Guanylate cyclase

Overview
NameGuanylate cyclase
Smed IDSMED30000341
Length (bp)2836
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanylate cyclase (SMED30000341) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30000341) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase (SMED30000341) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30000341) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000341

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000341SMESG000054505.1 dd_Smed_v4_59367_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000341SMESG000054505.1 dd_Smed_v4_59367_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000341SMESG000054505.1 dd_Smed_v4_59367_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000341SMESG000054505.1 dd_Smed_v6_59367_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 269.626 bits (688), Expect = 2.927e-93
Identity = 132/267 (49.44%), Postives = 188/267 (70.41%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RP F  IR +++  N    S +LD+++  ++ Y  NLE++V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD++++  DVYKVETIGDAY V SG+P RNG  H  E+   +L ++++VR+ +RI H   +Q+ +RIGIHTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S +   ++ E+  +    RG +E+KGKG   TY+L G R 
Sbjct:  791 RPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRS-FRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERG 1056          

HSP 2 Score: 94.7449 bits (234), Expect = 2.927e-93
Identity = 85/323 (26.32%), Postives = 149/323 (46.13%), Query Frame = 1
Query: 1066 ALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLN--------LSNDDKNVEILFKS--FENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISS 2001
            +L ++ + I++ FI   Y   + +K++ + +W++ +E ++ ++   +L    SR+TL+        L   +   ++  K+  ++ N V +   N    R   + K    L   R + + ++  F G       + ++TE C +G+L  IL N  +TL    ++SL  DIV GM +LH   I  HG+L S NC +D ++ +KI D+  GL           +S R                 + D E   ++   + W APE++ + +     +   DVYSFGIIL EI +R   F  E    S  E +IE++   +  PF  S
Sbjct:  480 SLSLLGILIVSFFI---YRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYKGNLVAVKRVNR--KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDY--GL-----------ESFR-----------------DLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKE-IIERVTRGEQPPFRPS 766          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 262.692 bits (670), Expect = 2.611e-89
Identity = 132/266 (49.62%), Postives = 183/266 (68.80%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLAN-PSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP F  I+  I+  N     S+LD+++  ++ Y  NLE +V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG +H  EI   +L ++++V + +RI H    Q+ +RIG+HTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S      ++E   +    RG +E+KGKG   TY+L G R
Sbjct:  776 RPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSS-FRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGER 1040          

HSP 2 Score: 88.5817 bits (218), Expect = 2.611e-89
Identity = 92/349 (26.36%), Postives = 153/349 (43.84%), Query Frame = 1
Query: 1006 DNQKFNEILSSNTTDKILKIALPIVSMFIIALFIFVG---YVFYKQ---QKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEIL----FKSFENNNVFMTNT----NLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSM 2007
            DN      L   + DK     L IV++     FI  G   ++ +++   +K++ + +W+I +E+L    S        SR+TL+L        +     ++ F N   F  N     ++   R   + +    L   R +  +++  F G       + ++TE C +G+L  IL N  + L    ++SL  D+V GM +LH   I  HG L S NC +D ++ +KI D+  GL            S R+   P              DS AL +    + W APE++       +   K DVYSFGIIL EI +R  PF  E    S  E +++++ + + +P+   S+
Sbjct:  435 DNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDY--GL-----------ASFRSTAEPD-------------DSHALYA---KKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKE-IVQKVRNGQ-RPYFRPSI 752          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2D (guanylate cyclase 2D, retinal [Source:HGNC Symbol;Acc:HGNC:4689])

HSP 1 Score: 251.906 bits (642), Expect = 2.333e-80
Identity = 128/250 (51.20%), Postives = 177/250 (70.80%), Query Frame = 2
Query: 2066 KKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDK-QIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            K +++DSM+  L+ Y  NLED+++ RT+E+E  ++K   LL QMLP SV + L    PV PEY+E V+LYFSDIVGFT+IS+   P++VVD+LN LY+LFD+I+  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ +V   +R+ H  +  + +RIG+H+G  VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  +     ++   +  Y    RG+ E+KGKG++ T++L GRR 
Sbjct:  813 KTNIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLPPSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAV-GTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGRRG 1061          

HSP 2 Score: 69.3218 bits (168), Expect = 2.333e-80
Identity = 68/290 (23.45%), Postives = 124/290 (42.76%), Query Frame = 1
Query: 1186 TNTSRSNL-LRTMSRVTLNLSN--DDKNVEILFKSFENNNV----FMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITF-----HDERLW-----LITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKK--LQPFIS 1998
               SRS+L  R+MS +    S   D  N+ +    +E + V    F  + ++ +  A      +   +K + L H N+  + G+           LW     +++E+C++G+L  +L    + L    K SL  D++ G+ YLH + + HG L S NC +D ++ +KI D   G L +A K+            P  +++++                    W APE++          L  DV+S  II+ E+  R  P+        + E+V++++ S     +P +S
Sbjct:  524 AQGSRSSLGARSMSDIRSGPSQHLDSPNIGV----YEGDRVWLKKFPGDQHIAIRPAT-----KTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDLLAQREIKLDWMFKSSLLLDLIKGIRYLHHRGVAHGRLKSRNCIVDGRFVLKITDHGHGRLLEAQKVLP---------EPPRAEDQL--------------------WTAPELLRDPALERRGTLAGDVFSLAIIMQEVVCRSAPY---AMLELTPEEVVQRVRSPPPLCRPLVS 772          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2C (guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:4688])

HSP 1 Score: 232.261 bits (591), Expect = 1.676e-73
Identity = 122/271 (45.02%), Postives = 173/271 (63.84%), Query Frame = 2
Query: 2015 RPTFSSIRKSIK-----LANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYN-KYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP F  I  ++        +   +S +D++I  L  Y  NLE +V+ RT+  +  + +   L + +LP  VV  L +K  V PE YE V++YFSDIVGFT+I    TPM+VVDMLN +Y  FD IV+ +DVYKVETIGDAY V+SG+P RNG +H I+I + +L I+ S    + + H     I +RIG+H+G   AGVVG KMPR+CLFGDTVNTASRMESTG+ ++I  S     ++     ++ +  RG+  +KG+G++TTY+L G +
Sbjct:  735 RPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEIL-SFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMK 1004          

HSP 2 Score: 66.2402 bits (160), Expect = 1.676e-73
Identity = 66/232 (28.45%), Postives = 95/232 (40.95%), Query Frame = 1
Query: 1333 ANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNS-----GVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANL--KTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQI----ASKKLQPF 1992
             NF+ K +  LNK   +++ N+  F G    D  ++ + E C +G+L  +L+++     G  +    K S+  DI  GM YLH  +  +HG L S NC +D +  VKI D+                            N I P   +              W APE      +L  AN+  K DVYS+GII  EI       R E F   S  D  E+I     S  ++PF
Sbjct:  523 GNFTEKQKIELNKLLQIDYYNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKGMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGC--------------------------NSILPPKKD-------------LWTAPE------HLRQANISQKGDVYSYGIIAQEII-----LRKETFYTLSCRDRNEKIFRVENSNGMKPF 704          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:HGNC Symbol;Acc:HGNC:4691])

HSP 1 Score: 263.077 bits (671), Expect = 5.661e-73
Identity = 137/268 (51.12%), Postives = 186/268 (69.40%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDK-QIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQAS-EKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RPTF  I    K  N  KK+ ++DSM+  L+ Y  NLED+++ RT+E+E  ++K + LL QMLP SV + L K   V PE ++ V+LYFSDIVGFT+IS+   P++VVD+LN LY+LFD+I+  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ SV   +++ H  +  + +RIG+H+G VVAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  S     IL N    Y    RG+ E+KGKG++ T++L G++ 
Sbjct:  799 RPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSV-GTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWLIGKKG 1065          

HSP 2 Score: 72.0182 bits (175), Expect = 4.251e-12
Identity = 48/157 (30.57%), Postives = 78/157 (49.68%), Query Frame = 1
Query: 1183 DTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRAT--LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADW 1647
            +  + RS  L   S      + ++ N+ I    +E + V++   +LG      S K RA+      + L H NI    G  +      ++TE CS+G+L  IL N  V L    K SL  D++ GM+YLH ++ +HG L S NC +D ++ +K+ D+
Sbjct:  537 EVQSGRSPRLSFSSGSLTPATYENSNIAI----YEGDWVWLKKFSLGDFGDLKSIKSRASDVFEMMKDLRHENINPLLGFFYDSGMFAIVTEFCSRGSLEDILTNQDVKLDWMFKSSLLLDLIKGMKYLHHREFVHGRLKSRNCVVDGRFVLKVTDY 689          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-9 (Receptor-type guanylate cyclase gcy-9 [Source:UniProtKB/Swiss-Prot;Acc:E7EAU8])

HSP 1 Score: 248.825 bits (634), Expect = 8.478e-79
Identity = 130/267 (48.69%), Postives = 177/267 (66.29%), Query Frame = 2
Query: 2015 RPTFSSIRKSIK--LANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIA-VRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILIN-EYNKYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RP    +R  +   L +  K S++D M+  ++ Y  NLE+MV+ RT  +E++QK+   LL  MLP S+ + L   +PV+P+ Y   ++ FSDI GFT ISS  TP+QVV  LN ++S FD+I+ K+D YKVETIGDAY + SGVP  NG  H   I + +L +   + N +++ H  +++  VRIG H+G V AGVVG   PR+CLFGDTVNTASRMESTGVA KIQ SE AY L++  + ++    RG+IEVKGKG   TY+LEGR
Sbjct:  812 RPPIKKVRTMVNANLKSTGKGSLVDQMMKMMEEYTANLENMVRDRTALLEEAQKQADRLLNSMLPKSIAEDLKIGKPVLPQLYSCATVLFSDIRGFTRISSTSTPLQVVTFLNDMFSGFDAIIAKHDAYKVETIGDAYMIVSGVPTENGNSHAQNIADVALKMRAFICN-FKLAHRPEELMMVRIGFHSGPVAAGVVGLAAPRYCLFGDTVNTASRMESTGVANKIQISEGAYNLLHCFFPQFQMVERGKIEVKGKGECLTYYLEGR 1077          

HSP 2 Score: 65.855 bits (159), Expect = 8.478e-79
Identity = 58/213 (27.23%), Postives = 104/213 (48.83%), Query Frame = 1
Query: 1363 LNKYRALNHSNICNFAGITFHDER----LWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNP-QNSKNKIEPISNNYDSEALKSLNRHRFW-QAPEIIH---LENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIA 1971
            L + +   + N+  F GI+F+ +     +W++   CS+G+L  IL N  + L  + + S A D+V G+ +LH   ++ HG L   NC +D  W VK+ ++       AT+  +  K   N   P  N+ ++    S +  S+  K   R ++  QAPEII        +   +   D+Y+ G++L +I  R  PF +   +  S+  ++E +A
Sbjct:  576 LKELKICENDNLNKFYGISFNQQNEFIVMWVL---CSRGSLEDILFNDELKLGRNFQVSFAKDVVKGLNFLHTSPLLHHGMLCLQNCLVDSNWTVKLTNF-------ATEAVIFEKLDHNELRPFINTDSE----SADDVSDPTKDFARKKYLQQAPEIIREIVTTKTIPEGSQSADIYALGMVLYQILFRVEPFHE---RNKSINKLMETLA 771          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-21 (Receptor-type guanylate cyclase gcy-21 [Source:UniProtKB/Swiss-Prot;Acc:O16715])

HSP 1 Score: 218.394 bits (555), Expect = 2.491e-73
Identity = 111/267 (41.57%), Postives = 171/267 (64.04%), Query Frame = 2
Query: 2015 RPTFSSIRKSIK-LANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RP+   I++ +K L    K++++D+M+  ++ Y   LE  +  R +E+E  + K + LL  MLP  V D L     V  E +E+ +++FSD  GF  +S+   P+ +V  LN LY++FD I+++ DVYKVETI DAY V+SG+P  NG  H  EI    L ++++V + ++I H  ++++ +RIG+++G  VAGVVG KMPR+CLFGDTVNTASRMES G+ ++I  S  A  ++++   Y    RG +E+KGKG Q TYF+ G  +
Sbjct:  755 RPSLHQIKRKLKPLTIGLKRTIMDNMVSMIEKYTDKLEKDIAERNEELEGEKAKSEALLKMMLPEVVADSLKLGSNVSAESFENCTVFFSDCPGFVEMSATSKPIDIVQFLNDLYTVFDRIIDQFDVYKVETIADAYMVASGLPVPNGNHHAGEIASLGLALLKAVES-FKIRHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRINCSGTAKEILDQLGGYEIEERGIVEMKGKGKQMTYFVRGENS 1020          

HSP 2 Score: 78.5666 bits (192), Expect = 2.491e-73
Identity = 57/227 (25.11%), Postives = 102/227 (44.93%), Query Frame = 1
Query: 1327 SRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANL----KTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPF 1992
            S   F+   R  + K +   +SN+  F G+      ++++ E   +G+L  IL N  + L D  +  +  DI++G+EYLH   I  HG L S NC +D +W V+++ +  GL           + +R     Q   +  E               + + W +PE++     L    +    K+DVYS  I+L E++ R  P+ DE  +   +  ++++ A    +PF
Sbjct:  527 SDVEFTRSIRLEIAKLQESVNSNVIEFVGMVVQSPDVFVVYELAQRGSLKDILDNDDMPLDDVFRSQMTKDIIAGLEYLHSSPIGCHGRLKSTNCLIDARWMVRLSSF--GL-----------RELRGEETWQQEDDVQE--------------GKDQLWTSPELLRWSTGLSQCGVLLVQKSDVYSLAIVLYELFGRLGPWGDEPMEPREIVSLVKREALAGKKPF 726          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-18 (Receptor-type guanylate cyclase gcy-18 [Source:UniProtKB/Swiss-Prot;Acc:G5EFQ0])

HSP 1 Score: 228.409 bits (581), Expect = 3.091e-73
Identity = 119/265 (44.91%), Postives = 170/265 (64.15%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RP+   +R + ++   +K S++D M+  ++ Y  NLE +V  RT  +E++  +   LL Q+LPA V ++L     V P+ Y S ++ FSDIVGFT+I S  TP++VV+MLN LY+ FD  + +N  YKVETIGDAY V SG+P  N   H   I   +L + + +   Y+IPH    ++  R G HTGSV AGVVG   PR+CLFGDTVN +SRMESTG    IQ SE+A++ I  ++  +T T RG+++VKGKG+  T++LE R
Sbjct:  834 RPSIRRVRLNTEMVLKTKGSLVDQMMKMMEQYANNLEKLVAERTGMLEEANIRADQLLTQLLPAYVANELKMGRSVAPKLYSSATILFSDIVGFTTICSGSTPLEVVNMLNGLYTGFDECITRNKSYKVETIGDAYMVVSGIPEENEYNHSRNIANTALDMRQYLTG-YQIPHRPTHRVRCRWGFHTGSVAAGVVGLTCPRYCLFGDTVNVSSRMESTGTPGMIQMSEEAHMHIRAHHPVFTTTERGEVQVKGKGTCRTFWLEDR 1097          

HSP 2 Score: 67.781 bits (164), Expect = 3.091e-73
Identity = 60/236 (25.42%), Postives = 112/236 (47.46%), Query Frame = 1
Query: 1363 LNKYRALNHSNICNFAGITFHD-ERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPI----SNNYDSEALKSLNRHRFWQAPEIIH----------LENYLESANLK---TDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIA--SKKLQPFISSSM 2007
            L + +   H N+  F G  F++ E + ++ + CS+G +  I++N+ V L +    +   DI  G+EYLH   I  HG L+   C +D+ W VK++D+ I                    NP     K   I    + + D ++  S      + APE++            +++++ + L+    D+YSFG+++ EI  R +PFRD     +++ ++++ +A  SK + P I + M
Sbjct:  601 LTQMKQAVHDNLNPFLGAAFNEKEEMLVLWKFCSRGTIQDIIYNANVVLDEKFHGAFVRDITLGLEYLHASPIGYHGSLTPWCCLIDRNWMVKLSDYGIA-------------------NPLERWEKQGAIEIAAAKDSDDKSQASQATSIIYMAPELLKNRETNKRRGMDQSWVKQSMLRRQAGDIYSFGMVMYEILFRSLPFRDN----TNISELVDYLADGSKTVSPEIQNQM 813          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-11 (Receptor-type guanylate cyclase gcy-11 [Source:UniProtKB/Swiss-Prot;Acc:Q18331])

HSP 1 Score: 233.802 bits (595), Expect = 1.893e-71
Identity = 122/262 (46.56%), Postives = 181/262 (69.08%), Query Frame = 2
Query: 2015 RPTFSSIRKSIK-LANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFL 2794
            RP+   +R+ +K L+   K ++ D++++ LD Y  NLED+++ RT+++E  +K+ ++LL Q+LP SV + L   +PV  E+Y+SVS+YFSDIVGFT++SS+ TP+QVV+MLN LY+ FD+I++K D YKVETIGDAY   SG+P  N   H  E+   SL +++S++  + + H  D+++ +RIG HTG VV GVVG +MPR+CLFGDTV  A+ MES+G  M+IQ S  AY LI +   Y    R +I +K K    TY++
Sbjct:  911 RPSIKKVRELLKPLSKGLKGNIADNIMNLLDRYRNNLEDVIKERTEQLEDERKRNESLLLQLLPKSVANSLKNGQPVDAEFYDSVSIYFSDIVGFTALSSKSTPLQVVNMLNNLYTNFDTIIDKFDCYKVETIGDAYMFVSGLPEVNSYLHAGEVASASLELLDSIKT-FTVSHCPDEKLRLRIGNHTGPVVTGVVGIRMPRYCLFGDTVIIANMMESSGEPMRIQISSDAYELILKCGGYVTEQREKIVLKNKLEVMTYWM 1171          

HSP 2 Score: 56.9954 bits (136), Expect = 1.893e-71
Identity = 57/202 (28.22%), Postives = 92/202 (45.54%), Query Frame = 1
Query: 1387 HSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII--HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEII------HLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQI 1968
            H N+  F G+    + ++ I     + +L  +L N  + L    K S   D+V G+++LH    I  HG+L S NC +D  W +K++++ +       +I+V                  EP S   D            W APEII      H  + LE A  K D+YS  I+L EI+ R+ PF D++  +   +++IEQ+
Sbjct:  710 HENLNRFFGLINESDLIFTIHSYGPRKSLMDLLRNDDLRLDRMFKVSFVEDVVKGLQFLHEGSKIGYHGNLKSSNCIVDAYWRIKLSNYGM------EQIRVE-----------------EPESKPDD----------LLWFAPEIIRRYAVKHDLSKLELA--KADIYSLAIVLYEIYGRQGPFGDDLLDS---DEIIEQL 873          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 258.07 bits (658), Expect = 2.225e-71
Identity = 129/266 (48.50%), Postives = 185/266 (69.55%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS--VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRN--IYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP  SS+RK+++  N   ++  ++D+++  ++ Y  NLE +V+ RT+E    +KK++ LL+Q+LP ++ D L     V  E Y+ V++YFSDIVGFTS+SS+ TPMQVV +LN LY  FD +V+   VYKVETIGDAY V SG+P R    H  +I + SL ++  V+N  I   PH  +Q+ +RIG+H+GSVVAGVVG+KMPR+CLFGDTVNT+SRMES G+ +KI  S++ Y ++ +   +    RG +E+KGKG QTTY+L G
Sbjct:  941 RPEVSSVRKAVRSLNRDNETSNLVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLIAGRAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRD-DHANQIAQMSLSLLHKVKNFVIRHRPH--EQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWLRG 1203          

HSP 2 Score: 75.0998 bits (183), Expect = 1.787e-13
Identity = 53/188 (28.19%), Postives = 79/188 (42.02%), Query Frame = 1
Query: 1318 LGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFG 1878
            L LSRA         L K + L H +I  F G         ++TE C KG+L  IL N  + L   +K+SL  D+V G+ +LH  +I  HG L S NC +D ++ +K+ D+ +  L    +I                         N +     +  +   W APE++   N       K D+YSF 
Sbjct:  709 LDLSRAQL-----MELKKMKDLQHDHITRFTGACIDFPHYCVVTEYCPKGSLEDILENEKIELDKLMKYSLLHDLVKGLFFLHNSEIRSHGRLKSSNCVVDSRFVLKVTDFGLHRLHCLEEI-------------------------NLEEIGEHAYYKKMLWTAPELLRDSNAPPMGTQKGDIYSFA 866          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG42637 (gene:FBgn0261360 transcript:FBtr0302277)

HSP 1 Score: 249.595 bits (636), Expect = 3.883e-86
Identity = 130/265 (49.06%), Postives = 184/265 (69.43%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSK-KSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEY-NKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP FS IR  +K     K K+++D M++ ++ Y  NLED+V  RT+ + + + K ++LL++MLP SV +KLT  + V P  Y+ V++YFSDIVGFT++S+E TP+QVV+ LN LY++FD I+   DVYKVETIGDAY V SG+P +NG +H  EI   +L ++ +V+  +RI H  ++ + +RIG+HTG VVAGVVG  MPR+CLFGDTVNTASRMES G A+KI  S K  + +++    Y    RG + +KGKG   T++L G
Sbjct:  811 RPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQ-HRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTG 1074          

HSP 2 Score: 90.1225 bits (222), Expect = 3.883e-86
Identity = 62/207 (29.95%), Postives = 107/207 (51.69%), Query Frame = 1
Query: 1375 RALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPF 1992
            R L H NI +F G +    R+ L+T+ C+KG+LY I+ N  + L D    SL  D++ GM Y+H  Q++ HG+L S NC +  +W +++ D+ +  L +  + + +       G  Q+ +N++                    W+APE+  L N++  +  K DVY+F II+ EI+ R+ PF    F+   + D ++++  K   PF
Sbjct:  603 RELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESI-------GEHQHYRNQL--------------------WRAPEL--LRNHIHGSQ-KGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKGEDPF 779          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG42637 (gene:FBgn0261360 transcript:FBtr0302279)

HSP 1 Score: 249.595 bits (636), Expect = 3.883e-86
Identity = 130/265 (49.06%), Postives = 184/265 (69.43%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSK-KSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEY-NKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP FS IR  +K     K K+++D M++ ++ Y  NLED+V  RT+ + + + K ++LL++MLP SV +KLT  + V P  Y+ V++YFSDIVGFT++S+E TP+QVV+ LN LY++FD I+   DVYKVETIGDAY V SG+P +NG +H  EI   +L ++ +V+  +RI H  ++ + +RIG+HTG VVAGVVG  MPR+CLFGDTVNTASRMES G A+KI  S K  + +++    Y    RG + +KGKG   T++L G
Sbjct:  811 RPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQ-HRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTG 1074          

HSP 2 Score: 90.1225 bits (222), Expect = 3.883e-86
Identity = 62/207 (29.95%), Postives = 107/207 (51.69%), Query Frame = 1
Query: 1375 RALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPF 1992
            R L H NI +F G +    R+ L+T+ C+KG+LY I+ N  + L D    SL  D++ GM Y+H  Q++ HG+L S NC +  +W +++ D+ +  L +  + + +       G  Q+ +N++                    W+APE+  L N++  +  K DVY+F II+ EI+ R+ PF    F+   + D ++++  K   PF
Sbjct:  603 RELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESI-------GEHQHYRNQL--------------------WRAPEL--LRNHIHGSQ-KGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKGEDPF 779          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG42637 (gene:FBgn0261360 transcript:FBtr0302278)

HSP 1 Score: 249.595 bits (636), Expect = 3.883e-86
Identity = 130/265 (49.06%), Postives = 184/265 (69.43%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSK-KSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEY-NKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP FS IR  +K     K K+++D M++ ++ Y  NLED+V  RT+ + + + K ++LL++MLP SV +KLT  + V P  Y+ V++YFSDIVGFT++S+E TP+QVV+ LN LY++FD I+   DVYKVETIGDAY V SG+P +NG +H  EI   +L ++ +V+  +RI H  ++ + +RIG+HTG VVAGVVG  MPR+CLFGDTVNTASRMES G A+KI  S K  + +++    Y    RG + +KGKG   T++L G
Sbjct:  811 RPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQ-HRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTG 1074          

HSP 2 Score: 90.1225 bits (222), Expect = 3.883e-86
Identity = 62/207 (29.95%), Postives = 107/207 (51.69%), Query Frame = 1
Query: 1375 RALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPF 1992
            R L H NI +F G +    R+ L+T+ C+KG+LY I+ N  + L D    SL  D++ GM Y+H  Q++ HG+L S NC +  +W +++ D+ +  L +  + + +       G  Q+ +N++                    W+APE+  L N++  +  K DVY+F II+ EI+ R+ PF    F+   + D ++++  K   PF
Sbjct:  603 RELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESI-------GEHQHYRNQL--------------------WRAPEL--LRNHIHGSQ-KGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKGEDPF 779          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: Gyc76C (gene:FBgn0266136 transcript:FBtr0333879)

HSP 1 Score: 249.595 bits (636), Expect = 3.883e-86
Identity = 130/265 (49.06%), Postives = 184/265 (69.43%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSK-KSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEY-NKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP FS IR  +K     K K+++D M++ ++ Y  NLED+V  RT+ + + + K ++LL++MLP SV +KLT  + V P  Y+ V++YFSDIVGFT++S+E TP+QVV+ LN LY++FD I+   DVYKVETIGDAY V SG+P +NG +H  EI   +L ++ +V+  +RI H  ++ + +RIG+HTG VVAGVVG  MPR+CLFGDTVNTASRMES G A+KI  S K  + +++    Y    RG + +KGKG   T++L G
Sbjct:  811 RPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQ-HRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTG 1074          

HSP 2 Score: 90.1225 bits (222), Expect = 3.883e-86
Identity = 62/207 (29.95%), Postives = 107/207 (51.69%), Query Frame = 1
Query: 1375 RALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPF 1992
            R L H NI +F G +    R+ L+T+ C+KG+LY I+ N  + L D    SL  D++ GM Y+H  Q++ HG+L S NC +  +W +++ D+ +  L +  + + +       G  Q+ +N++                    W+APE+  L N++  +  K DVY+F II+ EI+ R+ PF    F+   + D ++++  K   PF
Sbjct:  603 RELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESI-------GEHQHYRNQL--------------------WRAPEL--LRNHIHGSQ-KGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKGEDPF 779          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: Gyc76C (gene:FBgn0266136 transcript:FBtr0302282)

HSP 1 Score: 249.595 bits (636), Expect = 3.883e-86
Identity = 130/265 (49.06%), Postives = 184/265 (69.43%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSK-KSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEY-NKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP FS IR  +K     K K+++D M++ ++ Y  NLED+V  RT+ + + + K ++LL++MLP SV +KLT  + V P  Y+ V++YFSDIVGFT++S+E TP+QVV+ LN LY++FD I+   DVYKVETIGDAY V SG+P +NG +H  EI   +L ++ +V+  +RI H  ++ + +RIG+HTG VVAGVVG  MPR+CLFGDTVNTASRMES G A+KI  S K  + +++    Y    RG + +KGKG   T++L G
Sbjct:  811 RPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQ-HRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTG 1074          

HSP 2 Score: 90.1225 bits (222), Expect = 3.883e-86
Identity = 62/207 (29.95%), Postives = 107/207 (51.69%), Query Frame = 1
Query: 1375 RALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPF 1992
            R L H NI +F G +    R+ L+T+ C+KG+LY I+ N  + L D    SL  D++ GM Y+H  Q++ HG+L S NC +  +W +++ D+ +  L +  + + +       G  Q+ +N++                    W+APE+  L N++  +  K DVY+F II+ EI+ R+ PF    F+   + D ++++  K   PF
Sbjct:  603 RELRHDNINSFIGASVEPTRILLVTDYCAKGSLYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQLVYHGNLKSSNCVVTSRWMLQVTDFGLHELRQCAENESI-------GEHQHYRNQL--------------------WRAPEL--LRNHIHGSQ-KGDVYAFAIIMYEIFSRKGPFGQINFEPKEIVDYVKKLPLKGEDPF 779          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: si:dkey-37g12.1 (si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-145])

HSP 1 Score: 259.61 bits (662), Expect = 2.398e-89
Identity = 130/265 (49.06%), Postives = 183/265 (69.06%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPS--KKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP FS IR +IK  +P    +++LD ++  ++ Y  NLE++V  RT E+++ +K+ + LL QMLP SV  +L   + V  E Y+ V++YFSDI GFT++S+  TPMQVV++LN LY+ FD+I++ ++VYKVETIGDAY V SG+P RNG  H  EI   SL IV+ +R+ +  PH  ++Q+ VRIG+H+G  VAGVVG KMPR+CLFGDTVNTASRMES G+ +KI  S     L++ +  +    RG I +KGKG   T++L G
Sbjct:  762 RPDFSYIRTAIKKNSPHGVSENILDDLLSRMEQYACNLEEIVSERTAELQEEKKRAEGLLTQMLPRSVASQLIAGKTVRAETYDCVTIYFSDIEGFTAMSASLTPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMSLAIVQGLRSFHS-PHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYGLPLKIHVSSSTKSLLDTFRNFRCELRGDIHIKGKGWVRTFWLLG 1025          

HSP 2 Score: 91.6633 bits (226), Expect = 2.398e-89
Identity = 63/216 (29.17%), Postives = 98/216 (45.37%), Query Frame = 1
Query: 1357 ATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPF--RDEIFKASSVEDVIEQIASKKLQPFI 1995
            A L ++R L H N+C F G      + +++TE C KG+L  IL N  + L  + KFSL  DIV GM+YLH   +  HGHLSS +C +D ++ +K+ D      F    ++ L        +P  +                        W+APE++  ++   +   K DVYSF II  E+  R  PF   +  F    + + +        +P+I
Sbjct:  552 AELKQFRDLTHYNLCKFIGAALETSQPFILTEYCPKGSLQDILQNESIKLDWTFKFSLMLDIVKGMDYLHHSPLQYHGHLSSSSCVVDSRFVLKVTD------FGLNSVRRLDTEQSPGSDPWTA----------------------LLWRAPELLR-QSIPANGTQKGDVYSFAIIAQEVVYRRGPFYIPNSHFSPREIVERVRAGGCSPSRPYI 738          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr2 (natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZDB-GENE-141030-2])

HSP 1 Score: 258.84 bits (660), Expect = 5.322e-89
Identity = 132/265 (49.81%), Postives = 183/265 (69.06%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP FS I+  I   N  +      ++  ++ Y  NLE++V+ RT+   + ++K +NLLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFTS+S+E TP+QVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG  H  EI   SL ++E V+  ++I H  + Q+ +RIGIHTG V AGVVG KMPR+CLFGDTVNTASRMESTG A++I  S     +++E+  +    RG +E+KGKG   TY+L G +
Sbjct:  783 RPDFSHIKVFIAKFN-KQHQYSQYLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIAGMSLALLEQVKT-FKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALRIHMSSATKEVLDEFGYFELQLRGDVEMKGKGKMRTYWLLGEK 1045          

HSP 2 Score: 91.2781 bits (225), Expect = 5.322e-89
Identity = 83/306 (27.12%), Postives = 136/306 (44.44%), Query Frame = 1
Query: 1078 VSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEIL----FKSFENNNVFMTN----TNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQI 1968
            +++ I  +  F+ Y   K +K++   +W+I +E+L   +      R  SR+TL+         I     ++ F     F  N     ++   R   + +    L   R +  +++  F G       + ++TE C +G+L  IL N  + L    ++SL  DIV GM YLH   I  HG+L S NC +D ++ +KI D+ +              S R++               N DS AL +    + W APE++  + +      K DVYSFGIIL EI +R  PF  E    S  E +I+++
Sbjct:  472 LALIIFGISSFLIYRKLKLEKELAGMLWRIRWEELQFESPNKYHKRAGSRLTLSQRGSSYGSLITAHGKYQLFAKTGYFKGNLVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNYLHNSYIGSHGNLKSSNCVVDSRFVLKITDYGLA-------------SFRSS-------------CENEDSHALYA---KKLWTAPELLIYDRHPPQGTQKGDVYSFGIILQEIALRNGPFYVEGMDLSPKE-IIQKV 747          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 266.929 bits (681), Expect = 7.479e-89
Identity = 135/266 (50.75%), Postives = 185/266 (69.55%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYN-KYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RPTF  I +  K  N  KK+ ++DSM+  L+ Y  NLED+++ RT+E+E  ++K   LL QMLP SV   L   +PV PE++  V+LYFSDIVGFT+IS+   P++VVD+LN LY+ FD I+  +DVYKVETIGDAY V+SGVPNRNG +H  E+   SL I+  +   +++ H  D ++ +RIG+H+G VVAGVVG KMPR+CLFGDTVNTASRMESTG+  +I  ++    ++N     Y    RG+ E+KGKG + T++L GR
Sbjct:  827 RPTFEDIFRQFKSMNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHDVYKVETIGDAYMVASGVPNRNGTRHAAEMANMSLDILHCI-GTFKMRHMPDVKVKIRIGLHSGPVVAGVVGLKMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVDVLNSLKLGYKIDTRGRTELKGKGVEETFWLVGR 1091          

HSP 2 Score: 82.4185 bits (202), Expect = 7.479e-89
Identity = 71/276 (25.72%), Postives = 121/276 (43.84%), Query Frame = 1
Query: 1177 KLDTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKK--LQPFIS 1998
            +LD  T R ++     R  +  + +  NV +    FE + V++       S    S   +    K R + H N+  F G+        ++TE+C++G+L  +L+N  + L    K SL  D++ GM+YLH + IIHG L S NC +D ++ +K+ D+    +     I      +  +  P++                       +FW APEI+   +  +      DVYSF II+ E+  R  PF          E++IE++ S     +P +S
Sbjct:  568 QLDVKTPRHSV---SGRSYITSTPETSNVAV----FEGDWVWLKKCPCADSITEISESTQTIFVKLRDMRHENLNLFLGLFMDTGIFGIVTEHCTRGSLEDLLNNEEMRLDWMFKSSLLLDLIRGMKYLHNRGIIHGRLKSRNCVVDGRFVLKVTDYGFNEILNCQNI------ILEDNAPED-----------------------QFWTAPEILRNPDLKKKGTYPGDVYSFSIIMQEVISRCAPF---CMLDMPPEEIIEKVRSPPPLCRPTVS 804          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 266.929 bits (681), Expect = 7.993e-89
Identity = 135/266 (50.75%), Postives = 185/266 (69.55%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYN-KYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RPTF  I +  K  N  KK+ ++DSM+  L+ Y  NLED+++ RT+E+E  ++K   LL QMLP SV   L   +PV PE++  V+LYFSDIVGFT+IS+   P++VVD+LN LY+ FD I+  +DVYKVETIGDAY V+SGVPNRNG +H  E+   SL I+  +   +++ H  D ++ +RIG+H+G VVAGVVG KMPR+CLFGDTVNTASRMESTG+  +I  ++    ++N     Y    RG+ E+KGKG + T++L GR
Sbjct:  829 RPTFEDIFRQFKSMNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHDVYKVETIGDAYMVASGVPNRNGTRHAAEMANMSLDILHCI-GTFKMRHMPDVKVKIRIGLHSGPVVAGVVGLKMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVDVLNSLKLGYKIDTRGRTELKGKGVEETFWLVGR 1093          

HSP 2 Score: 82.4185 bits (202), Expect = 7.993e-89
Identity = 71/276 (25.72%), Postives = 121/276 (43.84%), Query Frame = 1
Query: 1177 KLDTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKK--LQPFIS 1998
            +LD  T R ++     R  +  + +  NV +    FE + V++       S    S   +    K R + H N+  F G+        ++TE+C++G+L  +L+N  + L    K SL  D++ GM+YLH + IIHG L S NC +D ++ +K+ D+    +     I      +  +  P++                       +FW APEI+   +  +      DVYSF II+ E+  R  PF          E++IE++ S     +P +S
Sbjct:  570 QLDVKTPRHSV---SGRSYITSTPETSNVAV----FEGDWVWLKKCPCADSITEISESTQTIFVKLRDMRHENLNLFLGLFMDTGIFGIVTEHCTRGSLEDLLNNEEMRLDWMFKSSLLLDLIRGMKYLHNRGIIHGRLKSRNCVVDGRFVLKVTDYGFNEILNCQNI------ILEDNAPED-----------------------QFWTAPEILRNPDLKKKGTYPGDVYSFSIIMQEVISRCAPF---CMLDMPPEEIIEKVRSPPPLCRPTVS 806          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: gucy2d (guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB-GENE-011128-9])

HSP 1 Score: 266.544 bits (680), Expect = 9.282e-89
Identity = 135/266 (50.75%), Postives = 185/266 (69.55%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYN-KYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RPTF  I +  K  N  KK+ ++DSM+  L+ Y  NLED+++ RT+E+E  ++K   LL QMLP SV   L   +PV PE++  V+LYFSDIVGFT+IS+   P++VVD+LN LY+ FD I+  +DVYKVETIGDAY V+SGVPNRNG +H  E+   SL I+  +   +++ H  D ++ +RIG+H+G VVAGVVG KMPR+CLFGDTVNTASRMESTG+  +I  ++    ++N     Y    RG+ E+KGKG + T++L GR
Sbjct:  814 RPTFEDIFRQFKSMNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHDVYKVETIGDAYMVASGVPNRNGTRHAAEMANMSLDILHCI-GTFKMRHMPDVKVKIRIGLHSGPVVAGVVGLKMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVDVLNSLKLGYKIDTRGRTELKGKGVEETFWLVGR 1078          

HSP 2 Score: 82.4185 bits (202), Expect = 9.282e-89
Identity = 71/276 (25.72%), Postives = 121/276 (43.84%), Query Frame = 1
Query: 1177 KLDTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKK--LQPFIS 1998
            +LD  T R ++     R  +  + +  NV +    FE + V++       S    S   +    K R + H N+  F G+        ++TE+C++G+L  +L+N  + L    K SL  D++ GM+YLH + IIHG L S NC +D ++ +K+ D+    +     I      +  +  P++                       +FW APEI+   +  +      DVYSF II+ E+  R  PF          E++IE++ S     +P +S
Sbjct:  555 QLDVKTPRHSV---SGRSYITSTPETSNVAV----FEGDWVWLKKCPCADSITEISESTQTIFVKLRDMRHENLNLFLGLFMDTGIFGIVTEHCTRGSLEDLLNNEEMRLDWMFKSSLLLDLIRGMKYLHNRGIIHGRLKSRNCVVDGRFVLKVTDYGFNEILNCQNI------ILEDNAPED-----------------------QFWTAPEILRNPDLKKKGTYPGDVYSFSIIMQEVISRCAPF---CMLDMPPEEIIEKVRSPPPLCRPTVS 791          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000002946.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 261.922 bits (668), Expect = 1.984e-87
Identity = 131/267 (49.06%), Postives = 182/267 (68.16%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYN-KYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RPTF  I    K  N  KK+ ++DSM+  L+ Y  NLED+++ RT+E+E  ++K + LL QMLP SV + L     V PEY++ V++YFSDIVGFT+IS+   P++VVD+LN LY+LFD+++  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ SV +       D  + +RIG+H+G  VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  ++    ++   N +Y    RG+ E+KGKG + T++L G+  
Sbjct:  799 RPTFDEIFDQFKTINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQKTEKLLSQMLPPSVAEALKTGGTVEPEYFDHVTIYFSDIVGFTTISALSEPIEVVDLLNDLYTLFDAVLCNHDVYKVETIGDAYMVASGLPKRNGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNERYKIELRGKTELKGKGVEETFWLVGKEG 1065          

HSP 2 Score: 83.1889 bits (204), Expect = 1.984e-87
Identity = 75/275 (27.27%), Postives = 124/275 (45.09%), Query Frame = 1
Query: 1195 SRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLW-LITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITP 2016
            S  +L R++S  +L  S++  +V I    +E + V++     G+          +TL K + L + N+  F G  F D  ++ ++TE+CS+G+L  +L N  V L    K SL  D++ GM YLH +   HG L S NC +D ++ +KI D      +   ++    KS R +  P+                         FW APE++  +        K DV+SF IIL E+ +R  P+        S E++I ++   K  P +    + P
Sbjct:  544 SLKSLTRSLSAKSLGASHETSSVAI----YEGDWVWLKKFEPGVYH-ELRQSTTSTLRKMKDLRNENVNPFLGF-FSDCGIFAIVTEHCSRGSLEDLLRNEDVKLDWMFKSSLLLDLIKGMRYLHHRDFSHGRLKSRNCVVDGRFVLKITD------YGYNEVVETQKSPRYSMPPE-----------------------ELFWTAPELLRDQALSRRGTFKGDVFSFAIILQEVVVRGPPY---CTSGLSAEEIIRKV---KKPPPLCRPAVAP 777          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000002882.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 261.922 bits (668), Expect = 2.102e-87
Identity = 131/267 (49.06%), Postives = 182/267 (68.16%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYN-KYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RPTF  I    K  N  KK+ ++DSM+  L+ Y  NLED+++ RT+E+E  ++K + LL QMLP SV + L     V PEY++ V++YFSDIVGFT+IS+   P++VVD+LN LY+LFD+++  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ SV +       D  + +RIG+H+G  VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  ++    ++   N +Y    RG+ E+KGKG + T++L G+  
Sbjct:  799 RPTFDEIFDQFKTINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQKTEKLLSQMLPPSVAEALKTGGTVEPEYFDHVTIYFSDIVGFTTISALSEPIEVVDLLNDLYTLFDAVLCNHDVYKVETIGDAYMVASGLPKRNGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNERYKIELRGKTELKGKGVEETFWLVGKEG 1065          

HSP 2 Score: 83.1889 bits (204), Expect = 2.102e-87
Identity = 75/275 (27.27%), Postives = 124/275 (45.09%), Query Frame = 1
Query: 1195 SRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLW-LITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITP 2016
            S  +L R++S  +L  S++  +V I    +E + V++     G+          +TL K + L + N+  F G  F D  ++ ++TE+CS+G+L  +L N  V L    K SL  D++ GM YLH +   HG L S NC +D ++ +KI D      +   ++    KS R +  P+                         FW APE++  +        K DV+SF IIL E+ +R  P+        S E++I ++   K  P +    + P
Sbjct:  544 SLKSLTRSLSAKSLGASHETSSVAI----YEGDWVWLKKFEPGVYH-ELRQSTTSTLRKMKDLRNENVNPFLGF-FSDCGIFAIVTEHCSRGSLEDLLRNEDVKLDWMFKSSLLLDLIKGMRYLHHRDFSHGRLKSRNCVVDGRFVLKITD------YGYNEVVETQKSPRYSMPPE-----------------------ELFWTAPELLRDQALSRRGTFKGDVFSFAIILQEVVVRGPPY---CTSGLSAEEIIRKV---KKPPPLCRPAVAP 777          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000002786.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 261.922 bits (668), Expect = 2.265e-87
Identity = 131/267 (49.06%), Postives = 182/267 (68.16%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYN-KYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RPTF  I    K  N  KK+ ++DSM+  L+ Y  NLED+++ RT+E+E  ++K + LL QMLP SV + L     V PEY++ V++YFSDIVGFT+IS+   P++VVD+LN LY+LFD+++  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ SV +       D  + +RIG+H+G  VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  ++    ++   N +Y    RG+ E+KGKG + T++L G+  
Sbjct:  799 RPTFDEIFDQFKTINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQKTEKLLSQMLPPSVAEALKTGGTVEPEYFDHVTIYFSDIVGFTTISALSEPIEVVDLLNDLYTLFDAVLCNHDVYKVETIGDAYMVASGLPKRNGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNERYKIELRGKTELKGKGVEETFWLVGKEG 1065          

HSP 2 Score: 83.1889 bits (204), Expect = 2.265e-87
Identity = 75/275 (27.27%), Postives = 124/275 (45.09%), Query Frame = 1
Query: 1195 SRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLW-LITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITP 2016
            S  +L R++S  +L  S++  +V I    +E + V++     G+          +TL K + L + N+  F G  F D  ++ ++TE+CS+G+L  +L N  V L    K SL  D++ GM YLH +   HG L S NC +D ++ +KI D      +   ++    KS R +  P+                         FW APE++  +        K DV+SF IIL E+ +R  P+        S E++I ++   K  P +    + P
Sbjct:  544 SLKSLTRSLSAKSLGASHETSSVAI----YEGDWVWLKKFEPGVYH-ELRQSTTSTLRKMKDLRNENVNPFLGF-FSDCGIFAIVTEHCSRGSLEDLLRNEDVKLDWMFKSSLLLDLIKGMRYLHHRDFSHGRLKSRNCVVDGRFVLKITD------YGYNEVVETQKSPRYSMPPE-----------------------ELFWTAPELLRDQALSRRGTFKGDVFSFAIILQEVVVRGPPY---CTSGLSAEEIIRKV---KKPPPLCRPAVAP 777          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:NCBI gene;Acc:100492820])

HSP 1 Score: 254.988 bits (650), Expect = 2.539e-86
Identity = 130/267 (48.69%), Postives = 180/267 (67.42%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RP+F  I    K  N  +K+ ++DSM+  L+ Y  NLED+++ RT+E+E  ++K + LL QMLP SV + L     V PE ++ V+LYFSDIVGFTSIS+   P++VVD+LN LY+LFD+++  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ SV +       D  + +RIG+H+G  VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  ++     +   N+ Y    RG+ E+KGKG + T++L G+  
Sbjct:  825 RPSFDEIFDQFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAEALKMGCTVEPEGFDEVTLYFSDIVGFTSISAMSEPIEVVDLLNDLYTLFDAVIGNHDVYKVETIGDAYMVASGLPKRNGNRHAAEIANMSLDILSSVGSFKMRHMPDVPVRIRIGLHSGPAVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVKTLRSLNEGYLLELRGRTELKGKGIEETFWLVGKEG 1091          

HSP 2 Score: 86.2705 bits (212), Expect = 2.539e-86
Identity = 75/283 (26.50%), Postives = 127/283 (44.88%), Query Frame = 1
Query: 1183 DTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFM---TNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLW-LITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASK-KLQPFISSSMITP 2016
            DT + +S +    ++  +  + ++ NV I    +E + V+M    + + G  +   S  F       + + H N+  F G  FHD  ++ ++TE CS+G+L  +L N  V L    K SL  D++ GM+YLH ++ +HG L S NC +D ++ +K+ D+    + +A +I            P       E                   W APE++         +   DVYSF +I+ E+ +R  PF        +VED  E+I  K K  P +   M++P
Sbjct:  566 DTRSMKSPMRSGSTQSLIPATYENSNVAI----YEGDWVWMKKFPSGDFGELKPGTSDVFETM----KDMRHENVNPFLGF-FHDCGVFAIVTEFCSRGSLEDLLRNQDVKLDWMFKSSLLLDLIKGMKYLHHRKFVHGRLKSRNCVVDGRFVLKVTDYGYNEVLEAQRI------------PHEEPTAYE-----------------LLWTAPELLRDPLSAVHGSFSGDVYSFSVIMQEVVVRGPPF-------CTVEDTAEEIIQKVKKPPPLCRPMVSP 803          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:NCBI gene;Acc:100492820])

HSP 1 Score: 254.988 bits (650), Expect = 2.900e-86
Identity = 130/267 (48.69%), Postives = 180/267 (67.42%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RP+F  I    K  N  +K+ ++DSM+  L+ Y  NLED+++ RT+E+E  ++K + LL QMLP SV + L     V PE ++ V+LYFSDIVGFTSIS+   P++VVD+LN LY+LFD+++  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ SV +       D  + +RIG+H+G  VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  ++     +   N+ Y    RG+ E+KGKG + T++L G+  
Sbjct:  798 RPSFDEIFDQFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELEIEKQKTEKLLTQMLPPSVAEALKMGCTVEPEGFDEVTLYFSDIVGFTSISAMSEPIEVVDLLNDLYTLFDAVIGNHDVYKVETIGDAYMVASGLPKRNGNRHAAEIANMSLDILSSVGSFKMRHMPDVPVRIRIGLHSGPAVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVKTLRSLNEGYLLELRGRTELKGKGIEETFWLVGKEG 1064          

HSP 2 Score: 86.2705 bits (212), Expect = 2.900e-86
Identity = 75/283 (26.50%), Postives = 127/283 (44.88%), Query Frame = 1
Query: 1183 DTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFM---TNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLW-LITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASK-KLQPFISSSMITP 2016
            DT + +S +    ++  +  + ++ NV I    +E + V+M    + + G  +   S  F       + + H N+  F G  FHD  ++ ++TE CS+G+L  +L N  V L    K SL  D++ GM+YLH ++ +HG L S NC +D ++ +K+ D+    + +A +I            P       E                   W APE++         +   DVYSF +I+ E+ +R  PF        +VED  E+I  K K  P +   M++P
Sbjct:  539 DTRSMKSPMRSGSTQSLIPATYENSNVAI----YEGDWVWMKKFPSGDFGELKPGTSDVFETM----KDMRHENVNPFLGF-FHDCGVFAIVTEFCSRGSLEDLLRNQDVKLDWMFKSSLLLDLIKGMKYLHHRKFVHGRLKSRNCVVDGRFVLKVTDYGYNEVLEAQRI------------PHEEPTAYE-----------------LLWTAPELLRDPLSAVHGSFSGDVYSFSVIMQEVVVRGPPF-------CTVEDTAEEIIQKVKKPPPLCRPMVSP 776          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr1 (natriuretic peptide receptor 1 [Source:MGI Symbol;Acc:MGI:97371])

HSP 1 Score: 269.24 bits (687), Expect = 5.385e-94
Identity = 131/267 (49.06%), Postives = 189/267 (70.79%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RP F  IR +++  N    S +LD+++  ++ Y  NLE++V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD++++  DVYKVETIGDAY V SG+P RNG  H  E+   +L ++++VR+ +RI H   +Q+ +RIGIHTG V AGVVG KMPR+CLFGDTVNTASRMES G A++I  S +   ++ E++ +    RG +E+KGKG   TY+L G R 
Sbjct:  787 RPPFQQIRLALRKFNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRS-FRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGERG 1052          

HSP 2 Score: 97.4413 bits (241), Expect = 5.385e-94
Identity = 90/323 (27.86%), Postives = 150/323 (46.44%), Query Frame = 1
Query: 1066 ALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLN--------LSNDDKNVEILFKS--FENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISS 2001
            +L +VS  I++ FI   Y   + +K++++ +W++ +E L  ++   +L    SR+TL+        L   +   ++  K+  ++ N V +   N    R   + K    L   R + + ++  F G       + ++TE C +G+L  IL N  +TL    ++SL  DIV GM +LH   I  HG+L S NC +D ++ +KI D+  GL           +S R+           EP       E   +L   + W APE++ + +     +   DVYSFGIIL EI +R   F  E    S  E +IE++   +  PF  S
Sbjct:  476 SLSLVSFLIVSFFI---YRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYKGNLVAVKRVNR--KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDY--GL-----------ESFRDP----------EP-------EQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKE-IIERVTRGEQPPFRPS 762          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 260.766 bits (665), Expect = 3.310e-89
Identity = 131/266 (49.25%), Postives = 183/266 (68.80%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANP-SKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP F  I+  I+  N     S+LD+++  ++ Y  NLE +V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG +H  EI   +L ++++V + +RI H    Q+ +RIG+HTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S      ++E   +    RG +E+KGKG   TY+L G +
Sbjct:  342 RPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSS-FRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQ 606          

HSP 2 Score: 89.7373 bits (221), Expect = 3.310e-89
Identity = 89/342 (26.02%), Postives = 155/342 (45.32%), Query Frame = 1
Query: 1042 TTDKILKIALPIVSMFIIAL-----FIFVG---YVFYKQ---QKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEIL----FKSFENNNVFMTNT----NLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSM 2007
            TT  ++K+A P+ ++ I+AL     FI  G   ++ +++   +K++ + +W+I +E+L    S        SR+TL+L        +     ++ F N   F  N     ++   R   + +    L   R +  +++  F G       + ++TE C +G+L  IL N  + L    ++SL  D+V GM +LH   I  HG L S NC +D ++ +KI D+ +              S R+   P              DS AL +    + W APE++       +   K DVYSF IIL EI +R  PF  E    S  E +++++ + + +P+   S+
Sbjct:    9 TTHPVIKVA-PLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSDRYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDYGLA-------------SFRSTAEPD-------------DSHALYA---KKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKE-IVQKVRNGQ-RPYFRPSI 318          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 261.151 bits (666), Expect = 2.908e-88
Identity = 131/266 (49.25%), Postives = 183/266 (68.80%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLAN-PSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDK-QIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP F  I+  I+  N     S+LD+++  ++ Y  NLE +V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG +H  EI   +L ++++V + +RI H    Q+ +RIG+HTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S      ++E   +    RG +E+KGKG   TY+L G +
Sbjct:  776 RPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSS-FRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQ 1040          

HSP 2 Score: 86.2705 bits (212), Expect = 2.908e-88
Identity = 91/350 (26.00%), Postives = 153/350 (43.71%), Query Frame = 1
Query: 1003 VDNQKFNEILSSNTTDKILKIALPIVSMFIIALFIFVG---YVFYKQ---QKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEIL----FKSFENNNVFMTNT----NLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSM 2007
            +DN      L   + DK     L IV++     FI  G   ++ +++   +K++ + +W+I +E+L    S        SR+TL+L        +     ++ F N   F  N     ++   R   + +    L   R +  +++  F G       + ++TE C +G+L  IL N  + L    ++SL  D+V GM +LH   I  HG L S NC +D ++ +KI D+  GL            S R+   P              DS AL +    + W APE++       +   K DVYSF IIL EI +R  PF  E    S  E +++++ + + +P+   S+
Sbjct:  434 LDNPPCAFDLDDPSCDKTPLSTLAIVALGTGVTFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSDRYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDY--GL-----------ASFRSTAEPD-------------DSHALYA---KKLWTAPELLSGNPLPTTGMQKADVYSFAIILQEIALRSGPFYLEGLDLSPKE-IVQKVRNGQ-RPYFRPSI 752          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2e (guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:105123])

HSP 1 Score: 261.536 bits (667), Expect = 1.988e-85
Identity = 131/262 (50.00%), Postives = 182/262 (69.47%), Query Frame = 2
Query: 2024 FSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDK-QIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGR 2803
            F SI K        K +++DSM+  L+ Y  NLED+++ RT+E+E+ ++K   LL QMLP SV + L     V PEY+E V+LYFSDIVGFT+IS+   P++VVD+LN LY+LFD+I+  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ +V + +R+ H  +  + +RIG+H+G  VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  +     ++   ++ +   CRG+ E+KGKG + TY+L GR
Sbjct:  808 FKSINKG------RKTNIIDSMLRMLEQYSSNLEDLIRERTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGS-FRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGR 1062          

HSP 2 Score: 76.6406 bits (187), Expect = 1.988e-85
Identity = 62/256 (24.22%), Postives = 114/256 (44.53%), Query Frame = 1
Query: 1309 NTNLGLSRANFSW--KF------------RATLNKYRALNHSNICNFAGI----------TFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKK--LQPFIS 1998
            +TN+GL   ++ W  KF            +   +K R L H N+  + G+          T  +  L +++E+C++G+L+ +L    + L    K SL  D++ GM YLH + + HG L S NC +D ++ +K+ D   G L +A ++            P ++++++                    W APE++   +      L  DV+S  II+ E+  R  P+        + E+VI+++ S     +P +S
Sbjct:  552 STNVGLYEGDWVWLKKFPGEHHMAIRPATKTAFSKLRELRHENVALYLGLFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQREIKLDWMFKSSLLLDLIKGMRYLHHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLP---------EPPSAEDQL--------------------WTAPELLRDPSLERRGTLAGDVFSLAIIMQEVVCRSTPY---AMLELTPEEVIQRVRSPPPLCRPLVS 775          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2e (guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:105123])

HSP 1 Score: 261.536 bits (667), Expect = 1.988e-85
Identity = 131/262 (50.00%), Postives = 182/262 (69.47%), Query Frame = 2
Query: 2024 FSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDK-QIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGR 2803
            F SI K        K +++DSM+  L+ Y  NLED+++ RT+E+E+ ++K   LL QMLP SV + L     V PEY+E V+LYFSDIVGFT+IS+   P++VVD+LN LY+LFD+I+  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ +V + +R+ H  +  + +RIG+H+G  VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  +     ++   ++ +   CRG+ E+KGKG + TY+L GR
Sbjct:  808 FKSINKG------RKTNIIDSMLRMLEQYSSNLEDLIRERTEELEQEKQKTDRLLTQMLPPSVAEALKMGTSVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGS-FRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRILRALDQGFQMECRGRTELKGKGIEDTYWLVGR 1062          

HSP 2 Score: 76.6406 bits (187), Expect = 1.988e-85
Identity = 62/256 (24.22%), Postives = 114/256 (44.53%), Query Frame = 1
Query: 1309 NTNLGLSRANFSW--KF------------RATLNKYRALNHSNICNFAGI----------TFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKK--LQPFIS 1998
            +TN+GL   ++ W  KF            +   +K R L H N+  + G+          T  +  L +++E+C++G+L+ +L    + L    K SL  D++ GM YLH + + HG L S NC +D ++ +K+ D   G L +A ++            P ++++++                    W APE++   +      L  DV+S  II+ E+  R  P+        + E+VI+++ S     +P +S
Sbjct:  552 STNVGLYEGDWVWLKKFPGEHHMAIRPATKTAFSKLRELRHENVALYLGLFLAGTADSPATPGEGILAVVSEHCARGSLHDLLAQREIKLDWMFKSSLLLDLIKGMRYLHHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLP---------EPPSAEDQL--------------------WTAPELLRDPSLERRGTLAGDVFSLAIIMQEVVCRSTPY---AMLELTPEEVIQRVRSPPPLCRPLVS 775          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18910|ANPRA_RAT (Atrial natriuretic peptide receptor 1 OS=Rattus norvegicus OX=10116 GN=Npr1 PE=1 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 1.769e-93
Identity = 132/267 (49.44%), Postives = 189/267 (70.79%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RP F  IR +++  N    S +LD+++  ++ Y  NLE++V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD++++  DVYKVETIGDAY V SG+P RNG  H  E+   +L ++++VR+ +RI H   +Q+ +RIGIHTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S +   ++ E++ +    RG +E+KGKG   TY+L G R 
Sbjct:  787 RPPFQQIRLALRKFNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRS-FRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGERG 1052          

HSP 2 Score: 97.8265 bits (242), Expect = 1.769e-93
Identity = 89/323 (27.55%), Postives = 150/323 (46.44%), Query Frame = 1
Query: 1066 ALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLN--------LSNDDKNVEILFKS--FENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISS 2001
            +L ++S  I++ FI   Y   + +K++++ +W++ +E L  ++   +L    SR+TL+        L   +   ++  K+  ++ N V +   N    R   + K    L   R + + ++  F G       + ++TE C +G+L  IL N  +TL    ++SL  DIV GM +LH   I  HG+L S NC +D ++ +KI D+  GL           +S R+           EP       E   +L   + W APE++ + +     +   DVYSFGIIL EI +R   F  E    S  E +IE++   +  PF  S
Sbjct:  476 SLSLISFLIVSFFI---YRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYKGNLVAVKRVNR--KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDY--GL-----------ESFRDP----------EP-------EQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKE-IIERVTRGEQPPFRPS 762          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P18293|ANPRA_MOUSE (Atrial natriuretic peptide receptor 1 OS=Mus musculus OX=10090 GN=Npr1 PE=1 SV=2)

HSP 1 Score: 269.24 bits (687), Expect = 3.299e-93
Identity = 131/267 (49.06%), Postives = 189/267 (70.79%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RP F  IR +++  N    S +LD+++  ++ Y  NLE++V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD++++  DVYKVETIGDAY V SG+P RNG  H  E+   +L ++++VR+ +RI H   +Q+ +RIGIHTG V AGVVG KMPR+CLFGDTVNTASRMES G A++I  S +   ++ E++ +    RG +E+KGKG   TY+L G R 
Sbjct:  787 RPPFQQIRLALRKFNKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLDAVRS-FRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGERG 1052          

HSP 2 Score: 97.4413 bits (241), Expect = 3.299e-93
Identity = 90/323 (27.86%), Postives = 150/323 (46.44%), Query Frame = 1
Query: 1066 ALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLN--------LSNDDKNVEILFKS--FENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISS 2001
            +L +VS  I++ FI   Y   + +K++++ +W++ +E L  ++   +L    SR+TL+        L   +   ++  K+  ++ N V +   N    R   + K    L   R + + ++  F G       + ++TE C +G+L  IL N  +TL    ++SL  DIV GM +LH   I  HG+L S NC +D ++ +KI D+  GL           +S R+           EP       E   +L   + W APE++ + +     +   DVYSFGIIL EI +R   F  E    S  E +IE++   +  PF  S
Sbjct:  476 SLSLVSFLIVSFFI---YRKMQLEKELVSELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYKGNLVAVKRVNR--KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDY--GL-----------ESFRDP----------EP-------EQGHTLFAKKLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKE-IIERVTRGEQPPFRPS 762          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P16066|ANPRA_HUMAN (Atrial natriuretic peptide receptor 1 OS=Homo sapiens OX=9606 GN=NPR1 PE=1 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 1.299e-92
Identity = 132/267 (49.44%), Postives = 188/267 (70.41%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RP F  IR +++  N    S +LD+++  ++ Y  NLE++V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD++++  DVYKVETIGDAY V SG+P RNG  H  E+   +L ++++VR+ +RI H   +Q+ +RIGIHTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S +   ++ E+  +    RG +E+KGKG   TY+L G R 
Sbjct:  791 RPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRS-FRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERG 1056          

HSP 2 Score: 94.7449 bits (234), Expect = 1.299e-92
Identity = 85/323 (26.32%), Postives = 149/323 (46.13%), Query Frame = 1
Query: 1066 ALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLN--------LSNDDKNVEILFKS--FENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISS 2001
            +L ++ + I++ FI   Y   + +K++ + +W++ +E ++ ++   +L    SR+TL+        L   +   ++  K+  ++ N V +   N    R   + K    L   R + + ++  F G       + ++TE C +G+L  IL N  +TL    ++SL  DIV GM +LH   I  HG+L S NC +D ++ +KI D+  GL           +S R                 + D E   ++   + W APE++ + +     +   DVYSFGIIL EI +R   F  E    S  E +IE++   +  PF  S
Sbjct:  480 SLSLLGILIVSFFI---YRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYKGNLVAVKRVNR--KRIELTRKVLFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSNCVVDGRFVLKITDY--GL-----------ESFR-----------------DLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAGDVYSFGIILQEIALRSGVFHVEGLDLSPKE-IIERVTRGEQPPFRPS 766          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P46197|ANPRB_BOVIN (Atrial natriuretic peptide receptor 2 OS=Bos taurus OX=9913 GN=NPR2 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 5.865e-89
Identity = 132/266 (49.62%), Postives = 183/266 (68.80%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLAN-PSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP F  I+  I+  N     S+LD+++  ++ Y  NLE +V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG +H  EI   +L ++++V + +RI H    Q+ +RIG+HTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S      ++E   +    RG +E+KGKG   TY+L G R
Sbjct:  776 RPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSS-FRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGER 1040          

HSP 2 Score: 89.3521 bits (220), Expect = 5.865e-89
Identity = 91/350 (26.00%), Postives = 154/350 (44.00%), Query Frame = 1
Query: 1003 VDNQKFNEILSSNTTDKILKIALPIVSMFIIALFIFVG---YVFYKQ---QKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEIL----FKSFENNNVFMTNT----NLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSM 2007
            +DN      +   + DK     L IV++     FI  G   ++ +++   +K++ + +W+I +E+L    S        SR+TL+L        +     ++ F N   F  N     ++   R   + +    L   R +  +++  F G       + ++TE C +G+L  IL N  + L    ++SL  D+V GM +LH   I  HG L S NC +D ++ +KI D+  GL            S R+   P              DS AL +    + W APE++       +   K DVYSFGIIL EI +R  PF  E    S  E +++++ + + +P+   S+
Sbjct:  434 LDNPPCAFDMDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERCHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIASHGSLKSSNCVVDSRFVLKITDY--GL-----------ASFRSTAEPD-------------DSHALYA---KKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKE-IVQKVRNGQ-RPYFRPSI 752          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P20594|ANPRB_HUMAN (Atrial natriuretic peptide receptor 2 OS=Homo sapiens OX=9606 GN=NPR2 PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.159e-88
Identity = 132/266 (49.62%), Postives = 183/266 (68.80%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLAN-PSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP F  I+  I+  N     S+LD+++  ++ Y  NLE +V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG +H  EI   +L ++++V + +RI H    Q+ +RIG+HTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S      ++E   +    RG +E+KGKG   TY+L G R
Sbjct:  776 RPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSS-FRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGER 1040          

HSP 2 Score: 88.5817 bits (218), Expect = 1.159e-88
Identity = 92/349 (26.36%), Postives = 153/349 (43.84%), Query Frame = 1
Query: 1006 DNQKFNEILSSNTTDKILKIALPIVSMFIIALFIFVG---YVFYKQ---QKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEIL----FKSFENNNVFMTNT----NLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSM 2007
            DN      L   + DK     L IV++     FI  G   ++ +++   +K++ + +W+I +E+L    S        SR+TL+L        +     ++ F N   F  N     ++   R   + +    L   R +  +++  F G       + ++TE C +G+L  IL N  + L    ++SL  D+V GM +LH   I  HG L S NC +D ++ +KI D+  GL            S R+   P              DS AL +    + W APE++       +   K DVYSFGIIL EI +R  PF  E    S  E +++++ + + +P+   S+
Sbjct:  435 DNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIISSHGSLKSSNCVVDSRFVLKITDY--GL-----------ASFRSTAEPD-------------DSHALYA---KKLWTAPELLSGNPLPTTGMQKADVYSFGIILQEIALRSGPFYLEGLDLSPKE-IVQKVRNGQ-RPYFRPSI 752          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1W0X7Y7 (Guanylate cyclase 2G OS=Hypsibius dujardini OX=232323 GN=BV898_02406 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 6.718e-116
Identity = 125/263 (47.53%), Postives = 165/263 (62.74%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RPTF  I+K +K ANP  +S++DSM+ A+++Y L+LE+ V  RT+E+EK    M++LL+ MLPAS+ DKL K   V PE+YES +L+FSDIVGFTS+++  +P+ +V +LN LYS FD ++++ DVYKVETIGD+Y   SG+PNRNG   L                   IP    Q               VVG  MPR+CLFGDTVNTASRMEST + M+IQ SE    L++    Y    RGQ  VKGKG   TY+L G+
Sbjct:  749 RPTFFEIQKLVKAANPKHRSIVDSMMQAVENYALSLEEKVAERTRELEKLTANMESLLHSMLPASIADKLAKGHNVEPEFYESSTLFFSDIVGFTSLAAASSPIDIVTLLNDLYSAFDGVIQRFDVYKVETIGDSYMCISGLPNRNGKLEL-------------------IPEQLWQ---------------VVGITMPRYCLFGDTVNTASRMESTSLPMRIQISEATQFLLDSLKIYNIIARGQFVVKGKGMMKTYWLVGK 977          

HSP 2 Score: 207.994 bits (528), Expect = 6.718e-116
Identity = 194/716 (27.09%), Postives = 328/716 (45.81%), Query Frame = 1
Query:    1 AGFPRTVYQEWLIAFIANRSAYVSLTGKYDFVGSGQGQLMILDPKTNKIVFSG-----SDTGISNETQLKQPYLQLVPTIAGALVIAHNVPE-----------SSG---INGITMSRDVLAKIFMGNISFWNHAEIQYLNPTKSLPNEKIIIIVREDDSGTTFKMTSALSSFSKEWKTRYGIFS---VNSG----WNNSLIKFYGYQTNTVAGMIRAIRYSISYLSETDLYNFNLSSCLLINRRNQSIAASSDSVYAAMEAQSKLNVDPFNEDMIDIDADFAYPIATFTNIIIYIAGFWSCDLMIEMFRFIEWILTNSQADQIAITKKMVPLSKSMRNLIYNNILMKTTCESDSKLVKTLVDNQKFNEILSSNTTDKILKIALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRS-NLLRTMSRVTLNLSNDDKNVEILFKSFENNNV--------FMTNTNLG-LSRANFSWKFRATLNKYRA-LNHSNICNFAGITFHDERLWLITENC-SKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLS-KSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENY-----LESANLKTDVYSFGXXXXXXXXXXXPFRD--EIFKASSVEDVIEQIASKKLQPFISSSMI 2010
            A  P +VY+ W   + A R  Y  +   Y  VG  Q        ++ +  ++G     +D   +N T       QL PT A  + IA+NVPE           SSG   +  + ++R+ +  IF G I +WN + +   N   +  + +II+ VR+D +G T   T AL++FS +   R+  FS     SG    WN S+      Q   +A  I   +YSI Y   ++  +  +    L+N+ N+    S  +V  AM+  S          +++     +YPIA +T I+I      +C   +E++R   ++L +  A  I       PLS  +R  +  + L +  C+   +LV+ LV      E  S +     + I   ++ + ++ L  F  YV Y Q +  I N + I+   ++  T++S   L TMS  + N S    +  I + +   + V        F+  T    L      W  +  L K +  ++H+NI    G++ HDE+ W +  NC  KG L  ILH     L    ++S+ AD+  GM YLH+  ++HG L+S +CY+D +WNV + DW    L +A +++ ++ +++ +  N +  ++    I+N   SE LKSL    +W APE I   +Y     + +     DVYS+GII  E++   +P+ +  E+   S    V+  I    L+P I +  +
Sbjct:   33 ATLPASVYKSWKQVYQAYRQLYSMVDLSYQPVGQDQALRRF---QSGEYHYAGLNDDLTDVQYNNVTFAD---YQLFPTFAMPISIAYNVPEISENADIAGDFSSGRQSLGNMNLTRENVLGIFNGTIKYWNDSLLVADNAGLAEVHHRIIVAVRKDAAGATGIFTRALAAFSTDDNNRFSSFSDGCSKSGIPIKWNPSMNIQCVTQNLGLAFYILNTKYSIGYAGSSEARDAQIPDARLLNQENRWTRPSVRTVQGAMDNVSTDLGTRLTGSLVNAPGPLSYPIAGYTYILIRRTTMVNCTAAMELYRMFAYLLEDDFAQSIVADTINTPLSPIVRKQVVQHALNEMRCQG--QLVQDLVAVAISIEDGSYDAWKLPVIIVCALIGVALVMLTTFFIYVKYTQNRSAIRNTFIIALNPIEPVTAKSTGSLPTMSIASTNPSKAQTHDTIEWATGTGSGVVKVQSGEQFLVRTICSHLIPDTMQWSAKIMLVKLKEKISHANILKLIGVSLHDEK-WKMVTNCPGKGRLQDILHAGKYHLEAVFRYSILADLADGMIYLHKNGLVHGQLTSNSCYIDARWNVVVGDWEQYALHQAQRVQFIAFENLYSEANAEPERD----IANY--SEYLKSL----YWSAPEAI-TRDYNDIFIVSTPEKPADVYSYGIIAFEVFTDMLPYENTIELDAISRPHLVLAAIKVDNLRPKIPADAL 728          
BLAST of Guanylate cyclase vs. TrEMBL
Match: R7U1S3 (Guanylate cyclase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_143601 PE=3 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.346e-98
Identity = 139/261 (53.26%), Postives = 188/261 (72.03%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFL 2794
            RP F+ ++  +K A PS+K +LD M+D + +Y+  LEDMV+ RT E+ ++   M+ LLYQ+LP  V +KL + E + PE Y+SV+++FSDIVGFT+IS+  TP+Q+V  LN LYS FD+I++K+DVYKVETIGDAY V SG+P RNGI+H   I + ++ ++E+ RN Y IPH  D+Q+ +R GIH+G V AGVVG KMPRFCLFGDTVNTASRMEST VAM+IQ S     +  +   Y    RG + VKGKG   T++L
Sbjct:  209 RPNFTRVQTVLKHARPSRKGLLDCMMDVMKNYVEKLEDMVKDRTVELTQATDSMRTLLYQILPPKVAEKLQRGEAIDPENYDSVTVFFSDIVGFTTISALSTPLQIVHFLNSLYSCFDAILDKHDVYKVETIGDAYMVISGLPERNGIRHAACIADMAIELMEAARN-YTIPHLPDEQLQLRAGIHSGPVAAGVVGVKMPRFCLFGDTVNTASRMESTSVAMRIQVSGDFRDIARQVGGYEMQRRGTVSVKGKGDMVTFWL 468          

HSP 2 Score: 103.605 bits (257), Expect = 1.346e-98
Identity = 71/206 (34.47%), Postives = 113/206 (54.85%), Query Frame = 1
Query: 1381 LNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFIS 1998
            ++H NI  F G+T  +  L++  E    G L+ ILH     L D+ K+ L+ D+ +GM +LH + I+ G+LSS  C +D KWNVK+A+W    + +   +K+        G P  + +  EP      S+A + L      QAPEI  L   +   N +TDVYSFG++++EI+ +  PF D I  AS+ +D+I++I    L+P + 
Sbjct:    1 MHHQNIGTFYGLTTVENSLYIAMEYELNGLLHEILHGGRYDLDDNFKYCLSLDVATGMIFLHSKGIVCGNLSSQYCIIDSKWNVKVANWLHCPVTERENVKL------GYGLPPINSDATEP----SHSQACQILT-----QAPEI--LSGSVPLPNKQTDVYSFGMLVVEIFSQCEPFGDAISIASA-DDIIQEIVKNNLRPVMP 188          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A091GYS2 (Guanylate cyclase (Fragment) OS=Buceros rhinoceros silvestris OX=175836 GN=N320_12003 PE=3 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 7.425e-94
Identity = 135/266 (50.75%), Postives = 185/266 (69.55%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RPTF  ++K +   NP+K S +D M+  ++ Y  +LE +V  RT+++   ++K   LLY MLP  V D L + +P   + Y S +++FSDIVGFT +SS  TP QVVD+LN+LY++FD I++  DVYKVETIGDAY V SGVP  NGI H  EI   +L +++ V   +++PH  +  + +R GIH+G+VVAGVVG KMPR+CLFGDTVNTASRMEST  A+KIQ S  AY L+ +  +Y   CRG ++VKGKG   TY+LEG++A
Sbjct:  279 RPTFEQVKKMLYKMNPNKVSPVDMMMTLMEKYSKHLEILVSERTQDLMHEKQKTDRLLYSMLPKQVADDLRQGKPAQAQSYLSATIFFSDIVGFTQLSSSSTPYQVVDLLNKLYTIFDEIIDNYDVYKVETIGDAYMVVSGVPKENGILHAGEIASMALDLLD-VCKTFKVPHKPNTLLKIRAGIHSGAVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAYQLLEQIGEYVLVCRGNLQVKGKGDMVTYWLEGKKA 543          

HSP 2 Score: 95.1301 bits (235), Expect = 7.425e-94
Identity = 66/199 (33.17%), Postives = 96/199 (48.24%), Query Frame = 1
Query: 1351 FRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRH--RFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPF-RDEIFKA 1938
             R  + + R L+H N+C F G       + ++TE C KG+L  +L N  + L+   +FS A DI  GM YLH  ++ HG L S NC +D +W  KIAD+  GL           +S R   +P+ S                 S  +H  + + APE+  L +     N  TDVYS+ IIL+EI  R  P  +D++  A
Sbjct:   71 IRKEVKQVRELDHPNLCKFVGGCVEVPNVAIVTEYCPKGSLNDVLLNEDIPLNWGFRFSFATDIAQGMAYLHHHKMYHGRLKSTNCVIDDRWVCKIADY--GL-----------QSYRKGDSPEGS----------------GSYQQHLIQIYTAPEVRSLSH--SEPNSMTDVYSYAIILLEIATRSDPIPKDDVHSA 238          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A402FHC0 (Guanylate cyclase OS=Paroedura picta OX=143630 GN=parPi_0018243 PE=3 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 8.326e-94
Identity = 132/266 (49.62%), Postives = 187/266 (70.30%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLAN-PSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP F  I+  ++  N  S  ++LD+++  ++ Y  NLE++V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFT++S+E TPMQVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG  H  E+   SL ++E+VRN ++I H  ++Q+ +RIGIH+G V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S     ++ E+  +    RG +E+KGKG   TY+L   R
Sbjct:  497 RPDFHHIKGMLRKFNRESSSNLLDTLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGRLHAREVSRMSLALLEAVRN-FKIRHRPEQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSGATKSILEEFGCFELEVRGDVEMKGKGKMRTYWLLSER 761          

HSP 2 Score: 110.923 bits (276), Expect = 8.326e-94
Identity = 90/327 (27.52%), Postives = 154/327 (47.09%), Query Frame = 1
Query: 1054 ILKIALPIVSMFIIALFIFVGYVFYKQ--QKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKN----VEILFKSFENNNVFMTN----TNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISS 2001
            +L+I   ++S+F+  + I   +V+ K   +K++ + +W+I +E + ++    NL    S++TL+L   +       E  F+ +     +  N     ++   R   + K R  L   R + + ++  F G       + ++TE C++G+L  IL N  +TL    ++SL  DIV GM +LH   I  HG+L S NC +D ++ +KI D+                              +E      D+E   +L   + W APE++ +E+ L     K DVYSFGIIL EI +R   F  E   A S +++IE++ S +  PF  S
Sbjct:  176 LLEILSLVMSLFLSMVTIAAFFVYRKMRLEKELASELWRIHWEDVQSSNLEKNLRSVGSKLTLSLRGSNYGSLLTTEGQFQVYAKTAYYKGNLVAVKHVNRKRIELTRKMRFELKHMRDVQNKHLTRFIGACIDPPNICILTEYCTRGSLQDILENDSITLDWMFRYSLTNDIVKGMLFLHTGVIHSHGNLKSSNCVVDSRFVLKITDY-----------------------------GLESFRQAPDTEDSHALFAKKLWTAPELLRMESPLPGGTQKGDVYSFGIILQEIALRSGVFYVEGM-ALSPKEIIERVKSSEYPPFRPS 472          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A091SRJ2 (Guanylate cyclase (Fragment) OS=Pelecanus crispus OX=36300 GN=N334_12993 PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 8.604e-94
Identity = 135/266 (50.75%), Postives = 183/266 (68.80%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RPTF  ++K +   NP+K S +D M+  ++ Y  +LE +V  RT+++   ++K   LLY MLP  V D L + +    + Y S +++FSDIVGFT +SS  TP QVVD+LN+LY+ FD I++  DVYKVETIGDAY V SGVP  NGI H  EI   +L ++  +   ++IPH  +  + +R GIH+G+VVAGVVG KMPR+CLFGDTVNTASRMEST  A+KIQ S  AY L+ +  +Y   CRG ++VKGKG  TTY+LEG++A
Sbjct:  544 RPTFEQVKKMLYKMNPNKVSPVDMMMTLMEKYSKHLEVLVSERTQDLMHEKQKTDRLLYSMLPKQVADDLRQGKHAQAQSYLSATIFFSDIVGFTQLSSSSTPYQVVDLLNKLYTTFDEIIDNYDVYKVETIGDAYMVVSGVPKENGILHAGEIASMALDLL-GICKTFKIPHKPNTLLKIRAGIHSGAVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAYQLLEQLGEYVLVCRGNLQVKGKGDMTTYWLEGKKA 808          

HSP 2 Score: 98.5969 bits (244), Expect = 8.604e-94
Identity = 112/433 (25.87%), Postives = 178/433 (41.11%), Query Frame = 1
Query:  778 ATFTNIIIYIAGFWSCDLMIEMFRFI--EWILTNSQ-----------ADQIAITKKMVPLSKSMRNLIYNNIL--MKTTCESDSKLVKTLVDNQKFNE------ILSSN------TTDKILKIALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNT-SRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNV----FMTNTNLGLSRA-----------NFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRH--RFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPF-RDEIFKA 1938
            A   N  +Y A   SC L   M R I   WI  + Q             Q   T K+V +   + +LI +  +  M+   E+ + ++  +V    F E      I  ++      + D  + IALP+  +      + V +  Y++QK   +  W I +  +  +   R+     MS       ++   +  L       N+    + T T     R              S   R  + + R L+H N+C F G       + ++TE C KG+L  +L N  + L+   +FS A DI  GM YLH +++ HG L S NC +D +W  KIAD+  GL           +S R + +P+ S                 S  +H  + + APEI  L ++    N  TDVYS+ IIL+EI  R  P  +D++  A
Sbjct:  104 ANGENCCVYHANIHSCPLAF-MVRGICGPWIPDDGQIFTHTLSTAGKMSQRNWTAKVVLVHVGVTSLIAHIRVGRMQVALEAKTTVLPAVVCGDGFCEEEEGCSICPADCGECPLSADARIAIALPLF-LVCTGFILTVTWFQYQKQKLFWDESWIIDFSCIKQDCIVRTATGSMMSAPPAPSDSNASCITALSSCTAAANMTRKEYFTQTGRYDGRTVAIKKIMKKTFTLSKSIRKEVKQVRELDHPNLCKFIGGCIEVPNVAIVTEYCPKGSLSDVLLNEDIPLNWGFRFSFATDIAQGMAYLHHRKMYHGRLKSSNCVIDDRWVCKIADY--GL-----------QSYRKDDSPEGS----------------GSYQQHLIQIYTAPEIHSLSDF--EPNSMTDVYSYAIILLEIATRSDPMPKDDVLSA 503          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: ENSAMXT00000020840.2 (retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:103026799])

HSP 1 Score: 260.766 bits (665), Expect = 2.731e-87
Identity = 135/268 (50.37%), Postives = 184/268 (68.66%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            RPTF    +  +  N  +K+ ++DSM+  L+ Y  NLE++++ RT+E+E  ++K + LL QMLP SV + L     V PEY++SVSLYFSDIVGFT+IS+   P++VVD+LN LY+LFD+I+  +DVYKVETIGDAY V+SG+P  NG +H  EI   SL I+ +V   +++ H  D  + +RIG+HTG  VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  S     ++ E N+ Y    RG+ E+KGKG   TYFL G+  
Sbjct:  782 RPTFDETFEEFRNINKGRKTNIIDSMLRMLEQYSSNLEELIRERTEELEIEKQKTEKLLTQMLPPSVAEALKVGGTVEPEYFDSVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTLFDAIIGNHDVYKVETIGDAYMVASGLPVPNGNRHAAEIASMSLDILSAV-GTFKMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGMPYRIHVSHTTVKILIELNEGYKIELRGKTELKGKGMDETYFLVGKEG 1048          

HSP 2 Score: 83.1889 bits (204), Expect = 2.731e-87
Identity = 65/251 (25.90%), Postives = 114/251 (45.42%), Query Frame = 1
Query: 1309 NTNLGLSRANFSWKFRATLNKYRALN--------------HSNICNFAGITFHDERLW-LITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITP 2016
            N+N+ +   ++ W  R     + ++N              H N+  F G  FHD  ++ ++TE CS+G+L  +L N  V L    K SL  D++ GM+YLH + + HG L S NC +D ++ +K+ D+    + +A +                     EP + +              W APE++   +  ++A  + DVYS  II+ E+ +R  PF        S E++I+++   K  P +   M++P
Sbjct:  546 NSNVAIYEGDWVWLKRLPYGNFGSVNPKTSDVFELMKDIRHENLNPFMGY-FHDRGVFAMVTEFCSRGSLEDLLRNEDVKLDWMFKSSLLLDLIKGMKYLHHRGVCHGRLKSRNCVVDGRFVLKVTDYGYNEVLQAQRFPY-----------------TEPKAEDL------------LWTAPELLRASHPGQAATPEGDVYSLSIIMQEVVLRGPPF---FMLHLSAEEIIQRV---KKPPPLCRPMVSP 760          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: gucy2f (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:103038783])

HSP 1 Score: 264.233 bits (674), Expect = 3.683e-87
Identity = 135/270 (50.00%), Postives = 187/270 (69.26%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESV-----RNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RP+F  I    KL N  KK+ ++DSM+  L+ Y  NLED+++ RT+E+E  +++ + LL +MLP SV + L     V PEY++ V++YFSDIVGFT+ISS   P++VVD+LN LY+LFD+++  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ SV     R++  +P     + +RIGIH+GS VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  +     ++N  N+ Y    RG+ E+KGKG + TY+L G+
Sbjct:  798 RPSFDEIFDQFKLINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQRTEKLLTEMLPQSVAEALKTGATVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAVLSNHDVYKVETIGDAYMVASGLPKRNGNKHAAEIANMSLNILSSVGSFKMRHMPEVP-----VRIRIGIHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNISTVKILNSLNEGYKIEVRGKTELKGKGIEETYWLVGK 1062          

HSP 2 Score: 79.337 bits (194), Expect = 3.683e-87
Identity = 62/218 (28.44%), Postives = 95/218 (43.58%), Query Frame = 1
Query: 1363 LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITP 2016
              K + L + N+  F G     E   ++TE CS+G+L  +L N  V L    K SL  D++ GM+YLH ++  HG L S NC +D ++ +KI D+    L ++       K+ R    P +                        FW APE++           K DVYSF IIL E+ +R  P+        S E++I ++   K  P +    + P
Sbjct:  594 FTKMKDLRNENVNPFLGFFSDCEMFAVVTEYCSRGSLQDLLRNDDVKLDWMFKSSLLLDLIKGMKYLHHREFPHGRLKSRNCVVDGRFVLKITDYGFNELLES------QKAPRKEFPPGD-----------------------LFWTAPELLRDPESSRRGTYKGDVYSFAIILQEVVVRGPPY---CMLGLSAEEIIRKV---KKPPPMCRPTVAP 776          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: gucy2f (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:103038783])

HSP 1 Score: 263.848 bits (673), Expect = 3.714e-87
Identity = 135/270 (50.00%), Postives = 187/270 (69.26%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESV-----RNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RP+F  I    KL N  KK+ ++DSM+  L+ Y  NLED+++ RT+E+E  +++ + LL +MLP SV + L     V PEY++ V++YFSDIVGFT+ISS   P++VVD+LN LY+LFD+++  +DVYKVETIGDAY V+SG+P RNG +H  EI   SL I+ SV     R++  +P     + +RIGIH+GS VAGVVG  MPR+CLFGDTVNTASRMESTG+  +I  +     ++N  N+ Y    RG+ E+KGKG + TY+L G+
Sbjct:  798 RPSFDEIFDQFKLINKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVEKQRTEKLLTEMLPQSVAEALKTGATVEPEYFDEVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYTLFDAVLSNHDVYKVETIGDAYMVASGLPKRNGNKHAAEIANMSLNILSSVGSFKMRHMPEVP-----VRIRIGIHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNISTVKILNSLNEGYKIEVRGKTELKGKGIEETYWLVGK 1062          

HSP 2 Score: 79.7221 bits (195), Expect = 3.714e-87
Identity = 62/218 (28.44%), Postives = 95/218 (43.58%), Query Frame = 1
Query: 1363 LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITP 2016
              K + L + N+  F G     E   ++TE CS+G+L  +L N  V L    K SL  D++ GM+YLH ++  HG L S NC +D ++ +KI D+    L ++       K+ R    P +                        FW APE++           K DVYSF IIL E+ +R  P+        S E++I ++   K  P +    + P
Sbjct:  594 FTKMKDLRNENVNPFLGFFSDCEMFAVVTEYCSRGSLQDLLRNDDVKLDWMFKSSLLLDLIKGMKYLHHREFPHGRLKSRNCVVDGRFVLKITDYGFNELLES------QKAPRKEFPPGD-----------------------LFWTAPELLRDPESSRRGTYKGDVYSFAIILQEVVVRGPPY---CMLGLSAEEIIRKV---KKPPPMCRPTVAP 776          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: gc2 (retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:103025043])

HSP 1 Score: 256.529 bits (654), Expect = 6.305e-86
Identity = 134/266 (50.38%), Postives = 179/266 (67.29%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNK-YTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RPTF  I    K  N  KK+ ++DSM+  L+ Y  NLE++++ RT+E+E  ++K + LL QMLP SV + L     V PEYYE V++YFSDIVGFT+IS+   P++VVD+LN LYS FD I+  +DVYKVETIGDAY V+SG+P  NG +H  EI   +L I+ +V   +++ H  D  + +RIGIHTGS VAGVVG  MPR+CLFGDTVNTASRME+TG   +I        ++ E    Y     G+ E+KGKG++ TY+L GR
Sbjct:  806 RPTFEEIFDQFKNINKGKKTNIIDSMLRMLEQYSSNLEELIRERTEELEVEKQKTEKLLTQMLPPSVAEALKLGTTVEPEYYECVTIYFSDIVGFTTISANSEPIEVVDLLNDLYSTFDEIIANHDVYKVETIGDAYMVASGLPVPNGNRHAAEIANMALDILSAV-GTFKMRHMPDVPVRIRIGIHTGSCVAGVVGLTMPRYCLFGDTVNTASRMEATGTPHRIHIHSSTVQILREMKAGYKVQLCGRTEIKGKGTEETYWLIGR 1070          

HSP 2 Score: 82.8037 bits (203), Expect = 6.305e-86
Identity = 68/257 (26.46%), Postives = 117/257 (45.53%), Query Frame = 1
Query: 1309 NTNLGLSRANFSWKFRATLNKYRALN--------------HSNICNFAGITFHDERLW-LITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITPTNVFVD 2034
            NTN+ +   +++W  R     ++ +N              H N+  F G+ FHD  ++ ++TE CS+G+L  +L N  V L    K SL  D++ GM+YLH + + HG L S NC +D ++ +K+ D+    L +A K +                  +EP      +E L        W APE++      ++     DVYSF I++ E+  R  PF        S E+++++I   +  P +    + P +  V+
Sbjct:  570 NTNVAVYEGDWAWLKRFPDGTFQGINPSTTELFELMRDIRHENVNPFMGL-FHDCGVFAIVTEFCSRGSLEDLLLNDDVKLDWMFKSSLLLDLIKGMKYLHHRNVCHGRLKSRNCLVDGRFVLKVTDYAYNKLLEAQKFQY-----------------VEP-----SAEEL-------LWTAPELLRGSFPGQNGTFPGDVYSFSIVMQEVVARGPPF---CMLDLSAEEILQKI---RKPPPLCRPTVYPDHAPVE 790          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: ENSAMXT00000016107.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001112.1:50819:73979:1 gene:ENSAMXG00000015515.2 transcript:ENSAMXT00000016107.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 290.041 bits (741), Expect = 5.497e-84
Identity = 144/265 (54.34%), Postives = 184/265 (69.43%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDK-QIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RPTF  IRK +   NP K S +D M++ ++ Y  +LE +V  RT+++   ++K   LLY MLP  V D L + +P   + Y S +++FSDIVGFT +SS  TP QVVD LN+LY+ FD I++ +DVYKVETIGDAY V SGVP  NGI H  EI   +L +V SV   +RIPH  + Q+ +R GIH+G VVAGVVG KMPR+CLFGDTVNTASRMEST  A+KIQ S  A+ L+ E   YT TCRG ++VKGKG   TY+LEGR+
Sbjct:  558 RPTFEQIRKFVHRINPHKVSPVDMMMNLMEKYSKHLEVLVAERTQDLMHEKQKTDRLLYSMLPKQVADDLRQGKPSQAQSYVSATVFFSDIVGFTQLSSTSTPYQVVDFLNKLYTTFDDIIDNHDVYKVETIGDAYMVVSGVPRENGILHAAEISNMALDLV-SVCKTFRIPHKPQTQLQIRAGIHSGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAFYLLEEIGGYTLTCRGVLQVKGKGDMVTYWLEGRQ 821          

HSP 2 Score: 88.9669 bits (219), Expect = 1.176e-17
Identity = 57/208 (27.40%), Postives = 97/208 (46.63%), Query Frame = 1
Query: 1078 VSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTN-TSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNV------FMTNTNLGLSRA-----------NFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADW 1647
            V+  II+ F+   +  Y++QK + +  W I   ++  +  +R+ +    S +++  +N D N   +        +        T+T +   R            + S   R  + + R L+H N+C F G       + ++TE C KG+L  +L N  + L+   +FS A DI  GM YLH+ +I HG L S NC +D +W  KI D+
Sbjct:  246 VTTIIISFFVTAMWFRYQKQKLLWDESWIIDVSQIKQDYIARAAM---GSIISVPAANSDSNASCVTALSSCTGMPTSRKQLYTHTGIYDGRTVAIKKIKTKSFSLSKTIRQEVKQVRELDHPNLCKFFGGCVEIPNVAIVTEYCPKGSLNDVLLNDEIPLNWGFRFSFATDIARGMSYLHQYKICHGRLKSTNCVIDDRWVCKITDF 450          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.899 bits (629), Expect = 4.823e-84
Identity = 132/266 (49.62%), Postives = 188/266 (70.68%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPS--KKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RP FSS+ + ++LA+P     ++LD+M+  L+ Y  +LE++V  RT ++E  +KK   LL  +LP  VVD+L   + V PE YE V+++F DIVGFT++S+  TP++V+++LN LY+L D I+++ DVYKVETIGDAY V+SG+P RNG++H+ EI   SL  + S+ N +RI H   +Q+ +RIGI++G VVAGVVGN MPR+CLFGDTVN ASRMESTG  + I  SE    L+ +   Y    RG I +KGKG+Q TY+L+G+
Sbjct:  364 RPDFSSVSRMLRLASPEGLHMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMN-FRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 628          

HSP 2 Score: 83.5741 bits (205), Expect = 4.823e-84
Identity = 83/328 (25.30%), Postives = 145/328 (44.21%), Query Frame = 1
Query: 1066 ALPIVSMFIIALFIFVGYVFYKQ---QKDIINNVWKISYEKLD-TNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRAT--------LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQ----IASKKLQPFIS 1998
            A+ I+S+ +I    F+ Y+  +    Q+ +    WKI++E +   +TS+  +  T+    L++ N     E L     N +   ++  +  +++N       T        + + R + H N+  F G+      + ++T+ C KG+L  +L  S   L    K S A DIV+GM +LH+  I  HG+L    C LD +  +K+  + I       K K L                   I+   D+ AL S  +  +W APE++ +E+   +   K DV+SF I++ E   RE P      +     D+I+Q    IA   L+P ++
Sbjct:   36 AVTILSLIVIGTVAFLTYLVVQSRSLQESMDTTWWKINFEDITLVSTSKEGMHTTVYLYVLSMLNHIVESESLQVPLVNGSYRSSSKQVSGNQSNVHHDVHGTDRVEIPIGIYQMREMLHENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTLD------------------INKQEDAWALSS--KELYWTAPELLRMEDLPVNGTPKGDVFSFAILMRESTPREWPTATRANRV-PFPDIIDQVRDGIAVPPLRPLLT 342          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002650.1 (pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 gene:ENSPMAG00000002416.1 transcript:ENSPMAT00000002650.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 262.307 bits (669), Expect = 4.232e-78
Identity = 131/264 (49.62%), Postives = 174/264 (65.91%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RPTF  I+K +   NP+K S +D M+  ++ Y  +LE +V  RT+++   ++K   LLY MLP  + D L +      + Y S +++FSDIVGFT +SS  TP +VVD LN+LY+ FD I++  DVYKVETIGDAY V SGVP  N  QH +E    +L +V +V   + IPH  + Q+ +R GIHTG VVAGVVG KMPR+CLFGDTVNTASRMEST  A+KIQ S     ++ +   Y  +CRG + VKGKG   T++LEGR
Sbjct:  235 RPTFEQIKKFLHKMNPNKFSPVDMMMSLMEKYSKHLESVVTERTQDLVLEKQKTDRLLYSMLPKQIADDLRQGRVTKAQSYASATVFFSDIVGFTQLSSSSTPYEVVDFLNKLYTSFDGIIDNYDVYKVETIGDAYMVVSGVPTENHNQHAVETANMALDLV-NVCQAFVIPHKPEMQLKIRAGIHTGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSPSTSSILQQIGSYLLSCRGTVTVKGKGEMITWWLEGR 497          

HSP 2 Score: 85.1149 bits (209), Expect = 2.345e-17
Identity = 38/104 (36.54%), Postives = 58/104 (55.77%), Query Frame = 1
Query: 1336 NFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADW 1647
            N +   R  + + R L ++N+C F G       + ++TE C KG+L  +L N  + L+   +FS A DI  GM +LH  ++ HG L S NC +D +W  KIAD+
Sbjct:   15 NLTKVIRREVKQVRELEYANLCKFIGGMVEVPNVAILTEYCPKGSLQDVLLNDDIPLNWGFRFSFATDIARGMAFLHSHRLFHGRLKSTNCVIDDRWVCKIADY 118          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 263.462 bits (672), Expect = 1.537e-75
Identity = 132/264 (50.00%), Postives = 187/264 (70.83%), Query Frame = 2
Query: 2015 RPTFSSIRKSI-KLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP FS I+  I K    +  ++LD+++  ++ Y  NLE++V+ RT+   + ++K + LLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFTS+S+E TPMQVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG  +  EI   SL ++++V+  ++I H  + ++ +RIGIHTG V AGVVG KMPRFCLFGDTVNTASRMES G A+KI  S+    +++E+  +    RG +E+KGKG   TY+L G
Sbjct:  557 RPDFSQIKMLIHKFNKENSTNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAETLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKT-FKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLG 819          

HSP 2 Score: 81.6481 bits (200), Expect = 4.787e-16
Identity = 73/294 (24.83%), Postives = 126/294 (42.86%), Query Frame = 1
Query: 1042 TTDKILKIALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANF-------SWKFRAT------LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYH-ILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFG 1878
            +T ++L I   ++ + I+A+  F+ Y   K +K++ + +W++ +E +  ++         S++TL++     +   L  +   N +F      G  R N          K   T      L   R + + ++  F G       + ++TE C +G+L   IL N  +TL    ++SL  DIV GM +LH   I  HG L S NC +D ++ +KI D+ +              S R+                  + E + SL   + W APE++ LE+       K DVYS G
Sbjct:  234 STMEVLMIVFSLI-LLIVAVSSFLIYRKLKLEKELASMLWRLRWENIQVSSLEKARRSAGSKLTLSMRGS--SCGSLLTTQGRNQMF---AKTGYYRGNLVAIKPINKKKIELTREVLFELKHMRDVLNEHLTRFVGACIDPPNICIVTEYCPRGSLQQDILENESITLDWVFRYSLINDIVKGMLFLHNSVIGSHGSLKSSNCVVDSRFVLKITDYGLA-------------SFRSCS----------------ECEDMHSLYAKKLWTAPELLRLEHPPPQGTQKGDVYSLG 492          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 250.366 bits (638), Expect = 1.370e-73
Identity = 124/271 (45.76%), Postives = 180/271 (66.42%), Query Frame = 2
Query: 2015 RPTFSSIRKSIK--------LANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQ-IAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP F  I+  ++          +P   ++LD+++  ++ Y  NLE++V+ RT+   + + K + LLYQ+LP SV ++L + E V  E ++SV++Y SDIVGFT++S++ TPMQVV  LN LY+ FD+I++  DVYKVETIGDAY V SG+P  NG +H IE+   +L ++ +VR  + I H   Q + +RIGIHTG V AGVVG KMPR+CLFGDTVNTASRME+ G A +I  S     +++EY  +     G +++KGKG+  TY+L G
Sbjct:  233 RPDFHQIKILLQKFSSQDDGPESPPAFTILDNLLSRMEQYANNLEELVEERTQAYLEEKGKAEALLYQILPHSVAEQLKRGETVPAEAFDSVTIYLSDIVGFTAMSAQSTPMQVVAFLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVHNGTRHAIEVARMALALLSAVR-CFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWLLG 502          

HSP 2 Score: 81.6481 bits (200), Expect = 2.874e-16
Identity = 63/186 (33.87%), Postives = 87/186 (46.77%), Query Frame = 1
Query: 1363 LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPF 1917
            L   R + + ++  F G       + +ITE C +G+L  IL N  ++L    ++SL  DIV GM YLH   I  HG+L S NC +D ++ +KI D+  GL            S+R +    +S N  E                 R W APE++ LE        K DVYSF IIL EI +R  PF
Sbjct:   25 LKHMRDVQNEHLTRFVGACIDVPNICIITEYCPRGSLQDILENESISLDWMFRYSLMHDIVKGMLYLHSSVIGSHGNLKSSNCVVDSRFVLKITDY--GL-----------SSVRAHSKADSSANYFE----------------KRLWTAPELLRLEEVAPRGTQKGDVYSFAIILQEIALRSGPF 181          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008976.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.899 bits (629), Expect = 2.463e-70
Identity = 132/265 (49.81%), Postives = 188/265 (70.94%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANP-SKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RP FSS+ + ++LA+P    ++LD+M+  L+ Y  +LE++V  RT ++E  +KK   LL  +LP  VVD+L   + V PE YE V+++F DIVGFT++S+  TP++V+++LN LY+L D I+++ DVYKVETIGDAY V+SG+P RNG++H+ EI   SL  + S+ N +RI H   +Q+ +RIGI++G VVAGVVGN MPR+CLFGDTVN ASRMESTG  + I  SE    L+ +   Y    RG I +KGKG+Q TY+L+G+
Sbjct:  454 RPDFSSVSRMLRLASPEGDMNILDNMVSKLEKYANHLEEVVDDRTAQLESEKKKTDRLLSSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLHFLSSIMN-FRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 717          

HSP 2 Score: 77.7962 bits (190), Expect = 7.084e-15
Identity = 77/291 (26.46%), Postives = 123/291 (42.27%), Query Frame = 1
Query: 1048 DKILKIALPIVSMFIIALFIFVGYVFYKQ---QKDIINNVWKISYEKLDTNTSRSNLLRTMSR-VTLNLSN------DDKNVEILFKSFENNNV---FMTNTNLGLSRAN-FSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSF 1875
            D  L +   I+S+ +I    F+ Y+  +    Q+ +    WKI++E +      +   R+ S+ V+ N SN          VEI    ++ N V   F+  T+    ++N F+ K R  L       H N+  F G+      + ++T+ C KG+L  +L  S   L    K S A DIV+GM +LH+  I  HG+L    C LD +  +K+  + I       K K L                        D   L S     +W APE++ +E+   +   K DV+SF
Sbjct:  129 DLALVLVGSILSLIVIGTVAFLTYLVVQSRSLQESMDTTWWKINFEDITLVPLVNGSYRSSSKQVSGNQSNVHHDVHGTDRVEIPIGIYQGNQVALKFLERTHPPDLKSNRFALKMREML-------HENLVIFFGVCVELPNVCIVTQYCRKGSLKDVLKTSDFELDWMFKTSFAHDIVNGMIFLHKSPIKSHGNLKPSTCLLDSRLQIKLTGFGIWEFRYGKKGKTL------------------------DINNLGSFFIELYWTAPELLRMEDLPVNGTPKGDVFSF 388          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 55.0694 bits (131), Expect = 5.071e-8
Identity = 27/110 (24.55%), Postives = 57/110 (51.82%), Query Frame = 1
Query: 1357 ATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKV 1686
            A ++  + LNH+NI  + G       L+++ E C+ G+L  ++  S   LS++   +     + G++YLH + +IH  + + N  L     VK+AD+ +  +  ++ + +
Sbjct:   69 AEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTL 178          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 53.9138 bits (128), Expect = 9.097e-8
Identity = 47/187 (25.13%), Postives = 82/187 (43.85%), Query Frame = 1
Query: 1363 LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRD 1923
            +N  + L+H NI  + G +     L +  E    G++  +L+N G    +S+  +    I+ G+ YLH++ IIH  +   N  +D K  VKI D+ I                           K+ P++   +  A  SL    FW +PE++       +   K D++S G ++IE++  + PF D
Sbjct:  505 MNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYG-PFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGIS-------------------------KKLSPLNKKQNKRA--SLQGSVFWMSPEVVK----QTATTAKADIWSTGCVVIEMFTGKHPFPD 659          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 53.5286 bits (127), Expect = 1.282e-7
Identity = 26/100 (26.00%), Postives = 50/100 (50.00%), Query Frame = 1
Query: 1348 KFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADW 1647
            K  + +  +++++H NI  F      D  ++++ E C  G+L  +L    V     V+F     I   ++Y+H +++IH  L   N + D  +N+KI D+
Sbjct:  125 KLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRF-FTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDF 223          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 53.1434 bits (126), Expect = 2.037e-7
Identity = 36/113 (31.86%), Postives = 55/113 (48.67%), Query Frame = 1
Query: 1381 LNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNP 1719
            LNH N+     +   +  L+L+ E   KG L+++L   G  L +         I+ G+ Y H   I+H  L   N  LD K+N+KIAD+  G+    T+ K+L  S    G+P
Sbjct:   88 LNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERG-PLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADF--GMAALETEGKLLETSC---GSP 194          
BLAST of Guanylate cyclase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 51.6026 bits (122), Expect = 5.038e-7
Identity = 52/187 (27.81%), Postives = 78/187 (41.71%), Query Frame = 1
Query: 1387 HSNICNFAGITFH-DERLWLITENCSKGNLYHILHNSGV------TLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDE 1926
            H NI NF       D+ LW++ E    G+L  I+ NS         L++     +  +   G+++LH + IIH  + S N  LD +  VKI D+  G   + T  +  SK     G P                          +W APE++    Y E    K DV+S GI+ IE+   E P+ +E
Sbjct:  619 HKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDF--GFCARLTDKR--SKRATMVGTP--------------------------YWMAPEVVKQREYDE----KIDVWSLGIMTIEMLEGEPPYLNE 771          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 265.003 bits (676), Expect = 1.811e-91
Identity = 136/265 (51.32%), Postives = 185/265 (69.81%), Query Frame = 2
Query: 2015 RPTFSSIRKSI-KLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH--NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP F  IRK++ KL    + +++D+M++ L+ Y  NLE +V+ RT ++   ++K +NLL +MLP SV   L   + V  E ++ VS++FSDIVGFTS+SSE TP+QVVD+LN LY+LFD I+   DVYKVETIGDAY V SG+P RNG QH  EI   +L ++  + + ++I H  NDK + +RIGIH+GS VAGVVG KMPR+CLFGDTVNTASRMES G A+KI  S     +++E   Y    RG++ +KGKG+  TY+L G
Sbjct:  254 RPDFEEIRKTVRKLPMGKQSNIMDNMVNLLEKYANNLESLVEERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREI-DSFKIRHRPNDK-LKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPSTKRILDELGGYHIQKRGKVFLKGKGTWITYWLVG 516          

HSP 2 Score: 91.2781 bits (225), Expect = 1.811e-91
Identity = 63/207 (30.43%), Postives = 93/207 (44.93%), Query Frame = 1
Query: 1375 RALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPF 1992
            R + H N+  F G       + ++ + C KG+L  IL N  + L      SL  DIV GM YLH  +I  HG L S NC +D +W +KI D+  GL                        NK +   +  + E   ++   + W APE++   +       K DVYSFGII+ E+  R  PF D  +  +   D+IE++   +  PF
Sbjct:   43 RTVRHENLVTFTGACVEPPNICILLQYCPKGSLQDILENEDIKLDSMFVNSLLTDIVKGMAYLHSTEIRSHGRLKSPNCVVDGRWVLKITDY--GL------------------------NKFKSNQDISEEEGEYAMYYRKLWTAPELLRAADPRPRGTQKGDVYSFGIIVQELLTRSGPF-DLSYYTNEPSDIIEKVTRVESPPF 222          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO30985 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SZ80])

HSP 1 Score: 246.899 bits (629), Expect = 4.279e-85
Identity = 121/264 (45.83%), Postives = 186/264 (70.45%), Query Frame = 2
Query: 2015 RPTFSSIRKSIK-LANPS--KKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDK-QIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFL 2794
            RP F+ I+K+++ + + S  KK++ D+M++ ++ Y  NLE++V  RT ++   ++K   LL  +LP  V ++L K + V  E +  V++YFSDIVGFTS+S+E TPMQVV  LN LY++FD I+++ DVYKVETIGDAY V+SG+P RNG +H  EI + +L +V++V + + + H  + ++ +R+G HTG VVAGVVGN M R+CLFGDTVNTASRMES G  ++I  S++   +++E   +    RG++ +KGKG+  T++L
Sbjct:  230 RPDFTEIKKTVRRIVDKSGMKKNIFDNMVNMMEIYADNLENLVAQRTDQLVDEKRKTDALLESILPRPVAEQLKKGKAVEAESFNEVTIYFSDIVGFTSLSAESTPMQVVTFLNDLYTIFDDIIQEYDVYKVETIGDAYMVASGLPIRNGRRHAGEIAKMALHLVDAVSHNFIVRHKPEYKLQLRVGCHTGPVVAGVVGNTMARYCLFGDTVNTASRMESNGEPLRIHISQQTKDVLDELGTFVVKSRGKVHLKGKGTVETFWL 493          

HSP 2 Score: 87.8113 bits (216), Expect = 4.279e-85
Identity = 65/220 (29.55%), Postives = 99/220 (45.00%), Query Frame = 1
Query: 1336 NFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPF 1992
            + S +    + + R + H N+  F G       + ++ + CS+G+L  IL N  V L      SL +DIV GMEYLH   I  HG+L S NC +D +W +KI D+ + LL                     S++K   I  N+         R   W APEI+ + +       K DVYSF IIL E   R+ P+     +  +   +IE++   +  P+
Sbjct:   14 DISRQLLLEMKQMRDIRHDNLNQFIGACVGPPNVCIVMQYCSRGSLQDILENDDVKLDLVFIASLLSDIVKGMEYLHNSDIRSHGNLKSSNCLVDSRWVLKITDYGLPLL--------------------RSRSKKSTIETNW---------RDLLWVAPEILRIPSRPPKGTHKGDVYSFSIILQEFHTRDGPYSANYMEPKA---IIEKVRKSEFPPY 201          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36203 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA1])

HSP 1 Score: 243.432 bits (620), Expect = 2.735e-79
Identity = 118/221 (53.39%), Postives = 162/221 (73.30%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVA 2674
            RPTFS I++ ++L    K S++D+M+  +++Y   LE +V  RT+++   + K   LLY+MLP  + + L + EPVI E Y SV+++FSDIVGFT +++  TP+QVVD+LN LY+ FD+I++K+DVYKVETIGDAY V SG+P RNG +H  EI   +L ++ S+ N +R  H  ++ I +RIGIHTGS VAGVVG KMPR+CLFGDTVN ASRMESTGV 
Sbjct:  301 RPTFSDIKRQLRLLKGGKSSIVDNMLRLMENYTEQLETIVDERTRQLADEKAKTDELLYKMLPRYIAESLKRGEPVIAESYSSVTIFFSDIVGFTELAAASTPLQVVDLLNDLYTCFDTIIDKHDVYKVETIGDAYMVVSGLPVRNGHRHAGEIATMALNLLSSMGN-FRARHLPNRPIHLRIGIHTGSCVAGVVGLKMPRYCLFGDTVNYASRMESTGVG 520          

HSP 2 Score: 72.0182 bits (175), Expect = 2.735e-79
Identity = 61/214 (28.50%), Postives = 96/214 (44.86%), Query Frame = 1
Query: 1363 LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSE-ALKSLNRHRFWQAPEIIHLENYLES--ANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPF 1992
            + + R + H+N+ ++ G+      + ++++ C +G+L  IL N  ++L    + S A DI  GM  +H   I +HG L S  C +D +W  K+AD+ + LL             + N  P              D E  + +     FW+APE++  E            DVYSFGIIL E+  RE P+    F      +VIE+I      PF
Sbjct:   90 MKQVRDVQHTNLLHYIGVCTTPPNICIVSQYCHRGSLQEILANDEISLDWFFRESFANDIAMGMHVIHTSSIHVHGDLRSSKCLIDSRWVCKVADFGLNLL-------------KANQRP--------------DPEIGVHAQYSRLFWRAPELLQNEKSTNKPVPTQMGDVYSFGIILNELLTREEPYATTEFAPI---EVIERIRCHLNPPF 273          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO27923 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7T7X3])

HSP 1 Score: 255.373 bits (651), Expect = 3.913e-79
Identity = 123/252 (48.81%), Postives = 182/252 (72.22%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKK-SVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVK 2764
            RPTFS+I+K +K     K  +++D+MI  +  Y   LED+V+ RTK++ + + K   LLY+MLP  + D+L K  PV  E ++SV+++FSDIVGFTS++++ TP+QVVD+LN+LY+ FD +V+++DVYKVETIGDAY V SG+P RNG +H  E+   +L ++  VR+ ++IPH   +++ +RIGIH+GS VAGVVG KMPR+CLFGDTVN ASRMES+G+A++I  S +   +++    Y    RG + +K
Sbjct:  179 RPTFSAIKKKLKANGMGKNLNIVDNMITMMAKYTDQLEDIVEERTKQLAEEKAKTDELLYKMLPRPIADELKKGNPVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRD-FQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMK 429          

HSP 2 Score: 59.6918 bits (143), Expect = 3.913e-79
Identity = 55/174 (31.61%), Postives = 82/174 (47.13%), Query Frame = 1
Query: 1480 ILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKT---DVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQP 1989
            +L N  + L    + S A DI +GME +H   I  HG+L S NC +D +W  KI D+ + LL             R N  P++                  ++ R+ FW  PE++ L +  +    KT   DVYS+GI+L EI  R+ P+       SS +DVIE +  K+ +P
Sbjct:    2 LLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLL-------------RANQTPKDIGEF--------------AVYRNLFWTVPELLPLADGFKDHKNKTQAGDVYSYGIVLYEIITRDEPYSTNTDTLSS-KDVIE-LVRKRQEP 146          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36182 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA4])

HSP 1 Score: 228.409 bits (581), Expect = 3.373e-77
Identity = 122/264 (46.21%), Postives = 175/264 (66.29%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RPTFS+I+K +K AN      +  M      Y  N   +V  R          +K LL  +L   + D+L K   V  E ++SV+++FSDIVGFTS++++ TP+QVVD+LN+LY+ FD +V+++DVYKVETIGDAY V SG+P RNG +H  E+   +L ++  VR+ ++IPH   +++ +RIGIH+GS VAGVVG KMPR+CLFGDTVN ASRMES+G+A++I  S +   +++    Y    RG + +KGKG+  TYFL G+
Sbjct:  217 RPTFSAIKKKLK-ANGMGNGKISGM---FSRYYNNFSKLVISRMGVC----MALKRLL--VLSRPIADELKKGNSVSAESFQSVTIFFSDIVGFTSVAAQSTPLQVVDLLNQLYTRFDKVVDEHDVYKVETIGDAYMVVSGLPVRNGERHAGEVASMALNLLSEVRD-FQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMKGKGTIVTYFLTGK 469          

HSP 2 Score: 80.1073 bits (196), Expect = 3.373e-77
Identity = 63/209 (30.14%), Postives = 102/209 (48.80%), Query Frame = 1
Query: 1375 RALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKT---DVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQP 1989
            R L+H+N+  + G+      + +++  C++G L  +L N  + L    + S A DI +GME +H   I  HG+L S NC +D +W  KI D+ + LL             R N  P++                  ++ ++ FW APE++ L +  +    KT   DVYS+GI+L EI  R+ P+       SS +DVIE +  K+ +P
Sbjct:    5 RDLHHANLNRYLGVCVESPNICMVSRFCNRGTLQDLLGNDSIKLDWMFRQSFANDIATGMEAIHNSPIQAHGNLKSSNCLIDSRWACKITDYGLDLL-------------RANQTPKDIGEF--------------AVYKNLFWTAPELLPLADGFKDRKNKTQAGDVYSYGIVLYEIITRDEPYSTNTDTLSS-KDVIE-LVRKRQEP 184          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 263.077 bits (671), Expect = 1.210e-89
Identity = 133/266 (50.00%), Postives = 186/266 (69.92%), Query Frame = 2
Query: 2015 RPTFSSIRKSI-KLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP F  I+  + KL      S+L++++  ++ Y  NLE++V+ RT+   + ++K +NLLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFTS+S+E TP+QVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG  H  EI   SL ++E V+  ++I H  + Q+ +RIGIHTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S     +++E+  +    RG +E+KGKG   TY+L G +
Sbjct:  785 RPDFGHIKIYMAKLNKEGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKT-FKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGEK 1049          

HSP 2 Score: 88.9669 bits (219), Expect = 1.210e-89
Identity = 87/326 (26.69%), Postives = 144/326 (44.17%), Query Frame = 1
Query: 1039 NTTDKILKIALPIVSMFII----ALFIF--VGYVFYKQ---QKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLN--------LSNDDKNVEILFKS--FENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDV 1956
            +T D      LP++ +  +    AL IF    ++ Y++   +K++   +W++ +E L   +      R  SR+TL+        L       ++  K+  F+ N V + + N    R   + +    L   R +  +++  F G       + ++TE C +G+L  IL N  + L    ++SL  DIV GM +LH      HG+L S NC +D ++ +KI D+ +              S R++               N DS AL +    + W APE++  +++      K DVYSFGIIL EI +R  PF  E    S  E V
Sbjct:  452 STDDPSCNDGLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRVQWEDLQFESPNKYHKRAGSRLTLSQRGSSYGSLITAQGKYQLFAKTGYFKGNLVAIKHVNK--KRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLA-------------SFRSS-------------CENDDSHALYA---KKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMDLSPKEIV 746          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 263.077 bits (671), Expect = 1.382e-89
Identity = 133/266 (50.00%), Postives = 186/266 (69.92%), Query Frame = 2
Query: 2015 RPTFSSIRKSI-KLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RP F  I+  + KL      S+L++++  ++ Y  NLE++V+ RT+   + ++K +NLLYQ+LP SV ++L + E V  E ++SV++YFSDIVGFTS+S+E TP+QVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG  H  EI   SL ++E V+  ++I H  + Q+ +RIGIHTG V AGVVG KMPR+CLFGDTVNTASRMES G A+KI  S     +++E+  +    RG +E+KGKG   TY+L G +
Sbjct:  733 RPDFGHIKIYMAKLNKEGSTSILNNLLSRMEQYANNLENLVEERTQAYLEEKRKAENLLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTSMSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHAREIASMSLALLEQVKT-FKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWLLGEK 997          

HSP 2 Score: 88.5817 bits (218), Expect = 1.382e-89
Identity = 87/326 (26.69%), Postives = 144/326 (44.17%), Query Frame = 1
Query: 1039 NTTDKILKIALPIVSMFII----ALFIF--VGYVFYKQ---QKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLN--------LSNDDKNVEILFKS--FENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQI-IHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDV 1956
            +T D      LP++ +  +    AL IF    ++ Y++   +K++   +W++ +E L   +      R  SR+TL+        L       ++  K+  F+ N V + + N    R   + +    L   R +  +++  F G       + ++TE C +G+L  IL N  + L    ++SL  DIV GM +LH      HG+L S NC +D ++ +KI D+ +              S R++               N DS AL +    + W APE++  +++      K DVYSFGIIL EI +R  PF  E    S  E V
Sbjct:  400 STDDPSCNDGLPVLGIVAVGSGLALIIFGISSFLIYRKLKLEKELAGMLWRVQWEDLQFESPNKYHKRAGSRLTLSQRGSSYGSLITAQGKYQLFAKTGYFKGNLVAIKHVNK--KRIELTRQVLMELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCPRGSLQDILENESINLDWMFRYSLINDIVKGMNFLHNSYFGCHGNLKSSNCVVDSRFVLKITDYGLA-------------SFRSS-------------CENDDSHALYA---KKLWTAPELLIYDHHPPQGTQKGDVYSFGIILQEIALRNGPFYVESMDLSPKEIV 694          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc-r2 (guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:100216004])

HSP 1 Score: 261.922 bits (668), Expect = 1.632e-85
Identity = 136/266 (51.13%), Postives = 183/266 (68.80%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPH-NDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYN-KYTFTCRGQIEVKGKGSQTTYFLEGR 2803
            RPTF  I    K  N  +K+ ++DSM+  L+ Y  NLE++++ RT+E+E  ++K + LL QMLP SV + L     V PEY++SVSLYFSDIVGFT+IS+   P++VVD+LN LY+LFD+I+  +DVYKVETIGDAY V+SGVP  N  +H  EI   SL I+ +V   +++ H  D  + +RIG+HTG  VAGVVG  MPR+CLFGDTV TASRMES+G+  +I   E    ++ E N  Y    RG+ EVKGKG++ TY+L GR
Sbjct:  806 RPTFDDIFDQFKNINKGRKTNIIDSMLRMLEQYSSNLEELIRERTEELEIEKQKTEKLLTQMLPPSVAEALMVGGTVKPEYFDSVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTLFDAIIGNHDVYKVETIGDAYMVASGVPVPNANRHAAEIANMSLDILSAV-GTFKMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVTTASRMESSGMPYRIHVHESIVKVLKELNLGYKLELRGRTEVKGKGTEETYWLVGR 1070          

HSP 2 Score: 75.8702 bits (185), Expect = 1.632e-85
Identity = 76/292 (26.03%), Postives = 130/292 (44.52%), Query Frame = 1
Query: 1165 ISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLG----LSRANFS---WKFRATLNKYRALNHSNICNFAGITFHDERLW-LITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITP 2016
            +S +KL  + SR++  R++S  + N     ++      ++EN+N+ +   +      L   NF     K        + + H NI  F G  FHD  ++ ++TE CS+G+L  +L N  V L    K SL  D++ GM+YLH + + H  L S NC +D ++ +K+ D+    + ++ +                      P +     E L        W APE++          L  DVYSF II+ E+ IR  PF   +   S  E +IE++   +  P +   +++P
Sbjct:  533 LSNKKLSLDDSRTSGGRSLSECSQNTPLSSQSP----ATYENSNIVIYEGDWAWLKRLPNGNFGSINPKTSDVFELMKDMRHENINPFLGF-FHDCGVFAIVTEFCSRGSLEDLLLNDDVKLDWMFKSSLLLDLIKGMKYLHHRGVCHTRLKSRNCVVDGRFVLKVTDYGYNEVLESQRF---------------------PYAEERPEELL--------WTAPEVLRSGQAGLHGTLPADVYSFAIIMQEVVIRGPPFC--MLDLSDAE-IIEKV---RRPPPLCRPVVSP 784          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc8 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100049174])

HSP 1 Score: 276.174 bits (705), Expect = 4.084e-79
Identity = 137/265 (51.70%), Postives = 178/265 (67.17%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDK-QIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRR 2806
            RPTF  I+K +   NP K S +D M++ ++ Y  +LE +V  RT+++   ++K   LLY MLP  V D L + +P   + Y S +++FSDIVGFT +SS  TP QVVD LN+LY+ FD+I++  DVYKVETIGDAY V SGVP  NGI H  EI   +L +V  V   +RIPH    Q+ +R GIH+G VVAGVVG KMPR+CLFGDTVNTASRMEST  A+KIQ S   + L+ E   Y   CRG  +VKGKG   TY+L+G++
Sbjct:  554 RPTFEQIKKFVHRINPIKVSPVDMMMNLMEKYSKHLEVLVAERTQDLTHEKQKTDRLLYSMLPKQVADDLRQGKPSQAQSYVSATVFFSDIVGFTQLSSSSTPYQVVDFLNKLYTTFDNIIDNYDVYKVETIGDAYMVVSGVPQENGILHASEIASMALDLV-GVCQTFRIPHKPSMQLQIRAGIHSGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSTALKIQCSSSTFYLLEEIGGYVLECRGVQQVKGKGDMVTYWLQGKK 817          

HSP 2 Score: 101.679 bits (252), Expect = 1.332e-21
Identity = 81/313 (25.88%), Postives = 139/313 (44.41%), Query Frame = 1
Query:  850 FIEWILTNSQADQIAITKKMVPLSKSMRNLIYN--NILMKTTCESDSKLVKTLV------DNQKFNEILSSNTTD------KILKIALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNT-SRSNLLRTMSRVTLNLSNDDKNVEILF--------KSFENNNVFMTNTNLGLSRA---------NFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLS 1692
            F   I T+ +  Q   T K+V L   + +LI +    +M+   E+ S ++  +V      +  +F     ++  D        + I+LP VS+F ++  +   ++ Y+++K + +  W I +  +  +  SR  +   MS   + + N D N   L                   T    G + A         + S   R  + + R L+H N+C F G       + +ITE C KG+L  +L N  + ++   +FS AADI  GM YLH+ +I HG L S+NC LD +W  KI D+ + +  +    + LS
Sbjct:  153 FTHTISTSGKMSQTNWTAKVVLLHAGLTSLIAHIRVGIMQAALEAKSTVLPAMVCGNNVCEEGEFCSTCPADCGDCPMTMTTKMAISLP-VSLFCLSFILTAVWLRYQKEKLLWDESWIIDFSMIKQDQESRMTMGSIMS---VPVGNCDSNTSCLTGLNSCTGQPGTRKTPFICTGIYDGRTVAIKIIQTKMFSLSKTIRQEVKQVRELDHPNLCKFIGGCIEVPNIAIITEYCPKGSLNDVLLNEEIPINWGFRFSFAADIARGMSYLHQHKICHGRLKSMNCVLDDRWVCKITDYGLRMYRRDDGTEPLS 461          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 268.855 bits (686), Expect = 1.093e-75
Identity = 131/264 (49.62%), Postives = 192/264 (72.73%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS-VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP F++I+  ++  +    S +LD+++  ++ Y  NLE++V+ RT+   + ++K + LLYQ+LP SV D+L + E V  E ++SV++YFSDIVGFT++S+E TP+QVV +LN LY+ FD+I++  DVYKVETIGDAY V SG+P RNG  H  E+   +L ++++V++ ++I H   +Q+ +RIG+H+G V AGVVG KMPR+CLFGDTVNTASRMESTG A+KI  SE    ++ E+N +    RG+IEVKGKG   TY+L+G
Sbjct:  728 RPDFNTIKILLRKQHRGYGSNILDNLLSRMEQYANNLEELVEERTQAYNEEKRKAEALLYQILPHSVADQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLHGREVARMALALLDAVKS-FKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWLQG 990          

HSP 2 Score: 80.8777 bits (198), Expect = 4.725e-15
Identity = 66/261 (25.29%), Postives = 118/261 (45.21%), Query Frame = 1
Query: 1129 KQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSND--------DKNVEILFKS--FENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQII-HGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFG 1878
            K + ++   +W++S+  +  +     L R  SR+T+++           + N++I  K+  ++ N V +   N    R   +      L   R +++ ++  F G       + +ITE C +G+L  ++ +  +TL    ++SL  DIV GM +LH   I  HG+L S NC +D ++ +KI D+  GL           +S+R +  P              D+ A  +    + W APE++  E+       K DVYSFG
Sbjct:  434 KLENELAAQLWRVSWVDIQMSNLDKVLRRACSRLTISMKGSNYGSLMTMEGNLQIYTKTGYYKGNLVAIKYINK--KRIELTRNVLFELKHMRDVHNEHLTRFIGACVDPPNMCIITEYCPRGSLQDLMESESMTLDWMFRYSLINDIVKGMTFLHNSVIFSHGNLKSSNCVVDSRFVLKITDY--GL-----------QSLRTSSCPD-------------DTHAYYA---RKLWTAPELLRTEDPPLCGTQKGDVYSFG 663          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000054503.1 (SMESG000054503.1)

HSP 1 Score: 1350.5 bits (3494), Expect = 0.000e+0
Identity = 670/673 (99.55%), Postives = 670/673 (99.55%), Query Frame = 1
Query:    1 AGFPRTVYQEWLIAFIANRSAYVSLTGKYDFVGSGQGQLMILDPKTNKIVFSGSDTGISNETQLKQPYLQLVPTIAGALVIAHNVPESSGINGITMSRDVLAKIFMGNISFWNHAEIQYLNPTKSLPNEKIIIIVREDDSGTTFKMTSALSSFSKEWKTRYGIFSVNSGWNNSLIKFYGYQTNTVAGMIRAIRYSISYLSETDLYNFNLSSCLLINRRNQSIAASSDSVYAAMEAQSKLNVDPFNEDMIDIDADFAYPIATFTNIIIYIAGFWSCDLMIEMFRFIEWILTNSQADQIAITKKMVPLSKSMRNLIYNNILMKTTCESDSKLVKTLVDNQKFNEILSSNTTDKILKIALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITPT 2019
            AGFPRTVYQEWLIAFIANRSAYVSLTGKYDFVGSGQGQLMILDPKTNKIVFSGSDTGISNETQLKQPYLQLVPTIAGALVIAHNVPESSGINGITMSRDVLAKIFMGNISFWNHAEIQYLNPTKSLPNEKIIIIVREDDSGTTFKMTSALSSFSKEWKTRYGIFSVNSGWNNSLIKFYGYQTNTVAGMIRAIRYSISYLSETDLYNFNLSSCLLINRRNQSIAASSDSVYAAMEAQSKLNVDPFNEDMIDIDADFAYPIATFTNIIIYIAGFWSCDLMIEMFRFIEWILTNSQADQIAIT KMVPLSKSMRNLIYNNILMKTTCESDSKLVKTLVDNQKFNEILSSNTTDKILKIALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRA LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGIILIEIWIREIPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITP 
Sbjct:   25 AGFPRTVYQEWLIAFIANRSAYVSLTGKYDFVGSGQGQLMILDPKTNKIVFSGSDTGISNETQLKQPYLQLVPTIAGALVIAHNVPESSGINGITMSRDVLAKIFMGNISFWNHAEIQYLNPTKSLPNEKIIIIVREDDSGTTFKMTSALSSFSKEWKTRYGIFSVNSGWNNSLIKFYGYQTNTVAGMIRAIRYSISYLSETDLYNFNLSSCLLINRRNQSIAASSDSVYAAMEAQSKLNVDPFNEDMIDIDADFAYPIATFTNIIIYIAGFWSCDLMIEMFRFIEWILTNSQADQIAITNKMVPLSKSMRNLIYNNILMKTTCESDSKLVKTLVDNQKFNEILSSNTTDKILKIALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSRSNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWKFRAMLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGIILIEIWIREIPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITPV 697          

HSP 2 Score: 216.853 bits (551), Expect = 1.033e-58
Identity = 106/107 (99.07%), Postives = 107/107 (100.00%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVV 2335
            RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQV+
Sbjct:  712 RPTFSSIRKSIKLANPSKKSVLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVI 818          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 278.87 bits (712), Expect = 6.835e-95
Identity = 135/265 (50.94%), Postives = 191/265 (72.08%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS--VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP F +I+  ++  N    S  +LD+++  ++ Y  NLE++V  RT++  + ++K ++LLY MLP SV  +L + E V  E YE VS+YFSDIVGFT++S+E TPMQV+++LNRLY+ FDSI+E  DVYKVETIGDAY V SG+P RNG  H+ EI   SL  + ++   ++IPH  +K++ +RIGIH+G V AGVVG KMPR+CLFGDTVNTASRMES G+ +KI  SE++  ++  + ++  + RGQ+ +KGKG QTTY+L G
Sbjct:  778 RPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFE-FQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHG 1041          

HSP 2 Score: 89.7373 bits (221), Expect = 6.835e-95
Identity = 70/225 (31.11%), Postives = 108/225 (48.00%), Query Frame = 1
Query: 1363 LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIH--LENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITPTNVFV 2031
            + K + LN+ +IC F G+     + WL+TE C KG+L  IL N  + L    KFSL  DI  GM YLH     HG+L S NC +D ++ +KI D+ +  L + TK  +L                    ++ Y      +  R+  W APEI+    E +L+ +  K DVYSFGII  E+      +R+ +F  S +      +  K++  F++   + P   F+
Sbjct:  566 VKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKL-RGTKEYLLE-------------------NDEY------AYYRNLLWTAPEILRKTTEIHLQKST-KADVYSFGIICQEVV-----YRNGVFYLSDI-----NLEPKQIVEFVTKVQLIPYRPFL 753          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000068881.1 (SMESG000068881.1)

HSP 1 Score: 278.87 bits (712), Expect = 7.242e-95
Identity = 135/265 (50.94%), Postives = 191/265 (72.08%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS--VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP F +I+  ++  N    S  +LD+++  ++ Y  NLE++V  RT++  + ++K ++LLY MLP SV  +L + E V  E YE VS+YFSDIVGFT++S+E TPMQV+++LNRLY+ FDSI+E  DVYKVETIGDAY V SG+P RNG  H+ EI   SL  + ++   ++IPH  +K++ +RIGIH+G V AGVVG KMPR+CLFGDTVNTASRMES G+ +KI  SE++  ++  + ++  + RGQ+ +KGKG QTTY+L G
Sbjct:  837 RPDFRTIKGMMRYLNKGGDSGNILDNLLSRMEQYANNLEELVNQRTEQYLEEKRKTEDLLYSMLPKSVAGQLIRNETVTAESYEMVSIYFSDIVGFTALSAESTPMQVIELLNRLYTTFDSIIESFDVYKVETIGDAYMVCSGLPQRNGDIHIREIARMSLAFLSAIFE-FQIPHKPNKRVELRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGLPLKIHMSEQSVDVLRTFQRFIISKRGQVNMKGKGYQTTYWLHG 1100          

HSP 2 Score: 89.7373 bits (221), Expect = 7.242e-95
Identity = 70/225 (31.11%), Postives = 108/225 (48.00%), Query Frame = 1
Query: 1363 LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIH--LENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISSSMITPTNVFV 2031
            + K + LN+ +IC F G+     + WL+TE C KG+L  IL N  + L    KFSL  DI  GM YLH     HG+L S NC +D ++ +KI D+ +  L + TK  +L                    ++ Y      +  R+  W APEI+    E +L+ +  K DVYSFGII  E+      +R+ +F  S +      +  K++  F++   + P   F+
Sbjct:  625 VKKVKNLNNEHICRFIGVCLDAPQHWLLTEYCPKGSLQDILENEQINLDWMFKFSLLQDICRGMIYLHSNIGPHGNLKSSNCLVDSRFVLKICDFGLEKL-RGTKEYLLE-------------------NDEY------AYYRNLLWTAPEILRKTTEIHLQKST-KADVYSFGIICQEVV-----YRNGVFYLSDI-----NLEPKQIVEFVTKVQLIPYRPFL 812          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000019264.1 (SMESG000019264.1)

HSP 1 Score: 269.24 bits (687), Expect = 2.091e-92
Identity = 131/265 (49.43%), Postives = 185/265 (69.81%), Query Frame = 2
Query: 2015 RPTFSSIRKSIKLANPSKKS--VLDSMIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKEPVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKNDVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN-DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEG 2800
            RP F  I+ S++  +  K+S  +LD+++  ++ Y  NLE +V  RT+E  + +K+ ++LLY MLP SV  +L K + V  E YE V++YFSDIVGFTS+S++ TPMQV+++LNRLY+ FDSI+E  DVYKVETIGDAY V SG+PN NG  H  EI    L  + ++   + IPH  + Q+ +RIG+H+G V AGVVG+KMPR+CLFGDTVNT+SRMES G+ +KI  S     ++  +  +  + RG++E+KGKG Q TY+L G
Sbjct:  888 RPDFPGIKNSMRKIDKGKESGNILDNLLSRMEQYANNLEGLVAQRTQEYLEEKKRAEDLLYSMLPKSVAHQLIKNQSVSAESYEQVTIYFSDIVGFTSLSADSTPMQVIELLNRLYTTFDSIIENFDVYKVETIGDAYMVVSGLPNVNGRNHAREIARMCLQFLSAIFR-FVIPHRPNTQLELRIGVHSGPVCAGVVGHKMPRYCLFGDTVNTSSRMESNGLPLKIHISHSTMEVLKSFQTFIMSERGEVEMKGKGKQLTYWLHG 1151          

HSP 2 Score: 91.2781 bits (225), Expect = 2.091e-92
Identity = 70/234 (29.91%), Postives = 106/234 (45.30%), Query Frame = 1
Query: 1318 LGLSRANFSWKFRAT------LNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGVTLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWPIGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRFWQAPEIIHLENYLESANLKTDVYSFGXXXXXXXXXXXPFRDEIFKASSVEDVIEQIASKKLQPFISS 2001
            + L + N   KF  T      + K + LN+ +IC F G+       +L+ E C KG+L  +L N  + L    + SL  DIV GM YLH     HGHL S NC +D ++ +K+ D+ + +L +  K                 +N  E  S+ Y  + L        W +PEI+  +       +K DVYSF II  EI  R   F  +   +   ++++E + S K  PF  S
Sbjct:  654 VALKKINTGRKFETTKEMLLDIKKIKDLNNDHICRFIGMCVEPLHQYLVYEYCPKGSLEDLLENEQINLDWMFRLSLIQDIVRGMIYLHSNYGCHGHLKSSNCVVDSRFVLKLTDFGLNILREIQK-----------------ENSNEEPSHEYYKKML--------WTSPEILRTQTLPFIGTVKGDVYSFAIIAQEIIYRRGVFAVDNCDSKDPKEIVESVKSSKHVPFRPS 862          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000054505.1 (SMESG000054505.1)

HSP 1 Score: 279.641 bits (714), Expect = 1.535e-88
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 2
Query: 2414 DAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 2809
            DAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA
Sbjct:   28 DAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA 159          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR12.927e-9349.44natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
NPR22.611e-8949.62natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
GUCY2D2.333e-8051.20guanylate cyclase 2D, retinal [Source:HGNC Symbol;... [more]
GUCY2C1.676e-7345.02guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:... [more]
GUCY2F5.661e-7351.12guanylate cyclase 2F, retinal [Source:HGNC Symbol;... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-98.478e-7948.69Receptor-type guanylate cyclase gcy-9 [Source:Uni... [more]
gcy-212.491e-7341.57Receptor-type guanylate cyclase gcy-21 [Source:Un... [more]
gcy-183.091e-7344.91Receptor-type guanylate cyclase gcy-18 [Source:Un... [more]
gcy-111.893e-7146.56Receptor-type guanylate cyclase gcy-11 [Source:Un... [more]
gcy-282.225e-7148.50Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG426373.883e-8649.06gene:FBgn0261360 transcript:FBtr0302277[more]
CG426373.883e-8649.06gene:FBgn0261360 transcript:FBtr0302279[more]
CG426373.883e-8649.06gene:FBgn0261360 transcript:FBtr0302278[more]
Gyc76C3.883e-8649.06gene:FBgn0266136 transcript:FBtr0333879[more]
Gyc76C3.883e-8649.06gene:FBgn0266136 transcript:FBtr0302282[more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-37g12.12.398e-8949.06si:dkey-37g12.1 [Source:ZFIN;Acc:ZDB-GENE-090312-1... [more]
npr25.322e-8949.81natriuretic peptide receptor 2 [Source:ZFIN;Acc:ZD... [more]
gucy2d7.479e-8950.75guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
gucy2d7.993e-8950.75guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
gucy2d9.282e-8950.75guanylate cyclase 2D, retinal [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000002946.11.984e-8749.06retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
ENSXETT00000002882.12.102e-8749.06retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
ENSXETT00000002786.12.265e-8749.06retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
GUCY2F2.539e-8648.69guanylate cyclase 2F, retinal [Source:NCBI gene;Ac... [more]
GUCY2F2.900e-8648.69guanylate cyclase 2F, retinal [Source:NCBI gene;Ac... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npr15.385e-9449.06natriuretic peptide receptor 1 [Source:MGI Symbol;... [more]
Npr23.310e-8949.25natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr22.908e-8849.25natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Gucy2e1.988e-8550.00guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:10... [more]
Gucy2e1.988e-8550.00guanylate cyclase 2e [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18910|ANPRA_RAT1.769e-9349.44Atrial natriuretic peptide receptor 1 OS=Rattus no... [more]
sp|P18293|ANPRA_MOUSE3.299e-9349.06Atrial natriuretic peptide receptor 1 OS=Mus muscu... [more]
sp|P16066|ANPRA_HUMAN1.299e-9249.44Atrial natriuretic peptide receptor 1 OS=Homo sapi... [more]
sp|P46197|ANPRB_BOVIN5.865e-8949.62Atrial natriuretic peptide receptor 2 OS=Bos tauru... [more]
sp|P20594|ANPRB_HUMAN1.159e-8849.62Atrial natriuretic peptide receptor 2 OS=Homo sapi... [more]
back to top
BLAST of Guanylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W0X7Y76.718e-11647.53Guanylate cyclase 2G OS=Hypsibius dujardini OX=232... [more]
R7U1S31.346e-9853.26Guanylate cyclase OS=Capitella teleta OX=283909 GN... [more]
A0A091GYS27.425e-9450.75Guanylate cyclase (Fragment) OS=Buceros rhinoceros... [more]
A0A402FHC08.326e-9449.62Guanylate cyclase OS=Paroedura picta OX=143630 GN=... [more]
A0A091SRJ28.604e-9450.75Guanylate cyclase (Fragment) OS=Pelecanus crispus ... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000020840.22.731e-8750.37retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:1... [more]
gucy2f3.683e-8750.00retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
gucy2f3.714e-8750.00retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
gc26.305e-8650.38retinal guanylyl cyclase 2 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000016107.25.497e-8454.34pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008986.14.823e-8449.62pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
ENSPMAT00000002650.14.232e-7849.62pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 ge... [more]
ENSPMAT00000006352.11.537e-7550.00pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
NPR11.370e-7345.76natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000008976.12.463e-7049.81pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC155.071e-824.55Protein kinase of the Mitotic Exit Network; locali... [more]
STE119.097e-825.13Signal transducing MEK kinase; involved in pheromo... [more]
CDC51.282e-726.00Polo-like kinase; controls targeting and activatio... [more]
GIN42.037e-731.86Protein kinase involved in bud growth and assembly... [more]
CLA45.038e-727.81Cdc42p-activated signal transducing kinase; member... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO342751.811e-9151.32Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309854.279e-8545.83Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362032.735e-7953.39Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279233.913e-7948.81Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361823.373e-7746.21Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr21.210e-8950.00natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
npr21.382e-8950.00natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
olgc-r21.632e-8551.13guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:10... [more]
olgc84.084e-7951.70membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc71.093e-7549.62membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054503.11.033e-5899.55SMESG000054503.1[more]
SMESG000068881.16.835e-9550.94SMESG000068881.1[more]
SMESG000068881.17.242e-9550.94SMESG000068881.1[more]
SMESG000019264.12.091e-9249.43SMESG000019264.1[more]
SMESG000054505.11.535e-88100.00SMESG000054505.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000341 ID=SMED30000341|Name=Guanylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=2836bp
GCTGGATTCCCAAGAACAGTTTACCAAGAATGGCTAATTGCATTTATCGC
TAATAGAAGTGCATATGTTTCTTTGACTGGCAAATACGATTTCGTGGGCA
GTGGACAAGGCCAATTGATGATCTTGGATCCAAAGACGAATAAAATTGTA
TTTAGTGGTTCCGATACTGGTATTTCCAACGAAACTCAGTTGAAGCAACC
TTACCTTCAATTGGTCCCTACTATCGCTGGAGCCCTCGTTATTGCACATA
ACGTTCCAGAATCCAGTGGGATAAATGGAATAACAATGTCTAGAGATGTT
CTAGCGAAAATCTTTATGGGAAATATATCATTTTGGAATCATGCAGAAAT
TCAATATCTAAACCCTACAAAAAGTTTACCAAATGAGAAAATTATTATTA
TTGTCAGAGAAGATGACAGCGGAACAACATTTAAAATGACTTCTGCATTG
TCATCTTTCAGTAAAGAATGGAAAACCAGATACGGAATATTTTCTGTTAA
TAGTGGTTGGAATAATTCTCTAATAAAATTTTACGGTTATCAAACAAATA
CTGTTGCCGGAATGATTAGAGCTATCCGATACTCAATTAGTTATCTTTCA
GAGACCGATTTATATAATTTCAATCTCTCCTCCTGTCTGTTAATAAATAG
GAGAAACCAATCAATCGCAGCCTCTTCTGATTCGGTGTACGCAGCAATGG
AGGCCCAATCAAAACTCAATGTCGATCCATTCAATGAGGACATGATCGAT
ATCGATGCGGATTTTGCTTATCCAATCGCAACCTTTACAAATATTATTAT
CTATATCGCCGGATTTTGGAGTTGTGATTTAATGATTGAAATGTTCAGAT
TTATTGAATGGATCCTCACCAACAGTCAAGCCGATCAAATAGCAATTACA
AAAAAAATGGTTCCTCTCTCAAAATCAATGAGAAATTTAATTTACAATAA
TATTTTAATGAAAACTACGTGTGAAAGTGATTCTAAATTAGTGAAAACTT
TGGTTGATAATCAAAAATTCAATGAAATTCTAAGCAGTAATACTACTGAC
AAAATTCTTAAAATCGCTTTACCGATTGTTTCAATGTTTATTATTGCACT
ATTTATTTTTGTTGGATATGTATTCTATAAGCAACAGAAAGATATCATTA
ACAATGTATGGAAAATCTCGTATGAAAAATTAGACACCAACACGTCTCGT
TCGAATCTTTTACGTACAATGTCTCGGGTCACTTTAAACTTATCTAATGA
TGACAAAAATGTTGAAATCTTGTTCAAATCATTTGAGAATAATAACGTTT
TTATGACAAATACAAACCTCGGACTATCTCGAGCGAATTTTTCTTGGAAG
TTCAGAGCCACGCTGAACAAATATCGTGCTCTAAATCACTCTAATATTTG
CAACTTTGCAGGAATTACATTCCACGACGAAAGATTATGGTTGATTACGG
AAAATTGCAGCAAAGGAAACTTATATCACATACTTCACAATTCAGGAGTA
ACATTGAGTGATTCGGTCAAATTTTCTCTTGCTGCCGACATAGTATCCGG
CATGGAATATTTGCACCGGCAGCAAATAATCCACGGTCATTTGTCATCAT
TAAATTGTTATCTGGATAAAAAATGGAACGTAAAAATTGCAGACTGGCCA
ATTGGGCTTCTTTTTAAAGCCACCAAAATAAAGGTTTTGTCGAAATCAAT
GAGAAATAATGGCAACCCACAGAATTCCAAAAATAAAATCGAACCGATTT
CAAATAATTACGACAGTGAAGCATTGAAATCCCTGAATCGTCACAGATTT
TGGCAAGCTCCTGAAATAATACACCTCGAAAACTACTTGGAATCGGCGAA
CTTGAAAACTGATGTTTATAGTTTCGGGATTATCCTTATAGAAATTTGGA
TTAGAGAAATCCCGTTTAGAGATGAAATTTTTAAAGCCTCATCAGTTGAG
GATGTCATTGAACAAATAGCATCGAAAAAGCTTCAGCCATTTATTTCTTC
TTCTATGATTACACCGACCAACGTTTTCGTCGATTCGTAAGTCCATAAAA
TTGGCGAATCCTTCAAAAAAAAGTGTTCTCGATTCAATGATAGATGCTTT
AGATTCGTACATTTTAAATTTAGAAGACATGGTGCAAGTTCGAACTAAGG
AAGTTGAAAAGTCTCAGAAAAAAATGAAAAACCTTCTTTATCAGATGCTC
CCAGCTTCTGTGGTTGACAAATTAACGAAGAAAGAGCCAGTTATTCCTGA
ATATTATGAAAGTGTATCACTGTATTTTTCTGATATAGTTGGATTTACTT
CTATCTCGTCAGAATGTACTCCTATGCAGGTTGTTGATATGCTGAACCGA
CTATATTCATTGTTTGATAGTATAGTAGAAAAGAACGACGTTTACAAAGT
TGAAACAATAGGTGATGCCTATTTCGTGTCATCTGGTGTTCCAAACAGAA
ATGGAATTCAGCATTTAATTGAAATTTGTGAATTCTCCTTGGGAATTGTA
GAATCTGTGCGAAATATATATCGGATTCCACACAATGATAAGCAAATTGC
GGTCCGAATCGGCATTCATACAGGATCAGTCGTAGCTGGAGTTGTGGGAA
ATAAAATGCCGAGATTCTGTCTATTTGGAGATACTGTCAACACAGCCAGC
AGAATGGAATCGACAGGAGTGGCAATGAAAATCCAAGCTTCAGAAAAAGC
CTACATATTAATTAATGAATATAACAAATATACCTTTACGTGTCGAGGTC
AAATTGAAGTAAAGGGCAAAGGATCACAAACTACTTATTTCCTCGAAGGT
AGAAGGGCTTAACTTATCTCTTTTACGATTGTTGGC
back to top

protein sequence of SMED30000341-orf-1

>SMED30000341-orf-1 ID=SMED30000341-orf-1|Name=SMED30000341-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
AGFPRTVYQEWLIAFIANRSAYVSLTGKYDFVGSGQGQLMILDPKTNKIV
FSGSDTGISNETQLKQPYLQLVPTIAGALVIAHNVPESSGINGITMSRDV
LAKIFMGNISFWNHAEIQYLNPTKSLPNEKIIIIVREDDSGTTFKMTSAL
SSFSKEWKTRYGIFSVNSGWNNSLIKFYGYQTNTVAGMIRAIRYSISYLS
ETDLYNFNLSSCLLINRRNQSIAASSDSVYAAMEAQSKLNVDPFNEDMID
IDADFAYPIATFTNIIIYIAGFWSCDLMIEMFRFIEWILTNSQADQIAIT
KKMVPLSKSMRNLIYNNILMKTTCESDSKLVKTLVDNQKFNEILSSNTTD
KILKIALPIVSMFIIALFIFVGYVFYKQQKDIINNVWKISYEKLDTNTSR
SNLLRTMSRVTLNLSNDDKNVEILFKSFENNNVFMTNTNLGLSRANFSWK
FRATLNKYRALNHSNICNFAGITFHDERLWLITENCSKGNLYHILHNSGV
TLSDSVKFSLAADIVSGMEYLHRQQIIHGHLSSLNCYLDKKWNVKIADWP
IGLLFKATKIKVLSKSMRNNGNPQNSKNKIEPISNNYDSEALKSLNRHRF
WQAPEIIHLENYLESANLKTDVYSFGIILIEIWIREIPFRDEIFKASSVE
DVIEQIASKKLQPFISSSMITPTNVFVDS*
back to top

protein sequence of SMED30000341-orf-2

>SMED30000341-orf-2 ID=SMED30000341-orf-2|Name=SMED30000341-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=242bp
MIDALDSYILNLEDMVQVRTKEVEKSQKKMKNLLYQMLPASVVDKLTKKE
PVIPEYYESVSLYFSDIVGFTSISSECTPMQVVDMLNRLYSLFDSIVEKN
DVYKVETIGDAYFVSSGVPNRNGIQHLIEICEFSLGIVESVRNIYRIPHN
DKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQ
ASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGRRA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001054A/G_cyclase
IPR018297A/G_cyclase_CS
IPR029787Nucleotide_cyclase
IPR024370PBP_domain
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR023795Serpin_CS
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004383guanylate cyclase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0009190cyclic nucleotide biosynthetic process
GO:0006468protein phosphorylation
GO:0006182cGMP biosynthetic process
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 78..259
e-value: 2.7E-56
score: 193.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 426..675
e-value: 3.4E-38
score: 133.2
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 3..309
e-value: 2.7E-56
score: 193.1
NoneNo IPR availablePANTHERPTHR42996FAMILY NOT NAMEDcoord: 2..331
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 2..318
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
NoneNo IPR availableTMHMMTMhelixcoord: 352..374
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 459..648
e-value: 4.8E-21
score: 75.3
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 376..679
score: 21.672
IPR024370PBP domainPFAMPF12849PBP_like_2coord: 2..290
e-value: 1.4E-19
score: 70.9
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 449..664