---FSPILSDEYRQVISYIKHSILSTDLATNFKQRPKFFALVESGEFDPYNMDHRDMLKAMMMTACDLNGTTKPWEIQKEVVNLVTREFFEQGDMERERYNMEPMAIMDRQKIDELPKLQVQFFETTGLPVFKVLAKLNNKL-QPLVDGAESNKRRWQKLD 718          

HSP 2 Score: 115.161 bits (287), Expect = 2.868e-26
Identity = 72/206 (34.95%), Postives = 113/206 (54.85%), Query Frame = 3
Query: 1305 KTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE--LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNK-VNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELM 1913
            K   + E   ++  +I   LD L  L  +I+     LTNA+RCS+FL+E    +  LVSKVFD           S+ ++   E  +  +EIR+    G+ G  A TGE +NI DAY+ P F + VD+ TGY T+++LC P+K+ + ++VGVAQ+ NK   G  FT  DE +   +  +C I I ++ +++      +RN+   EL+
Sbjct:   12 KNSNEREFFFEIVRDIANDLD-LKTLSYKILVNVGILTNADRCSLFLVEGPKGKQWLVSKVFDV-------HIGSLNVSSAKEAIDHQREIRVPLGVGLVGYAAETGETVNIPDAYADPRFNQDVDKQTGYHTKSLLCKPVKNNEGEVVGVAQIINKNPGGVPFTKEDEKVCDMYLTFCGIGITNAKLFELSAIEFNRNRALLELV 209          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde10a (phosphodiesterase 10A [Source:NCBI gene;Acc:101162470])

HSP 1 Score: 337.421 bits (864), Expect = 1.850e-101
Identity = 199/531 (37.48%), Postives = 297/531 (55.93%), Query Frame = 3
Query: 1329 MLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAY-LCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIE-SGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKL 2897
            +L V+   F  +  +  LL+ IM  AK L NA+RC++F ++    EL S +FD +    E  P           + + KEIR S  +GIAG+VA TGE+LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK+ G  FT +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + E +  L+   +P     E+  F  D + F+ I   +         + M H     + + + +  L RF + V++ YR  PYHNW HA++VAH  Y +  K  D      ELE     +A LCHD+DHRG +N++    +  LAALYS+  S +E+HHF+QT+ IL  EG N+F NLN  EY++ L++IR  I+ATDLA +F    Q  E++  S  D +N  HR  ++ L+MT  DL    K W+  R  A  IY EF+ +GD  K IG +P   MDR++   +P  Q+ F + VAIPC+   +KL+  P   +LK  +EN   WE++
Sbjct:  263 LLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD-IGEEKEGKPV----------FRKTKEIRFSIDKGIAGQVARTGEVLNIPDAYADPRFNREVDLKTGYTTRNILCMPIV-SRGTVIGVVQMVNKLCGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLNLPTPIYKEIETFQFDISPFEEIWPAV--------FIYMVHNSCGENSFELEK--LCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTPD---SFTELEKKGLLIACLCHDLDHRGYSNAYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLNSSEYEQVLEIIRKAIIATDLALYFNNHQQLTELLSTSALDFNNHSHRDRVIGLMMTACDLCSVTKQWQITRLTANDIYAEFWAEGDEMKKIGIQPIPMMDRDKKDEVPEGQVGFYNSVAIPCYTTLSKLF-PPSSPLLKACRENLSHWERI 765          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde10a (phosphodiesterase 10A [Source:NCBI gene;Acc:101162470])

HSP 1 Score: 337.035 bits (863), Expect = 2.264e-101
Identity = 199/531 (37.48%), Postives = 297/531 (55.93%), Query Frame = 3
Query: 1329 MLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAY-LCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIE-SGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKL 2897
            +L V+   F  +  +  LL+ IM  AK L NA+RC++F ++    EL S +FD +    E  P           + + KEIR S  +GIAG+VA TGE+LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK+ G  FT +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + E +  L+   +P     E+  F  D + F+ I   +         + M H     + + + +  L RF + V++ YR  PYHNW HA++VAH  Y +  K  D      ELE     +A LCHD+DHRG +N++    +  LAALYS+  S +E+HHF+QT+ IL  EG N+F NLN  EY++ L++IR  I+ATDLA +F    Q  E++  S  D +N  HR  ++ L+MT  DL    K W+  R  A  IY EF+ +GD  K IG +P   MDR++   +P  Q+ F + VAIPC+   +KL+  P   +LK  +EN   WE++
Sbjct:  266 LLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD-IGEEKEGKPV----------FRKTKEIRFSIDKGIAGQVARTGEVLNIPDAYADPRFNREVDLKTGYTTRNILCMPIV-SRGTVIGVVQMVNKLCGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLNLPTPIYKEIETFQFDISPFEEIWPAV--------FIYMVHNSCGENSFELEK--LCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTPD---SFTELEKKGLLIACLCHDLDHRGYSNAYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLNSSEYEQVLEIIRKAIIATDLALYFNNHQQLTELLSTSALDFNNHSHRDRVIGLMMTACDLCSVTKQWQITRLTANDIYAEFWAEGDEMKKIGIQPIPMMDRDKKDEVPEGQVGFYNSVAIPCYTTLSKLF-PPSSPLLKACRENLSHWERI 768          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde10a (phosphodiesterase 10A [Source:NCBI gene;Acc:101162470])

HSP 1 Score: 337.806 bits (865), Expect = 2.766e-101
Identity = 199/531 (37.48%), Postives = 297/531 (55.93%), Query Frame = 3
Query: 1329 MLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIP-----EVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAY-LCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIE-SGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKL 2897
            +L V+   F  +  +  LL+ IM  AK L NA+RC++F ++    EL S +FD +    E  P           + + KEIR S  +GIAG+VA TGE+LNI DAY+ P F R VD  TGY TRNILC PI   +  ++GV Q+ NK+ G  FT +DE+  K F+V+C +++  + MY  ++ ++   ++  E ++YH   + E +  L+   +P     E+  F  D + F+ I   +         + M H     + + + +  L RF + V++ YR  PYHNW HA++VAH  Y +  K  D      ELE     +A LCHD+DHRG +N++    +  LAALYS+  S +E+HHF+QT+ IL  EG N+F NLN  EY++ L++IR  I+ATDLA +F    Q  E++  S  D +N  HR  ++ L+MT  DL    K W+  R  A  IY EF+ +GD  K IG +P   MDR++   +P  Q+ F + VAIPC+   +KL+  P   +LK  +EN   WE++
Sbjct:  294 LLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHNNKELYSDLFD-IGEEKEGKPV----------FRKTKEIRFSIDKGIAGQVARTGEVLNIPDAYADPRFNREVDLKTGYTTRNILCMPIV-SRGTVIGVVQMVNKLCGSAFTKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLNLPTPIYKEIETFQFDISPFEEIWPAV--------FIYMVHNSCGENSFELEK--LCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAILQKTPD---SFTELEKKGLLIACLCHDLDHRGYSNAYLQKFDHPLAALYST--STMEQHHFSQTVSILQLEGHNIFSNLNSSEYEQVLEIIRKAIIATDLALYFNNHQQLTELLSTSALDFNNHSHRDRVIGLMMTACDLCSVTKQWQITRLTANDIYAEFWAEGDEMKKIGIQPIPMMDRDKKDEVPEGQVGFYNSVAIPCYTTLSKLF-PPSSPLLKACRENLSHWERI 796          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde11a (phosphodiesterase 11A [Source:NCBI gene;Acc:101163533])

HSP 1 Score: 318.546 bits (815), Expect = 1.986e-93
Identity = 192/590 (32.54%), Postives = 314/590 (53.22%), Query Frame = 3
Query: 1179 IVGLVDKINSES----FNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELV--SKVFDGL-PTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEK-AIGQKPAEQMDRERAC-IPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDG 2918
            I+G+   IN  S    F   D +++Q+   F    + ++  +   +K   ++ A+L+V  ++F +  +L  ++++IM  A+ L   ERCSV LLE+  + +V  +K F+ L P  S ++ +S   + E   Y          +  IA  VA+TG  +NI DAY  P F    D+ + +  R++LC PI +   +I+GVAQ+ N+++G  F  +D+ L +AF ++C + I +++MY  V+++  +  +A ++++YH   S+          IP V     D  SFD     ++    + A L MF  L  + +++I    L R++L V++ YR   YHNW HA +V    +           L +LEI +  V  +CHD+DHRGTNN+FQ  + S LA LY +  + LE HHFN  + IL SEG N+F NL+  EY   + L++  ILATDL  +F   N   +++  G Y+ +   HR +   ++MT  DL    K W+ +R VA L+  EFF QGD E+  +   P+   DR R   +P LQ+ ++DG+  P ++   KL  +  + M   ++ NR KWE+LN   + G
Sbjct:  294 IIGVAQAINKTSNGELFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVRFTKSFELLSPKCSADAESSFKDSMEKSSYSD-----WLINNRIAELVASTGLPVNISDAYQDPRFDAEADQFSDFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKTEVDKFKAANIPLVCELGIDKLSFDDFSLDVDAM--ITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQCMFAMLTTAGFQEVLTDLEILALIVGCVCHDLDHRGTNNAFQAKTGSALALLYGTSAT-LEHHHFNHAVMILQSEGHNIFSNLSSTEYSDLMQLLKLSILATDLTLYFENRNMFFDLVSKGEYNWNVKAHRDMCRSMMMTACDLGAVTKPWDISRKVAELVTSEFFEQGDRERLELKLTPSAIFDRNRKDELPGLQLEWIDGICAPLYETLVKLNPKL-QPMFDRIRANRSKWEELNKKRQSG 874          

HSP 2 Score: 103.219 bits (256), Expect = 6.724e-22
Identity = 70/213 (32.86%), Postives = 115/213 (53.99%), Query Frame = 3
Query: 1266 PVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE--LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKV-NGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNK 1895
            P       YY+++    + E  L++  +I   LD LT L  +I+     + +A+RCS+FL+E   N+  LVSK FD       ++ T+V I+   +E + P        +GI G VA  GE +NI DAY    F   +D+ TGY+T+++LC PI +   +I+GVAQ  NK  NG  FT  DE + + +  +C I+I ++ ++   ++   R++
Sbjct:  149 PSTAVDFKYYLKEHN--EREFFLELVKDISNDLD-LTSLSYKILVFVCIMVDADRCSLFLVEGTGNKKTLVSKFFD------VHAGTTVLISMNSDEVQVP------WGKGIIGYVAEHGETVNIPDAYQDRRFSDEIDKLTGYKTKSLLCMPIHNSDGEIIGVAQAINKTSNGELFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSR 346          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde5ab (phosphodiesterase 5A [Source:NCBI gene;Acc:101173207])

HSP 1 Score: 269.24 bits (687), Expect = 3.173e-76
Identity = 189/608 (31.09%), Postives = 311/608 (51.15%), Query Frame = 3
Query: 1179 IVGLVDKINSE-----SFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVF----DGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVD--ESTGYRTRNILCFPIKD-EKDKIVGVAQLCNKVNGPH-----FTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEV-SVFLPDFN--SFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDP-PYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESG-YDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLE-KAIGQKPAEQMDRE-RACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITA 2930
            +VG+   IN       +F  +D +       F+  VL ++  Y   +    +   +L +A  IF +   L +LL++I         A+ C+VF+ +EE+    S VF    + L  V E+   +  +          K+I    +Q     V +T + LNI D      F    D  +    + +++LC PI++ +KDK++GV QL NK++        F  +DE   +AF+++C + I ++ MY+ V+ A  + ++  E+++YH   +EE    L    +P   S+ L DF+   FD     +++  + LAT+ MF  L  +  +++  + L ++IL VK+ YR    YHNW HA + A   +   K+  L N L++LEI +  +A L HD+DHRG NNS+   S   LA LY    S +E HHF+Q + ILN+ G+ +   L+  EY+  L +I   ILATDLA + +      E+ ++  +   +  HR LL  +LMT  D+S   K W   + VA L+  EFF QGD E + +  +P + M+RE R  IPS+Q+SF+D + I  ++  A L       +L+  Q+NR+ W++L  D   G++ A
Sbjct:  259 VVGVAQAINKTCGEDGAFTEQDQKDFSAYLAFSGIVLHNAQLYETSQLENKRNRVLLDLATLIFEEQQCLEVLLRKIAGTILSFMQAQACTVFIADEESMNSFSGVFHMEHEELSEVLEDPKRNCDV----------KQINYMFAQ----YVKSTMQPLNISDVTKDQRFPWTSDCPDHMSNQIKSLLCAPIRNRKKDKVIGVCQLVNKLDEASGSIKSFNRNDEQFLEAFAIFCGLGIQNTQMYETVERAMAKQEVTLEVLSYHASATEEESQELQVATVPSAQSLRLLDFSFSDFD-----LSDTETTLATIRMFTDLNLVQNFQMKYTSLCQWILSVKKNYRKSVAYHNWRHAFNTAQCMFALLKSGRLQNNLSDLEILALMIATLSHDLDHRGVNNSYIQRSEHPLAQLYCH--STMEHHHFDQCLMILNTPGNQILSGLSLDEYKATLKMIEKAILATDLALYMKKREDFFELTKNNQFVWVDEHHRDLLRSMLMTACDISAITKPWPVQKRVAELVATEFFEQGDKERRELNIEPTDLMNREKRDKIPSMQVSFIDAICIQLYETLAGLLEH-CSPLLEGCQKNRQHWKRLAEDCEKGQVDA 844          

HSP 2 Score: 96.2857 bits (238), Expect = 7.962e-20
Identity = 67/201 (33.33%), Postives = 108/201 (53.73%), Query Frame = 3
Query: 1329 MLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE---LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPH--FTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMT 1916
            +L++  ++   LD +  L  +I     +L  A+R S+FL+ E+++    LVS++FD    V+E S      +           IR+  ++GI G VA TG+ LNI +AY  P F   VD  TGY+T++ILC PIK+ + ++VGVAQ  NK  G    FT  D+    A+  +  I + ++ +Y+  Q    RN++  +L T
Sbjct:  133 LLELVKDVSSHLD-VPALCHKIFLHINELIAADRYSLFLVGEDSSNRKFLVSRLFD----VAEGSTLEESSS---------SSIRLEWNKGIVGHVAATGQPLNIKNAYKDPRFNAEVDLITGYKTQSILCLPIKNHRGEVVGVAQAINKTCGEDGAFTEQDQKDFSAYLAFSGIVLHNAQLYETSQLENKRNRVLLDLAT 319          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000075722.1 (SMESG000075722.1)

HSP 1 Score: 1838.16 bits (4760), Expect = 0.000e+0
Identity = 902/906 (99.56%), Postives = 905/906 (99.89%), Query Frame = 3
Query:  276 TCCCGINKLSHSNHNEDVEQISVHELVTIISPAEVEETVTRVISKLFQKSEKIKILWEFKSVSNHLNHTHSSIWKINLPDHKGKLILTSKQMDKSVYANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNGSLMSPSISSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDMSPLHSINNTNT 2993
            TCCCGINKLSHSNHNEDVEQIS+HELVTIISPAEVEETVTRVISKLFQKSEKIKILWEFKSVSNHLNHTHSSIWKINLPDHKGKLILTSKQMDKSVYANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNGSLMSPSISSAEISNETRNAILTLCGEL+DRDPCVLQMKIINFLKGMIHVKTGFIL VSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDSLLLIPILSSLNNSLVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVL+SSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDMSPLHSINNTNT
Sbjct:    4 TCCCGINKLSHSNHNEDVEQISIHELVTIISPAEVEETVTRVISKLFQKSEKIKILWEFKSVSNHLNHTHSSIWKINLPDHKGKLILTSKQMDKSVYANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNGSLMSPSISSAEISNETRNAILTLCGELFDRDPCVLQMKIINFLKGMIHVKTGFILIVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDSLLLIPILSSLNNSLVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLISSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDMSPLHSINNTNT 909          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000051078.1 (SMESG000051078.1)

HSP 1 Score: 1014.22 bits (2621), Expect = 0.000e+0
Identity = 511/920 (55.54%), Postives = 665/920 (72.28%), Query Frame = 3
Query:  276 TCCCGINKLSHSNHNEDVEQISVHELVTIISPAEVEETVTRVISKLFQKSEKIKILWEFKSVSNHLNHTHSSIW----KINLPDHKGKLILTSKQMDKSVYANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNGS---------LMSPSISSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKEN-CVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINS-ESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDMSPLHSINNTN 2990
             CCC + +    +  E+ E+  +  L  I+S  E+ + V   I+++F  S  +++ W   +  N      S+ W    KI +P  +  LI+  K   +  Y++ F      N+GI +P+   E   F A+L+F C +++    K L   E Q+K+MFQRL  +  S         L  P + S++   ++   IL+LC +L+DRDP +LQ+KII FLK  IH+++ FILT+S    E  CQ  D  I +PE R  + +SI E I+KE  C +    +  Q+KL +L++L   T  KW+S L +PI++  +  + A+V +++KI S +SF ++DI + Q +F++T  VL SS+A+ +E++ K+QTE MLQVAMNIFRKL +LT LLKEIMTEAKKLTNAERCSVFL++ +T ELVSKVFDGLPT+SE S             + P EIRI  +QG+AG+VATTGE+LNI+DAYSHPLFYRGVDE TGY+TRNILCFPIKDE +K+VGVAQLCNK+NGP FT+ DED+AKAFSVYCCISI+HSLMYK VQ+AQHRNKLANELM YHMQ++E+   WL++C  P++     DFNSF+ IPR + EH+S LA L MF+TL FIS+WR+ R  L+RFILM+KRGYRDPPYHNWTHA SVAHF YLC  NL L  QL  +E+ + FVA LCHDIDHRGTNNSFQVTS SVLAALYSSEGSVLERHHF+QTIC+LNSEG N+FEN +RQ+Y   LDLIRDIILATDLAHH RII+ QR+MI++ YD ++  H  LL+ LLMT ADLSDQ K+W+N R VA+LIYEEFF+QGD+EK+IGQKPAEQMDRERAC+PSLQ+SFLDG+A+PCFQ FA LY   G+ M++ +  NRKKWEKLN DI++GKI+ANIFQLF +D+SP+ S+++ +
Sbjct:    4 ACCCLMKRKLSESCLENTERELLLGLSNIVSYEEIPDAVKTTINRVFPNSNSVRLEW-INTRENSTKSIRSNGWMNENKI-IP--QSSLIINRKDRLQEQYSDYFDSENSDNFGIIVPLISSEMKEFQAFLSFSCQEFNQNEKKLLQTFENQVKVMFQRLERLKNSKDSNLQQSNLQDPKLDSSDFYIDS--TILSLCADLHDRDPGILQVKIIRFLKQRIHMESAFILTISNNNLELVCQAQDEQIFDPEKRFRVTDSIFERIMKEKICAQLSDVNMFQDKLNELELL---TNIKWNSFLCVPIINQSDGCVSALVCMINKIGSNQSFTAEDISITQHLFQYTAAVLTSSVAFQMERRLKIQTETMLQVAMNIFRKLGDLTGLLKEIMTEAKKLTNAERCSVFLVDNDTKELVSKVFDGLPTISEQS-------------QHPVEIRIPVTQGVAGRVATTGEMLNIVDAYSHPLFYRGVDEETGYKTRNILCFPIKDENEKVVGVAQLCNKINGPCFTNYDEDIAKAFSVYCCISIMHSLMYKKVQDAQHRNKLANELMIYHMQVNEDTVKWLTSCGYPDLMDIKEDFNSFECIPRDIKEHDSALAVLGMFNTLGFISKWRLSRPTLSRFILMIKRGYRDPPYHNWTHAFSVAHFIYLCITNLPLHGQLLPIELLALFVASLCHDIDHRGTNNSFQVTSKSVLAALYSSEGSVLERHHFSQTICVLNSEGCNIFENFSRQDYHHVLDLIRDIILATDLAHHLRIISDQRKMIDTFYDSNSNHHHVLLMDLLMTSADLSDQSKNWKNTRAVAQLIYEEFFSQGDMEKSIGQKPAEQMDRERACVPSLQMSFLDGIALPCFQLFADLYPLFGQKMIENITNNRKKWEKLNEDIKNGKISANIFQLFHRDISPMRSLSSVD 901          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000051078.1 (SMESG000051078.1)

HSP 1 Score: 1009.98 bits (2610), Expect = 0.000e+0
Identity = 508/905 (56.13%), Postives = 659/905 (72.82%), Query Frame = 3
Query:  321 EDVEQISVHELVTIISPAEVEETVTRVISKLFQKSEKIKILWEFKSVSNHLNHTHSSIW----KINLPDHKGKLILTSKQMDKSVYANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEKQIKIMFQRLTVMNGS---------LMSPSISSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSIIESIVKEN-CVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINS-ESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDMSPLHSINNTN 2990
            E+ E+  +  L  I+S  E+ + V   I+++F  S  +++ W   +  N      S+ W    KI +P  +  LI+  K   +  Y++ F      N+GI +P+   E   F A+L+F C +++    K L   E Q+K+MFQRL  +  S         L  P + S++   ++   IL+LC +L+DRDP +LQ+KII FLK  IH+++ FILT+S    E  CQ  D  I +PE R  + +SI E I+KE  C +    +  Q+KL +L++L   T  KW+S L +PI++  +  + A+V +++KI S +SF ++DI + Q +F++T  VL SS+A+ +E++ K+QTE MLQVAMNIFRKL +LT LLKEIMTEAKKLTNAERCSVFL++ +T ELVSKVFDGLPT+SE S             + P EIRI  +QG+AG+VATTGE+LNI+DAYSHPLFYRGVDE TGY+TRNILCFPIKDE +K+VGVAQLCNK+NGP FT+ DED+AKAFSVYCCISI+HSLMYK VQ+AQHRNKLANELM YHMQ++E+   WL++C  P++     DFNSF+ IPR + EH+S LA L MF+TL FIS+WR+ R  L+RFILM+KRGYRDPPYHNWTHA SVAHF YLC  NL L  QL  +E+ + FVA LCHDIDHRGTNNSFQVTS SVLAALYSSEGSVLERHHF+QTIC+LNSEG N+FEN +RQ+Y   LDLIRDIILATDLAHH RII+ QR+MI++ YD ++  H  LL+ LLMT ADLSDQ K+W+N R VA+LIYEEFF+QGD+EK+IGQKPAEQMDRERAC+PSLQ+SFLDG+A+PCFQ FA LY   G+ M++ +  NRKKWEKLN DI++GKI+ANIFQLF +D+SP+ S+++ +
Sbjct:   11 ENTERELLLGLSNIVSYEEIPDAVKTTINRVFPNSNSVRLEW-INTRENSTKSIRSNGWMNENKI-IP--QSSLIINRKDRLQEQYSDYFDSENSDNFGIIVPLISSEMKEFQAFLSFSCQEFNQNEKKLLQTFENQVKVMFQRLERLKNSKDSNLQQSNLQDPKLDSSDFYIDS--TILSLCADLHDRDPGILQVKIIRFLKQRIHMESAFILTISNNNLELVCQAQDEQIFDPEKRFRVTDSIFERIMKEKICAQLSDVNMFQDKLNELELL---TNIKWNSFLCVPIINQSDGCVSALVCMINKIGSNQSFTAEDISITQHLFQYTAAVLTSSVAFQMERRLKIQTETMLQVAMNIFRKLGDLTGLLKEIMTEAKKLTNAERCSVFLVDNDTKELVSKVFDGLPTISEQS-------------QHPVEIRIPVTQGVAGRVATTGEMLNIVDAYSHPLFYRGVDEETGYKTRNILCFPIKDENEKVVGVAQLCNKINGPCFTNYDEDIAKAFSVYCCISIMHSLMYKKVQDAQHRNKLANELMIYHMQVNEDTVKWLTSCGYPDLMDIKEDFNSFECIPRDIKEHDSALAVLGMFNTLGFISKWRLSRPTLSRFILMIKRGYRDPPYHNWTHAFSVAHFIYLCITNLPLHGQLLPIELLALFVASLCHDIDHRGTNNSFQVTSKSVLAALYSSEGSVLERHHFSQTICVLNSEGCNIFENFSRQDYHHVLDLIRDIILATDLAHHLRIISDQRKMIDTFYDSNSNHHHVLLMDLLMTSADLSDQSKNWKNTRAVAQLIYEEFFSQGDMEKSIGQKPAEQMDRERACVPSLQMSFLDGIALPCFQLFADLYPLFGQKMIENITNNRKKWEKLNEDIKNGKISANIFQLFHRDISPMRSLSSVD 893          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000021196.1 (SMESG000021196.1)

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 400/766 (52.22%), Postives = 528/766 (68.93%), Query Frame = 3
Query:  654 LTFY--CNQWDSKSTKTLDHLEKQIKIMFQRLTVMNGSLMSPSISSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIR-NSIIESIVKE------NCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKI 2924
            LTF+   N+     +K LD LEKQ+ +   RL  ++ + +        ISN+  N IL LCG L+D+D   LQ K++++L      +TGF+L V  +  E  CQVI   I    +  +   N I + ++K        C+ + +  EI   +       S    K  + L +P+     N ++AIV L++K     F + D ++I   F++T  VL +++AY  E++ K+QTE ML VA NIF ++DNL  LL  IM EA+ LT AERCSVFL++E++NELV+KVFDGLPT S+ +        +G E +QP EIR   +QGIAG VATTGE+LNI  AY HPLFYRGVD+ TG++T+NILCFPI+D+  K VGVAQLCNK+ G  FT  DE++AKAFS+YCCISI HSLMYK V++AQHR++LANELM YHMQI E++  WLST  IP VS+FL DF SF+SIPR + + ++++A +SMF  +  ISRWRI R  L +FI MVKR YRDPPYHNW HA SVAHF ++C KNL L  QL ELE+F+ FVA LCHDIDHRGTNNSFQV SNS+LAALYSSEGSVLERHHF+QT+CILN+EG N+FE+L ++EY KALDLIRDIILATDLAHH +I ++  +M + GYD  + ++  LLL LLMT ADLSDQ K+W N R+VA LIY+EFF QGDLEKAIG +PAEQMDRERA +P+LQI+FLDG+  P ++  + L+ Q  + +   ++  R+ W K++  +   +I
Sbjct:  124 LTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKI--------ISNQI-NQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMN-----ASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKNER--LRLQDGTEIQQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYIKALDLIRDIILATDLAHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQT-DCINHTIERTRENWSKISQKVASHEI 872          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000021196.1 (SMESG000021196.1)

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 399/766 (52.09%), Postives = 525/766 (68.54%), Query Frame = 3
Query:  654 LTFY--CNQWDSKSTKTLDHLEKQIKIMFQRLTVMNGSLMSPSISSAEISNETRNAILTLCGELYDRDPCVLQMKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIR-NSIIESIVKE------NCVKKVKSSEIQNKLGDLKVLQSLTGFKWDXXXXXXXXXXXXXXXVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKVQTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNELVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATTGEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCNKVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMTYHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSMFHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCGKNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSEGSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAHHFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNVARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQNFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKI 2924
            LTF+   N+     +K LD LEKQ+ +   RL  ++ + +        ISN+  N IL LCG L+D+D   LQ K++++L      +TGF+L V  +  E  CQVI   I    +  +   N I + ++K        C+ + +  EI   +       S    K  + L +P+     N ++AIV L++K     F + D ++I   F++T  VL +++AY  E++ K+QTE ML VA NIF ++DNL  LL  IM EA+ LT AERCSVFL++E++NELV+KVFDGLPT S+ +             EQP EIR   +QGIAG VATTGE+LNI  AY HPLFYRGVD+ TG++T+NILCFPI+D+  K VGVAQLCNK+ G  FT  DE++AKAFS+YCCISI HSLMYK V++AQHR++LANELM YHMQI E++  WLST  IP VS+FL DF SF+SIPR + + ++++A +SMF  +  ISRWRI R  L +FI MVKR YRDPPYHNW HA SVAHF ++C KNL L  QL ELE+F+ FVA LCHDIDHRGTNNSFQV SNS+LAALYSSEGSVLERHHF+QT+CILN+EG N+FE+L ++EY KALDLIRDIILATDLAHH +I ++  +M + GYD  + ++  LLL LLMT ADLSDQ K+W N R+VA LIY+EFF QGDLEKAIG +PAEQMDRERA +P+LQI+FLDG+  P ++  + L+ Q  + +   ++  R+ W K++  +   +I
Sbjct:  124 LTFFQKFNENSENRSKRLDFLEKQMSLTLSRLMRIHPNKI--------ISNQI-NQILELCGSLFDQDAGKLQKKVLSYLIQNTSAETGFLLLVCMDTVELLCQVIGQVIQEDPINFDAEENGIFDKVLKSKTGINLGCLTEAQLREISEIMN-----ASKQETKIQNALCVPVRHQGTNDVIAIVCLINKSGPAQFTNYDEQVINECFKYTTSVLFTTIAYQNERRLKLQTEKMLVVAKNIFSRMDNLNELLLMIMQEARNLTQAERCSVFLVDEDSNELVAKVFDGLPTSSDKN-------------EQPVEIRFPKAQGIAGHVATTGEMLNIKKAYDHPLFYRGVDDETGFKTKNILCFPIQDDCGKTVGVAQLCNKIKGHFFTKMDEEIAKAFSIYCCISITHSLMYKKVEDAQHRSRLANELMMYHMQIPEDDIAWLSTFSIPPVSIFLSDFESFNSIPRNVKDRDTLMACISMFDGIGLISRWRINRRTLTKFIFMVKRNYRDPPYHNWMHAFSVAHFIFICIKNLPLDKQLTELELFALFVASLCHDIDHRGTNNSFQVQSNSILAALYSSEGSVLERHHFSQTVCILNTEGCNVFESLPQKEYIKALDLIRDIILATDLAHHLQIFSKIEKMAQQGYDNLDSENHNLLLCLLMTSADLSDQTKNWRNTRSVAELIYKEFFRQGDLEKAIGNQPAEQMDRERAVVPNLQIAFLDGIVSPLYRVLSLLHPQT-DCINHTIERTRENWSKISQKVASHEI 861          
The following BLAST results are available for this feature:
BLAST of Phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE2A0.000e+045.47phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A0.000e+045.47phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A0.000e+045.47phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A0.000e+045.47phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A0.000e+046.41phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde-24.169e-10135.95Probable 3',5'-cyclic phosphodiesterase pde-2 [So... [more]
pde-25.241e-10135.95Probable 3',5'-cyclic phosphodiesterase pde-2 [So... [more]
pde-56.898e-9935.77Probable 3',5'-cyclic phosphodiesterase pde-5 [So... [more]
pde-12.251e-3630.24Probable 3',5'-cyclic phosphodiesterase pde-1 [So... [more]
pde-18.113e-3630.24Probable 3',5'-cyclic phosphodiesterase pde-1 [So... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde62.247e-9533.01gene:FBgn0038237 transcript:FBtr0300330[more]
Pde62.247e-9533.01gene:FBgn0038237 transcript:FBtr0345168[more]
Pde62.370e-9533.01gene:FBgn0038237 transcript:FBtr0330048[more]
Pde111.180e-8832.48gene:FBgn0085370 transcript:FBtr0303163[more]
Pde112.724e-8832.48gene:FBgn0085370 transcript:FBtr0303162[more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde10a2.887e-9836.98phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde10a1.399e-9735.16phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde10a6.110e-9637.33phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde11a1.023e-9532.99phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pde11al2.012e-9032.42phosphodiesterase 11a, like [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE10A6.903e-9636.02phosphodiesterase 10A [Source:NCBI gene;Acc:100485... [more]
pde2a1.254e-9439.35phosphodiesterase 2A [Source:NCBI gene;Acc:780063][more]
ENSXETT00000053056.19.802e-9432.88phosphodiesterase 11A [Source:NCBI gene;Acc:100379... [more]
PDE10A4.676e-9036.83phosphodiesterase 10A [Source:NCBI gene;Acc:100485... [more]
pde2a6.111e-9039.05phosphodiesterase 2A [Source:NCBI gene;Acc:780063][more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm458370.000e+045.44predicted gene 45837 [Source:MGI Symbol;Acc:MGI:58... [more]
Pde2a0.000e+045.44phosphodiesterase 2A, cGMP-stimulated [Source:MGI ... [more]
Pde2a0.000e+045.44phosphodiesterase 2A, cGMP-stimulated [Source:MGI ... [more]
Pde2a0.000e+045.44phosphodiesterase 2A, cGMP-stimulated [Source:MGI ... [more]
Pde2a0.000e+044.97phosphodiesterase 2A, cGMP-stimulated [Source:MGI ... [more]
back to top
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14099|PDE2A_BOVIN0.000e+045.34cGMP-dependent 3',5'-cyclic phosphodiesterase OS=B... [more]
sp|Q01062|PDE2A_RAT0.000e+045.33cGMP-dependent 3',5'-cyclic phosphodiesterase OS=R... [more]
sp|O00408|PDE2A_HUMAN0.000e+045.47cGMP-dependent 3',5'-cyclic phosphodiesterase OS=H... [more]
sp|Q922S4|PDE2A_MOUSE0.000e+044.97cGMP-dependent 3',5'-cyclic phosphodiesterase OS=M... [more]
sp|P30645|PDE2_CAEEL6.667e-10035.95Probable 3',5'-cyclic phosphodiesterase pde-2 OS=C... [more]
back to top
BLAST of Phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FW740.000e+047.02Phosphodiesterase (Fragment) OS=Macrostomum lignan... [more]
A0A3Q0KMK50.000e+051.41Phosphodiesterase OS=Schistosoma mansoni OX=6183 P... [more]
A0A5K4ENT00.000e+051.41Phosphodiesterase OS=Schistosoma mansoni OX=6183 P... [more]
R7VEB40.000e+053.32Phosphodiesterase (Fragment) OS=Capitella teleta O... [more]
A0A4Z2CV850.000e+051.55Phosphodiesterase OS=Schistosoma japonicum OX=6182... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde10a3.371e-9937.17phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde11a7.044e-9733.50phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pde11al8.800e-9233.16dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 1... [more]
pde11al1.650e-8632.56dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 1... [more]
pde11a3.274e-8231.52phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE2A0.000e+052.40phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE2A1.912e-16157.46phosphodiesterase 2A [Source:HGNC Symbol;Acc:HGNC:... [more]
pde5ab2.215e-6930.27phosphodiesterase 5A, cGMP-specific, b [Source:ZFI... [more]
pde10a4.829e-3634.13phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pde1a7.015e-3330.86phosphodiesterase 1A, calmodulin-dependent [Source... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDE29.255e-627.72High-affinity cyclic AMP phosphodiesterase; compon... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO386444.190e-15948.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446266.431e-10635.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395227.074e-10035.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320883.384e-9234.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436572.983e-8131.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde10a1.850e-10137.48phosphodiesterase 10A [Source:NCBI gene;Acc:101162... [more]
pde10a2.264e-10137.48phosphodiesterase 10A [Source:NCBI gene;Acc:101162... [more]
pde10a2.766e-10137.48phosphodiesterase 10A [Source:NCBI gene;Acc:101162... [more]
pde11a1.986e-9332.54phosphodiesterase 11A [Source:NCBI gene;Acc:101163... [more]
pde5ab3.173e-7631.09phosphodiesterase 5A [Source:NCBI gene;Acc:1011732... [more]
back to top
BLAST of Phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075722.10.000e+099.56SMESG000075722.1[more]
SMESG000051078.10.000e+055.54SMESG000051078.1[more]
SMESG000051078.10.000e+056.13SMESG000051078.1[more]
SMESG000021196.10.000e+052.22SMESG000021196.1[more]
SMESG000021196.10.000e+052.09SMESG000021196.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000345 ID=SMED30000345|Name=Phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=3064bp
GCAGACTTTTGAATTCTAATTTCTGCCAATCAAATCCAAGGAATTCTCTG
TGTACAACTGGAATTAAAATGACATTGTTTTCAATGCCGACTTTTGACAG
CGATCTTGTGAAATATCATTATTGTTAAATTGTAATGGATTATATTGTTA
TATTTTCTAAATCTCATCTGTTCAATGAACCGACTAATAGATGCAATTCA
AGAGGTCTTGAGCACCTTGATTACTTTCAATGTATTTCTATGATCTTTAG
CTAAATATTTATCGTGATGGCTATTACATGTTGTTGTGGTATTAATAAAC
TGTCCCACTCTAATCACAATGAAGATGTCGAACAGATTTCAGTTCATGAA
CTGGTCACAATCATCAGTCCTGCCGAAGTGGAAGAGACAGTTACAAGAGT
GATTTCAAAATTGTTCCAAAAATCAGAAAAAATAAAAATCCTTTGGGAAT
TTAAATCAGTTTCAAATCACCTTAATCACACGCATTCAAGTATCTGGAAA
ATAAATCTGCCTGATCATAAAGGGAAACTGATACTGACATCCAAACAAAT
GGATAAATCAGTCTATGCAAATCTTTTTAAAGAAAGAGCTGGATCAAATT
ATGGAATTTTCCTGCCAATATTTGACGATGAAAACTCAATGTTCAATGCT
TACTTGACATTTTACTGCAACCAGTGGGATTCCAAGTCTACGAAAACTCT
TGATCATCTGGAAAAACAGATTAAAATTATGTTTCAAAGACTGACTGTGA
TGAATGGTTCTTTGATGTCTCCTTCAATTAGCTCTGCTGAAATATCGAAT
GAGACTAGAAATGCCATTTTAACGCTGTGTGGAGAATTATATGACCGAGA
TCCATGTGTTTTACAAATGAAAATTATTAATTTTCTTAAAGGAATGATAC
ATGTGAAAACAGGATTCATCTTGACAGTTAGCACAGAAATTTCTGAATTT
GGATGTCAAGTCATCGATTCTACAATCGTGAATCCAGAATTACGGTGTGA
AATTAGGAACAGCATTATAGAATCAATTGTGAAAGAAAATTGTGTCAAAA
AAGTGAAGTCGTCAGAAATTCAAAATAAATTAGGTGACCTGAAGGTCCTA
CAAAGTTTGACAGGTTTCAAATGGGACTCCTTATTACTCATTCCTATATT
AAGTTCATTAAATAACTCTCTTGTGGCCATTGTTGGTCTTGTGGATAAAA
TTAATTCAGAGAGCTTCAATAGCAAAGATATTGAGTTAATACAATTAGTC
TTTCGGTTTACAAATCCAGTGTTGATGAGTAGCCTTGCGTATTATGTAGA
AAAGAAGACCAAAGTTCAGACTGAGGCAATGTTACAAGTAGCAATGAATA
TATTCAGAAAGCTAGACAACCTTACAATGCTACTGAAAGAAATTATGACA
GAAGCGAAGAAGTTGACAAATGCTGAAAGGTGTTCAGTTTTTTTGTTGGA
AGAAGAAACTAATGAGCTTGTTTCAAAAGTATTTGACGGTCTTCCAACTG
TATCAGAAAATTCACCAACCTCTGTCTTTATCACCCCTGAAGGAGAAGAA
TATGAACAGCCAAAAGAAATACGAATATCAACTAGCCAAGGAATTGCTGG
AAAAGTCGCAACAACAGGTGAAATACTCAATATCTTGGATGCGTATTCTC
ATCCTTTATTCTACAGAGGCGTGGATGAATCGACGGGATACAGAACGAGA
AATATTTTGTGTTTTCCTATTAAAGATGAAAAGGATAAAATCGTCGGAGT
CGCTCAATTATGCAACAAGGTTAATGGACCTCACTTTACAAGTTCTGATG
AGGACCTTGCTAAAGCATTCTCTGTTTACTGTTGCATAAGTATTGTCCAC
TCTTTAATGTATAAAAACGTCCAAGAAGCTCAACATCGCAACAAGTTAGC
AAATGAACTAATGACTTATCATATGCAAATCTCAGAAGAAAACTTTCTTT
GGTTGTCAACGTGTCCAATACCAGAGGTCTCAGTTTTCCTACCAGATTTC
AATAGTTTCGACTCGATTCCCCGACAAATGAACGAACACAATTCCGTTTT
AGCGACACTCAGTATGTTCCACACGTTGAAGTTCATTTCCCGATGGAGAA
TTCCAAGATCAGTTCTGGCCAGATTTATTTTAATGGTCAAACGCGGTTAC
CGAGATCCTCCATATCATAATTGGACTCATGCTTTATCAGTTGCTCATTT
TGCCTATCTCTGTGGAAAAAATCTTGACTTGATGAATCAACTGAATGAAT
TGGAAATATTTTCATTTTTCGTTGCGGGACTTTGTCATGATATTGACCAT
AGAGGAACAAATAATTCTTTTCAGGTCACCTCAAATTCCGTACTTGCAGC
CTTATATAGTAGTGAAGGTTCTGTGCTAGAAAGACATCATTTCAATCAAA
CAATTTGCATTCTCAATTCAGAAGGGAGTAATCTATTTGAAAATCTAAAT
CGACAGGAATATCAAAAAGCACTGGATTTGATACGGGATATAATTCTAGC
AACAGACCTAGCTCATCATTTTCGAATAATTAATCAACAAAGAGAGATGA
TTGAATCCGGATACGACAAATCTAATCCAGACCACCGGAAGCTTCTTTTA
TTTCTTCTAATGACTTGCGCGGATCTGAGCGATCAAATTAAATCGTGGGA
AAACGCCAGAAATGTTGCAAGATTAATTTATGAGGAATTCTTTACTCAAG
GCGACTTGGAAAAGGCTATCGGTCAGAAACCAGCCGAACAAATGGATAGA
GAAAGAGCTTGCATTCCGAGTTTGCAAATATCCTTTCTAGACGGTGTAGC
GATACCCTGTTTTCAAAATTTTGCTAAACTCTATCGACAACCTGGCGAAT
CGATGTTGAAGATCATGCAAGAGAATCGAAAGAAATGGGAGAAACTTAAC
AATGACATTCGAGACGGGAAAATAACTGCCAACATATTTCAGTTGTTTCA
AAAGGATATGTCACCTTTGCATTCTATAAATAATACCAATACTTGATGAT
GTGAATGCTAGATTTTCATAATTAGAATACCGTTGTTTTTATTATTTTTA
TTACGAAATAAAAC
back to top

protein sequence of SMED30000345-orf-1

>SMED30000345-orf-1 ID=SMED30000345-orf-1|Name=SMED30000345-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=910bp
MAITCCCGINKLSHSNHNEDVEQISVHELVTIISPAEVEETVTRVISKLF
QKSEKIKILWEFKSVSNHLNHTHSSIWKINLPDHKGKLILTSKQMDKSVY
ANLFKERAGSNYGIFLPIFDDENSMFNAYLTFYCNQWDSKSTKTLDHLEK
QIKIMFQRLTVMNGSLMSPSISSAEISNETRNAILTLCGELYDRDPCVLQ
MKIINFLKGMIHVKTGFILTVSTEISEFGCQVIDSTIVNPELRCEIRNSI
IESIVKENCVKKVKSSEIQNKLGDLKVLQSLTGFKWDSLLLIPILSSLNN
SLVAIVGLVDKINSESFNSKDIELIQLVFRFTNPVLMSSLAYYVEKKTKV
QTEAMLQVAMNIFRKLDNLTMLLKEIMTEAKKLTNAERCSVFLLEEETNE
LVSKVFDGLPTVSENSPTSVFITPEGEEYEQPKEIRISTSQGIAGKVATT
GEILNILDAYSHPLFYRGVDESTGYRTRNILCFPIKDEKDKIVGVAQLCN
KVNGPHFTSSDEDLAKAFSVYCCISIVHSLMYKNVQEAQHRNKLANELMT
YHMQISEENFLWLSTCPIPEVSVFLPDFNSFDSIPRQMNEHNSVLATLSM
FHTLKFISRWRIPRSVLARFILMVKRGYRDPPYHNWTHALSVAHFAYLCG
KNLDLMNQLNELEIFSFFVAGLCHDIDHRGTNNSFQVTSNSVLAALYSSE
GSVLERHHFNQTICILNSEGSNLFENLNRQEYQKALDLIRDIILATDLAH
HFRIINQQREMIESGYDKSNPDHRKLLLFLLMTCADLSDQIKSWENARNV
ARLIYEEFFTQGDLEKAIGQKPAEQMDRERACIPSLQISFLDGVAIPCFQ
NFAKLYRQPGESMLKIMQENRKKWEKLNNDIRDGKITANIFQLFQKDMSP
LHSINNTNT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036971PDEase_catalytic_dom_sf
IPR023088PDEase
IPR003607HD/PDEase_dom
IPR003018GAF
IPR002073PDEase_catalytic_dom
IPR029016GAF-like_dom_sf
IPR023174PDEase_CS
Vocabulary: molecular function
TermDefinition
GO:0008081phosphoric diester hydrolase activity
GO:0005515protein binding
GO:00041143',5'-cyclic-nucleotide phosphodiesterase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 366..386
NoneNo IPR availablePANTHERPTHR11347CYCLIC NUCLEOTIDE PHOSPHODIESTERASEcoord: 328..885
NoneNo IPR availablePANTHERPTHR11347:SF102PHOSPHODIESTERASEcoord: 328..885
NoneNo IPR availableSUPERFAMILYSSF109604HD-domain/PDEase-likecoord: 577..882
NoneNo IPR availableSUPERFAMILYSSF55781GAF domain-likecoord: 353..553
NoneNo IPR availableSUPERFAMILYSSF55781GAF domain-likecoord: 181..364
IPR0230883'5'-cyclic nucleotide phosphodiesterasePRINTSPR00387PDIESTERASE1coord: 799..815
score: 53.18
coord: 629..642
score: 51.71
coord: 782..795
score: 48.86
coord: 660..673
score: 32.71
coord: 702..718
score: 45.06
coord: 674..689
score: 58.5
IPR003018GAF domainSMARTSM00065gaf_1coord: 195..346
e-value: 0.37
score: 3.2
coord: 368..536
e-value: 2.4E-31
score: 120.2
IPR003018GAF domainPFAMPF01590GAFcoord: 369..520
e-value: 3.0E-15
score: 57.0
IPR003607HD/PDEase domainSMARTSM00471hd_13coord: 631..800
e-value: 8.2E-10
score: 48.6
IPR003607HD/PDEase domainCDDcd00077HDccoord: 633..809
e-value: 4.17995E-20
score: 85.4688
IPR029016GAF-like domain superfamilyGENE3DG3DSA:3.30.450.40coord: 172..345
e-value: 1.1E-15
score: 59.4
IPR029016GAF-like domain superfamilyGENE3DG3DSA:3.30.450.40coord: 346..527
e-value: 1.4E-54
score: 185.9
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPFAMPF00233PDEase_Icoord: 633..859
e-value: 2.0E-73
score: 247.0
IPR0020733'5'-cyclic nucleotide phosphodiesterase, catalytic domainPROSITEPS51845PDEASE_I_2coord: 536..881
score: 108.577
IPR0369713'5'-cyclic nucleotide phosphodiesterase, catalytic domain superfamilyGENE3DG3DSA:1.10.1300.10coord: 555..895
e-value: 5.8E-112
score: 375.8
IPR0231743'5'-cyclic nucleotide phosphodiesterase, conserved sitePROSITEPS00126PDEASE_I_1coord: 674..685