Pleckstrin homology domain-containing family G member 7

Overview
NamePleckstrin homology domain-containing family G member 7
Smed IDSMED30000338
Length (bp)2826
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pleckstrin homology domain-containing family G member 7 (SMED30000338) t-SNE clustered cells

Violin plots show distribution of expression levels for Pleckstrin homology domain-containing family G member 7 (SMED30000338) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pleckstrin homology domain-containing family G member 7 (SMED30000338) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pleckstrin homology domain-containing family G member 7 (SMED30000338) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000338

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000338SMESG000022039.1 SmedASXL_014828SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30000338SMESG000022039.1 dd_Smed_v4_16856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000338SMESG000022039.1 dd_Smed_v6_16856_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Human
Match: PLEKHG7 (pleckstrin homology and RhoGEF domain containing G7 [Source:HGNC Symbol;Acc:HGNC:33829])

HSP 1 Score: 241.891 bits (616), Expect = 8.045e-68
Identity = 140/449 (31.18%), Postives = 244/449 (54.34%), Query Frame = 2
Query:  767 VTDVQEALLNLKKSNFRDSYLASFKEIHWSDLI-PHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPT-EGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNF 2107
            ++D++  L ++K ++FR       K+  W +++  H+++P +      D++  ++EAVWELF  E  + LDHL+VLK  FM  L+ LQ   +L+ V+   +F NL+EL   S  F       +   +   E   +   +  L ++ + S       +YCLNY  A+ YL++L++ + F  + KWC ++E+ +RL + +LLVAP+Q  T+ PLLL +I K + +  E+ ++    +K E  +R L+ K+ WL NF++ + +Q  +VWP + D + R FIPE LKHI      E +++   R LL+EG + L E  + +++Y+FLF+D L++TK K   KK+  S        D    C        + +L++   EG    V  QP+ LDR  +  +         +++AF++ H +R++Q IA + +Q+ TE  K  WM +++ +   F
Sbjct:  241 ISDLENCLSSVKITSFRGYDFYGLKDKTWDEVLETHHKLPTDQL----DLKK-QQEAVWELFTSECTYFLDHLLVLKMIFMNTLRYLQTHEYLLDVDLWRLFANLEELTQTSLGFVNSLFGIIKDYVDASEISSSLDFISVLTKYFRGSL-CQSHQTYCLNYSAAIFYLESLRQRDDFGIYLKWCEQNEQCRRLHVPELLVAPLQRLTRYPLLLKNIWKRSMDSAEKIMIYSIKEKVEKSIRDLEGKVKWLDNFQKFRYLQEIIVWPPLWDRDKRFFIPECLKHIFKEHMAENILSPTSRHLLYEGKLTLAESTRFLDVYLFLFNDFLLVTKTKCNKKKLGGS--------DPGLMC-----PSLTPELQAVIKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCF 670          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Human
Match: PLEKHG7 (pleckstrin homology and RhoGEF domain containing G7 [Source:HGNC Symbol;Acc:HGNC:33829])

HSP 1 Score: 197.593 bits (501), Expect = 4.257e-55
Identity = 115/370 (31.08%), Postives = 197/370 (53.24%), Query Frame = 2
Query: 1001 FMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPT-EGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNF 2107
            FM  L+ LQ   +L+ V+   +F NL+EL   S  F       +   +   E   +   +  L ++ + S       +YCLNY  A+ YL++L++ + F  + KWC ++E+ +RL + +LLVAP+Q  T+ PLLL +I K + +  E+ ++    +K E  +R L+ K+ WL NF++ + +Q  +VWP + D + R FIPE LKHI      E +++   R LL+EG + L E  + +++Y+FLF+D L++TK K   KK+  S        D    C        + +L++   EG    V  QP+ LDR  +  +         +++AF++ H +R++Q IA + +Q+ TE  K  WM +++ +   F
Sbjct:    3 FMNTLRYLQTHEYLLDVDLWRLFANLEELTQTSLGFVNSLFGIIKDYVDASEISSSLDFISVLTKYFRGSLCQS-HQTYCLNYSAAIFYLESLRQRDDFGIYLKWCEQNEQCRRLHVPELLVAPLQRLTRYPLLLKNIWKRSMDSAEKIMIYSIKEKVEKSIRDLEGKVKWLDNFQKFRYLQEIIVWPPLWDRDKRFFIPECLKHIFKEHMAENILSPTSRHLLYEGKLTLAESTRFLDVYLFLFNDFLLVTKTKCNKKKLGGS--------DPGLMC-----PSLTPELQAVIKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCF 358          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Human
Match: PLEKHG6 (pleckstrin homology and RhoGEF domain containing G6 [Source:HGNC Symbol;Acc:HGNC:25562])

HSP 1 Score: 109.768 bits (273), Expect = 7.287e-24
Identity = 109/444 (24.55%), Postives = 187/444 (42.12%), Query Frame = 2
Query:  842 EIHWSDLIP-HNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILS---RQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE-KLKEKLQNRN 2143
            E  W +L+P H E+  E           ++EA+WEL   EL ++   L ++       L  LQ  G LM V  + +FGN+  L     +F  + +       T EE   +   +  +   S     G  FH Y   CL  +  MAY  +  + N +F  F +WC K +R  R  L DLL+ P Q  TK PLLL  + K +     Q  L   ++  E +LR ++ ++      E L    +Q + P      P   + + L+   +     P   + +   RQLL EG + + EG +  +++Y+FLF D+L++TK ++   K                                       +V + PL L++     + +         ++F+LIH++ FQ V +   +   +   +A W+++  Q+Q   Q+ K +E +Q + 
Sbjct:  110 EKSWRELVPGHKEMSQELC--------HQQEALWELLTTELIYV-RKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGP-----TLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQMLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQESLA-AAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKADKA--------------------------------------KVIRPPLMLEKLVCQPLRDP--------NSFLLIHLTEFQCVSSALLVHCPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQKR 492          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Human
Match: PLEKHG6 (pleckstrin homology and RhoGEF domain containing G6 [Source:HGNC Symbol;Acc:HGNC:25562])

HSP 1 Score: 109.768 bits (273), Expect = 7.694e-24
Identity = 109/444 (24.55%), Postives = 187/444 (42.12%), Query Frame = 2
Query:  842 EIHWSDLIP-HNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILS---RQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE-KLKEKLQNRN 2143
            E  W +L+P H E+  E           ++EA+WEL   EL ++   L ++       L  LQ  G LM V  + +FGN+  L     +F  + +       T EE   +   +  +   S     G  FH Y   CL  +  MAY  +  + N +F  F +WC K +R  R  L DLL+ P Q  TK PLLL  + K +     Q  L   ++  E +LR ++ ++      E L    +Q + P      P   + + L+   +     P   + +   RQLL EG + + EG +  +++Y+FLF D+L++TK ++   K                                       +V + PL L++     + +         ++F+LIH++ FQ V +   +   +   +A W+++  Q+Q   Q+ K +E +Q + 
Sbjct:  142 EKSWRELVPGHKEMSQELC--------HQQEALWELLTTELIYV-RKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGP-----TLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQMLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQESLA-AAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKADKA--------------------------------------KVIRPPLMLEKLVCQPLRDP--------NSFLLIHLTEFQCVSSALLVHCPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQKR 524          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Human
Match: PLEKHG6 (pleckstrin homology and RhoGEF domain containing G6 [Source:HGNC Symbol;Acc:HGNC:25562])

HSP 1 Score: 109.768 bits (273), Expect = 7.694e-24
Identity = 109/444 (24.55%), Postives = 187/444 (42.12%), Query Frame = 2
Query:  842 EIHWSDLIP-HNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILS---RQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE-KLKEKLQNRN 2143
            E  W +L+P H E+  E           ++EA+WEL   EL ++   L ++       L  LQ  G LM V  + +FGN+  L     +F  + +       T EE   +   +  +   S     G  FH Y   CL  +  MAY  +  + N +F  F +WC K +R  R  L DLL+ P Q  TK PLLL  + K +     Q  L   ++  E +LR ++ ++      E L    +Q + P      P   + + L+   +     P   + +   RQLL EG + + EG +  +++Y+FLF D+L++TK ++   K                                       +V + PL L++     + +         ++F+LIH++ FQ V +   +   +   +A W+++  Q+Q   Q+ K +E +Q + 
Sbjct:  142 EKSWRELVPGHKEMSQELC--------HQQEALWELLTTELIYV-RKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGP-----TLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQMLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQESLA-AAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKADKA--------------------------------------KVIRPPLMLEKLVCQPLRDP--------NSFLLIHLTEFQCVSSALLVHCPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQKR 524          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Celegans
Match: prhg-1 (pep chromosome:WBcel235:I:912415:926562:-1 gene:WBGene00022391.1 transcript:Y95B8A.12d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:prhg-1)

HSP 1 Score: 314.694 bits (805), Expect = 1.369e-95
Identity = 172/466 (36.91%), Postives = 275/466 (59.01%), Query Frame = 2
Query:  746 KVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDV-GNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE-KLKEKLQ 2134
            + + RE +  VQ AL   K     D  L     + + ++   +E     S K   ++     AVWELF  EL FL   L VL+  + EPLK+ QV+G L+ VEPD +FGNLD+LC +S TFC+ F++ L+  +  E +  T ++V    R+S+       + +YC+NY+  M YL +++ K E F EF++ C  DER  RLQL DLL+AP+Q  T++P+LL  I K +   E +  + + +D     LRS+DD + WL NFERLQ++Q+Q+VWP+I+D+EP+ ++P+FL+  LSRQ CE L+A+P+R+L+HEG + L E  + V+MY FLF+D+ ++TK KK   K+     +   +G                     +E  I Q  +QP+ LD     D   N +A   ++K AFV+IH++R+ QV+ +YT+Q++ +  K +W+++  +S +N++  +LK+ L+
Sbjct:  133 RAKRREIIKHVQAALETSKDHEIEDDELEKLLPVSFEEMFMGDETTTIPSSKHKYLQ-----AVWELFHTELVFLYRQLFVLRDVYKEPLKRCQVEGCLLLVEPDLLFGNLDQLCRISRTFCQSFLSLLST-VDKENWDCTQLVVDLFERFSKGPSTISAYQAYCINYKATMEYLGSIRQKEERFTEFERICLADERCFRLQLEDLLIAPLQRITRLPILLREIHKRSEEEESKGKVEKVIDTMTESLRSIDDSVQWLHNFERLQQLQTQVVWPNISDLEPKSYVPDFLRVALSRQFCENLLAHPRRKLIHEGPLELVENGRTVDMYAFLFNDMFVLTKTKKCASKLK---VKGVPIGK--------------------SEHYIVQ--RQPVPLDSCVFCDADSNDQATPMSLKFAFVIIHLTRYYQVVGIYTLQAADKADKELWIEKFQESIENYESIQLKDMLK 567          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Celegans
Match: prhg-1 (pep chromosome:WBcel235:I:912415:919147:-1 gene:WBGene00022391.1 transcript:Y95B8A.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:prhg-1)

HSP 1 Score: 314.694 bits (805), Expect = 1.558e-95
Identity = 172/466 (36.91%), Postives = 275/466 (59.01%), Query Frame = 2
Query:  746 KVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDV-GNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE-KLKEKLQ 2134
            + + RE +  VQ AL   K     D  L     + + ++   +E     S K   ++     AVWELF  EL FL   L VL+  + EPLK+ QV+G L+ VEPD +FGNLD+LC +S TFC+ F++ L+  +  E +  T ++V    R+S+       + +YC+NY+  M YL +++ K E F EF++ C  DER  RLQL DLL+AP+Q  T++P+LL  I K +   E +  + + +D     LRS+DD + WL NFERLQ++Q+Q+VWP+I+D+EP+ ++P+FL+  LSRQ CE L+A+P+R+L+HEG + L E  + V+MY FLF+D+ ++TK KK   K+     +   +G                     +E  I Q  +QP+ LD     D   N +A   ++K AFV+IH++R+ QV+ +YT+Q++ +  K +W+++  +S +N++  +LK+ L+
Sbjct:  132 RAKRREIIKHVQAALETSKDHEIEDDELEKLLPVSFEEMFMGDETTTIPSSKHKYLQ-----AVWELFHTELVFLYRQLFVLRDVYKEPLKRCQVEGCLLLVEPDLLFGNLDQLCRISRTFCQSFLSLLST-VDKENWDCTQLVVDLFERFSKGPSTISAYQAYCINYKATMEYLGSIRQKEERFTEFERICLADERCFRLQLEDLLIAPLQRITRLPILLREIHKRSEEEESKGKVEKVIDTMTESLRSIDDSVQWLHNFERLQQLQTQVVWPNISDLEPKSYVPDFLRVALSRQFCENLLAHPRRKLIHEGPLELVENGRTVDMYAFLFNDMFVLTKTKKCASKLK---VKGVPIGK--------------------SEHYIVQ--RQPVPLDSCVFCDADSNDQATPMSLKFAFVIIHLTRYYQVVGIYTLQAADKADKELWIEKFQESIENYESIQLKDMLK 566          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Celegans
Match: prhg-1 (pep chromosome:WBcel235:I:912415:926562:-1 gene:WBGene00022391.1 transcript:Y95B8A.12e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:prhg-1)

HSP 1 Score: 314.309 bits (804), Expect = 1.699e-95
Identity = 172/466 (36.91%), Postives = 275/466 (59.01%), Query Frame = 2
Query:  746 KVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDV-GNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE-KLKEKLQ 2134
            + + RE +  VQ AL   K     D  L     + + ++   +E     S K   ++     AVWELF  EL FL   L VL+  + EPLK+ QV+G L+ VEPD +FGNLD+LC +S TFC+ F++ L+  +  E +  T ++V    R+S+       + +YC+NY+  M YL +++ K E F EF++ C  DER  RLQL DLL+AP+Q  T++P+LL  I K +   E +  + + +D     LRS+DD + WL NFERLQ++Q+Q+VWP+I+D+EP+ ++P+FL+  LSRQ CE L+A+P+R+L+HEG + L E  + V+MY FLF+D+ ++TK KK   K+     +   +G                     +E  I Q  +QP+ LD     D   N +A   ++K AFV+IH++R+ QV+ +YT+Q++ +  K +W+++  +S +N++  +LK+ L+
Sbjct:  125 RAKRREIIKHVQAALETSKDHEIEDDELEKLLPVSFEEMFMGDETTTIPSSKHKYLQ-----AVWELFHTELVFLYRQLFVLRDVYKEPLKRCQVEGCLLLVEPDLLFGNLDQLCRISRTFCQSFLSLLS-TVDKENWDCTQLVVDLFERFSKGPSTISAYQAYCINYKATMEYLGSIRQKEERFTEFERICLADERCFRLQLEDLLIAPLQRITRLPILLREIHKRSEEEESKGKVEKVIDTMTESLRSIDDSVQWLHNFERLQQLQTQVVWPNISDLEPKSYVPDFLRVALSRQFCENLLAHPRRKLIHEGPLELVENGRTVDMYAFLFNDMFVLTKTKKCASKLK---VKGVPIGK--------------------SEHYIVQ--RQPVPLDSCVFCDADSNDQATPMSLKFAFVIIHLTRYYQVVGIYTLQAADKADKELWIEKFQESIENYESIQLKDMLK 559          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Celegans
Match: prhg-1 (pep chromosome:WBcel235:I:912415:926877:-1 gene:WBGene00022391.1 transcript:Y95B8A.12f.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:prhg-1)

HSP 1 Score: 314.309 bits (804), Expect = 1.809e-95
Identity = 172/466 (36.91%), Postives = 275/466 (59.01%), Query Frame = 2
Query:  746 KVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDV-GNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE-KLKEKLQ 2134
            + + RE +  VQ AL   K     D  L     + + ++   +E     S K   ++     AVWELF  EL FL   L VL+  + EPLK+ QV+G L+ VEPD +FGNLD+LC +S TFC+ F++ L+  +  E +  T ++V    R+S+       + +YC+NY+  M YL +++ K E F EF++ C  DER  RLQL DLL+AP+Q  T++P+LL  I K +   E +  + + +D     LRS+DD + WL NFERLQ++Q+Q+VWP+I+D+EP+ ++P+FL+  LSRQ CE L+A+P+R+L+HEG + L E  + V+MY FLF+D+ ++TK KK   K+     +   +G                     +E  I Q  +QP+ LD     D   N +A   ++K AFV+IH++R+ QV+ +YT+Q++ +  K +W+++  +S +N++  +LK+ L+
Sbjct:  131 RAKRREIIKHVQAALETSKDHEIEDDELEKLLPVSFEEMFMGDETTTIPSSKHKYLQ-----AVWELFHTELVFLYRQLFVLRDVYKEPLKRCQVEGCLLLVEPDLLFGNLDQLCRISRTFCQSFLSLLST-VDKENWDCTQLVVDLFERFSKGPSTISAYQAYCINYKATMEYLGSIRQKEERFTEFERICLADERCFRLQLEDLLIAPLQRITRLPILLREIHKRSEEEESKGKVEKVIDTMTESLRSIDDSVQWLHNFERLQQLQTQVVWPNISDLEPKSYVPDFLRVALSRQFCENLLAHPRRKLIHEGPLELVENGRTVDMYAFLFNDMFVLTKTKKCASKLK---VKGVPIGK--------------------SEHYIVQ--RQPVPLDSCVFCDADSNDQATPMSLKFAFVIIHLTRYYQVVGIYTLQAADKADKELWIEKFQESIENYESIQLKDMLK 565          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Celegans
Match: prhg-1 (pep chromosome:WBcel235:I:912415:926877:-1 gene:WBGene00022391.1 transcript:Y95B8A.12c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:prhg-1)

HSP 1 Score: 314.694 bits (805), Expect = 1.847e-95
Identity = 172/466 (36.91%), Postives = 275/466 (59.01%), Query Frame = 2
Query:  746 KVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDV-GNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE-KLKEKLQ 2134
            + + RE +  VQ AL   K     D  L     + + ++   +E     S K   ++     AVWELF  EL FL   L VL+  + EPLK+ QV+G L+ VEPD +FGNLD+LC +S TFC+ F++ L+  +  E +  T ++V    R+S+       + +YC+NY+  M YL +++ K E F EF++ C  DER  RLQL DLL+AP+Q  T++P+LL  I K +   E +  + + +D     LRS+DD + WL NFERLQ++Q+Q+VWP+I+D+EP+ ++P+FL+  LSRQ CE L+A+P+R+L+HEG + L E  + V+MY FLF+D+ ++TK KK   K+     +   +G                     +E  I Q  +QP+ LD     D   N +A   ++K AFV+IH++R+ QV+ +YT+Q++ +  K +W+++  +S +N++  +LK+ L+
Sbjct:  139 RAKRREIIKHVQAALETSKDHEIEDDELEKLLPVSFEEMFMGDETTTIPSSKHKYLQ-----AVWELFHTELVFLYRQLFVLRDVYKEPLKRCQVEGCLLLVEPDLLFGNLDQLCRISRTFCQSFLSLLST-VDKENWDCTQLVVDLFERFSKGPSTISAYQAYCINYKATMEYLGSIRQKEERFTEFERICLADERCFRLQLEDLLIAPLQRITRLPILLREIHKRSEEEESKGKVEKVIDTMTESLRSIDDSVQWLHNFERLQQLQTQVVWPNISDLEPKSYVPDFLRVALSRQFCENLLAHPRRKLIHEGPLELVENGRTVDMYAFLFNDMFVLTKTKKCASKLK---VKGVPIGK--------------------SEHYIVQ--RQPVPLDSCVFCDADSNDQATPMSLKFAFVIIHLTRYYQVVGIYTLQAADKADKELWIEKFQESIENYESIQLKDMLK 573          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0332698)

HSP 1 Score: 77.7962 bits (190), Expect = 4.584e-14
Identity = 74/323 (22.91%), Postives = 136/323 (42.11%), Query Frame = 2
Query:  827 LASFKEIH--WSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFI------TTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPK---RQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTK 1759
            LA  + +H  W D +        NS  +S+ E   + A+WEL   E+ + +  L  +   F+  L+ +Q +G L+ V+   +F N+  +C  +  F   ++      + +T E     F Q   L    I           +  YC        Y   L   N +F  +  WC   +   RL+L D++V PMQ  TK  LLL+ I+K+ ++ EE   +   +   E+++ S+++ +   +  ERL+ +  ++    + D    V      ++      C  +   P    R L  EG     +     +++ FL  D+L++ K
Sbjct:  784 LAYLQYMHKSWRDFV--------NSDSMSESEVKIQTAIWELVTTEV-YYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAP--------YKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKSDVHCFLLTDLLLVCK 1089          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0302716)

HSP 1 Score: 77.7962 bits (190), Expect = 4.584e-14
Identity = 74/323 (22.91%), Postives = 136/323 (42.11%), Query Frame = 2
Query:  827 LASFKEIH--WSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFI------TTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPK---RQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTK 1759
            LA  + +H  W D +        NS  +S+ E   + A+WEL   E+ + +  L  +   F+  L+ +Q +G L+ V+   +F N+  +C  +  F   ++      + +T E     F Q   L    I           +  YC        Y   L   N +F  +  WC   +   RL+L D++V PMQ  TK  LLL+ I+K+ ++ EE   +   +   E+++ S+++ +   +  ERL+ +  ++    + D    V      ++      C  +   P    R L  EG     +     +++ FL  D+L++ K
Sbjct:  784 LAYLQYMHKSWRDFV--------NSDSMSESEVKIQTAIWELVTTEV-YYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAP--------YKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKSDVHCFLLTDLLLVCK 1089          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0332699)

HSP 1 Score: 77.0258 bits (188), Expect = 5.414e-14
Identity = 74/323 (22.91%), Postives = 136/323 (42.11%), Query Frame = 2
Query:  827 LASFKEIH--WSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFI------TTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPK---RQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTK 1759
            LA  + +H  W D +        NS  +S+ E   + A+WEL   E+ + +  L  +   F+  L+ +Q +G L+ V+   +F N+  +C  +  F   ++      + +T E     F Q   L    I           +  YC        Y   L   N +F  +  WC   +   RL+L D++V PMQ  TK  LLL+ I+K+ ++ EE   +   +   E+++ S+++ +   +  ERL+ +  ++    + D    V      ++      C  +   P    R L  EG     +     +++ FL  D+L++ K
Sbjct:  220 LAYLQYMHKSWRDFV--------NSDSMSESEVKIQTAIWELVTTEV-YYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAP--------YKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKSDVHCFLLTDLLLVCK 525          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0302715)

HSP 1 Score: 77.0258 bits (188), Expect = 7.681e-14
Identity = 74/323 (22.91%), Postives = 136/323 (42.11%), Query Frame = 2
Query:  827 LASFKEIH--WSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFI------TTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPK---RQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTK 1759
            LA  + +H  W D +        NS  +S+ E   + A+WEL   E+ + +  L  +   F+  L+ +Q +G L+ V+   +F N+  +C  +  F   ++      + +T E     F Q   L    I           +  YC        Y   L   N +F  +  WC   +   RL+L D++V PMQ  TK  LLL+ I+K+ ++ EE   +   +   E+++ S+++ +   +  ERL+ +  ++    + D    V      ++      C  +   P    R L  EG     +     +++ FL  D+L++ K
Sbjct:  817 LAYLQYMHKSWRDFV--------NSDSMSESEVKIQTAIWELVTTEV-YYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAP--------YKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKSDVHCFLLTDLLLVCK 1122          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0302713)

HSP 1 Score: 76.6406 bits (187), Expect = 8.417e-14
Identity = 74/323 (22.91%), Postives = 136/323 (42.11%), Query Frame = 2
Query:  827 LASFKEIH--WSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFI------TTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLK-KNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPK---RQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTK 1759
            LA  + +H  W D +        NS  +S+ E   + A+WEL   E+ + +  L  +   F+  L+ +Q +G L+ V+   +F N+  +C  +  F   ++      + +T E     F Q   L    I           +  YC        Y   L   N +F  +  WC   +   RL+L D++V PMQ  TK  LLL+ I+K+ ++ EE   +   +   E+++ S+++ +   +  ERL+ +  ++    + D    V      ++      C  +   P    R L  EG     +     +++ FL  D+L++ K
Sbjct:  817 LAYLQYMHKSWRDFV--------NSDSMSESEVKIQTAIWELVTTEV-YYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAP--------YKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKSDVHCFLLTDLLLVCK 1122          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Zebrafish
Match: plekhg7 (pleckstrin homology domain containing, family G (with RhoGef domain) member 7 [Source:ZFIN;Acc:ZDB-GENE-070410-15])

HSP 1 Score: 260.766 bits (665), Expect = 3.235e-74
Identity = 155/467 (33.19%), Postives = 252/467 (53.96%), Query Frame = 2
Query:  746 KVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIP-HNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNF--QEKLKEKLQN 2137
            KV+ R S  D+ + L +++   +RD+   +FK++   D +   +E+     P     +    EA+WELF  E  + LD LMVLK  F+  L  LQ    L  ++   +F NL+ELC VS+ F    +  + +EM  +    ++  +  L R +           YCLNY  A+ YLD+LK  E F  F KWC ++E  +RLQL DLLV P+Q  T+ PLLL +I K + +  E+  +   +D  +  +  L+ K+ WL N++++++++  LVW  + + + R  +PE LKH+L     E L+ N  R LLH+G +FL E  K  E+Y+FLFD+ L++TKIK+  K+ S         G  D   GQ+             EG  F V  QP++LDR  L ++    A A+ + ++F+++H +R+QQ IAV+ +Q+ +E +K  WM E+ ++  +   Q+ L  ++ N
Sbjct:  317 KVKTR-SGADIDKCLASVQVPEWRDTDFQTFKDMSLVDFLQGRSELKAAQHPMTYKTQ----EAIWELFTSECVYFLDQLMVLKEVFLTTLSDLQTRQCLQDIDSWRLFANLNELCLVSFGFLTSLLRVI-KEMWTDPDSCSTQSLHDLFRKAFSESICHCLQKYCLNYSTAILYLDSLKLREDFGSFVKWCERNEECRRLQLKDLLVVPLQRFTRYPLLLKNIGKRSCSKAEENTIQSIVDLVDRAIYDLEGKVKWLDNYQKVKQLKETLVWLPVWESDKRAHVPESLKHLLKPVTLENLVIN--RSLLHDGKLFLIENTKQQEVYLFLFDEFLLITKIKRNKKQKS---------GVVDFAAGQELE-------LLLQEGCSFTVLDQPISLDRLQLKNIDQLNATASTLPNSFIIMHQNRYQQCIAVFVLQAQSESTKKAWMSEIEKAVSSLLKQDSLHPRVNN 759          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Zebrafish
Match: plekhg7 (pleckstrin homology domain containing, family G (with RhoGef domain) member 7 [Source:ZFIN;Acc:ZDB-GENE-070410-15])

HSP 1 Score: 245.358 bits (625), Expect = 4.841e-72
Identity = 139/390 (35.64%), Postives = 217/390 (55.64%), Query Frame = 2
Query:  926 REAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQS 2095
            +EA+WELF  E  + LD LMVLK  F+  L  LQ    L  ++   +F NL+ELC VS+ F    +  + +EM  +    ++  +  L R +           YCLNY  A+ YLD+LK  E F  F KWC ++E  +RLQL DLLV P+Q  T+ PLLL +I K + +  E+  +   +D  +  +  L+ K+ WL N++++++++  LVW  + + + R  +PE LKH+L     E L+ N  R LLH+G +FL E  K  E+Y+FLFD+ L++TKIK+  KK           G  D   GQ+             EG  F V  QP++LDR  L ++    A A+ + ++F+++H +R+QQ IAV+ +Q+ +E +K  WM E+ ++
Sbjct:   25 QEAIWELFTSECVYFLDQLMVLKEVFLTTLSDLQTRQCLQDIDSWRLFANLNELCLVSFGFLTSLLRVI-KEMWTDPDSCSTQSLHDLFRKAFSESICHCLQKYCLNYSTAILYLDSLKLREDFGSFVKWCERNEECRRLQLKDLLVVPLQRFTRYPLLLKNIGKRSCSKAEENTIQSIVDLVDRAIYDLEGKVKWLDNYQKVKQLKETLVWLPVWESDKRAHVPESLKHLLKPVTLENLVIN--RSLLHDGKLFLIENTKQQEVYLFLFDEFLLITKIKRNKKK----------SGVVDFAAGQELE-------LLLQEGCSFTVLDQPISLDRLQLKNIDQLNATASTLPNSFIIMHQNRYQQCIAVFVLQAQSESTKKAWMSEIEKA 394          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Zebrafish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 104.76 bits (260), Expect = 2.764e-22
Identity = 98/411 (23.84%), Postives = 175/411 (42.58%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTP--EEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL-VWPSITDMEPRV--FIPEF-----LKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQ 2110
            ++EA+WEL + E +++   L V+   F+  L  LQ  G L  VEP  +F N+ ++  +  +         T  M P  E+  Q   ++         S  G  F  Y   C+  E  M Y+ TL K NE+F  +  W    ++  RL+L D+LV P Q  TK PLLL  + K T +P  +  +   +   E ++ S+D ++      ++L  I  ++  + ++      V   + E+     +  ++   P E       RQLL EG + + EG +  +++Y FLF D+L++TK  K  +KV                                      +V +QPL +      ++ +          +F+LI+++ F   +A Y  Q+++      W++ +  +Q   Q
Sbjct:  415 QQEAIWELLQTESDYI-KKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSL-------WTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEE------TRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKV--------------------------------------KVIRQPLVIHNVVCRELKDP--------GSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAIYNAQNQLQ 765          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Zebrafish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 104.375 bits (259), Expect = 3.261e-22
Identity = 98/411 (23.84%), Postives = 175/411 (42.58%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTP--EEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL-VWPSITDMEPRV--FIPEF-----LKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQ 2110
            ++EA+WEL + E +++   L V+   F+  L  LQ  G L  VEP  +F N+ ++  +  +         T  M P  E+  Q   ++         S  G  F  Y   C+  E  M Y+ TL K NE+F  +  W    ++  RL+L D+LV P Q  TK PLLL  + K T +P  +  +   +   E ++ S+D ++      ++L  I  ++  + ++      V   + E+     +  ++   P E       RQLL EG + + EG +  +++Y FLF D+L++TK  K  +KV                                      +V +QPL +      ++ +          +F+LI+++ F   +A Y  Q+++      W++ +  +Q   Q
Sbjct:  337 QQEAIWELLQTESDYI-KKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSL-------WTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEE------TRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKV--------------------------------------KVIRQPLVIHNVVCRELKDP--------GSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAIYNAQNQLQ 687          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Zebrafish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 104.375 bits (259), Expect = 3.261e-22
Identity = 98/411 (23.84%), Postives = 175/411 (42.58%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTP--EEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL-VWPSITDMEPRV--FIPEF-----LKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQ 2110
            ++EA+WEL + E +++   L V+   F+  L  LQ  G L  VEP  +F N+ ++  +  +         T  M P  E+  Q   ++         S  G  F  Y   C+  E  M Y+ TL K NE+F  +  W    ++  RL+L D+LV P Q  TK PLLL  + K T +P  +  +   +   E ++ S+D ++      ++L  I  ++  + ++      V   + E+     +  ++   P E       RQLL EG + + EG +  +++Y FLF D+L++TK  K  +KV                                      +V +QPL +      ++ +          +F+LI+++ F   +A Y  Q+++      W++ +  +Q   Q
Sbjct:  337 QQEAIWELLQTESDYI-KKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSL-------WTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEE------TRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKV--------------------------------------KVIRQPLVIHNVVCRELKDP--------GSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAIYNAQNQLQ 687          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Xenopus
Match: PLEKHG7 (pleckstrin homology and RhoGEF domain containing G7 [Source:NCBI gene;Acc:100492548])

HSP 1 Score: 261.151 bits (666), Expect = 2.567e-74
Identity = 167/530 (31.51%), Postives = 277/530 (52.26%), Query Frame = 2
Query:  563 KRSSIVL---GMQMIPGVETLKEQHNKKTLRRQHTISEINPSTSTFHTEDSRRKGLSFLKLIDKKVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRW-SQHSRNGDVF--HSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSN-SFTEQPSMGDCDCFCGQKSNSDSSSQLRSPT-EGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEK 2128
            +RSS+VL   G+++ PG            L      S+    ++   + DS++    F K        ++ ++D++  L ++K  +F  + L   K+  W+++I  +    EN+  +      R+E+VWELF  E  + LD L+VLK  F   L+ LQ + HL+ V+   +F NL+EL   S  F    + T+       E G T+     L    ++H ++        YCLNY +A+ YL++LK+ + F  + KWC + E+ +RL L+DLLVAP+   T+ PLLL +I K +T+  E+  +    DK E  LR L+ K+ WL   ++ +++Q  +VWPS+ + + R FIPE LKH       E ++++  R LLHEG + L E  +++++Y+FLFDD L++TKIK+  +K +N    + P +                 +L+  T EG   +V  QP+ALDR SL  V         +K+AF++ H +R+QQ IA + +Q+ TE  K  WM ++  +   + E  + K
Sbjct:  248 RRSSVVLSLPGLEVFPG-----------DLLVSDGASDYMYHSTWVSSADSKKPKWPFSKKGTLMKGKQKQISDLENCLSSVKIQDFTGNELYILKDKTWNEVISMHTA--ENTENLHKSNRRRQESVWELFTSECTYHLDQLLVLKKVFFSALQHLQSNDHLLDVDVVRLFANLEELIQESLNFAVGLLNTIKSR----ELGSTASFSPPLAGLLTKHFKDSLCLSHEVYCLNYTSAVIYLESLKQRDDFAIYLKWCEQHEQCRRLHLSDLLVAPLHRLTRYPLLLKNIWKQSTDVTEKIAIYSVKDKVESTLRDLEGKVKWLDKSQKYKQLQEVIVWPSLWERDKRFFIPEGLKHHFKEPNVESMLSSLNRDLLHEGKLILTESTRLLDVYLFLFDDFLLITKIKRNKRKSTNLEVNQYPCL---------------HPELQMVTKEGGYCKVVDQPIALDRLSLKTVDQYHVTVYGMKNAFMVQHENRYQQCIAAFILQAHTESEKKTWMSQIETAMSCYTETHRSK 745          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Xenopus
Match: PLEKHG7 (pleckstrin homology and RhoGEF domain containing G7 [Source:NCBI gene;Acc:100492548])

HSP 1 Score: 250.366 bits (638), Expect = 1.025e-70
Identity = 147/431 (34.11%), Postives = 235/431 (54.52%), Query Frame = 2
Query:  851 WSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRW-SQHSRNGDVF--HSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSN-SFTEQPSMGDCDCFCGQKSNSDSSSQLRSPT-EGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEK 2128
            W+++I  +    EN+  +      R+E+VWELF  E  + LD L+VLK  F   L+ LQ + HL+ V+   +F NL+EL   S  F    + T+       E G T+     L    ++H ++        YCLNY +A+ YL++LK+ + F  + KWC + E+ +RL L+DLLVAP+   T+ PLLL +I K +T+  E+  +    DK E  LR L+ K+ WL   ++ +++Q  +VWPS+ + + R FIPE LKH       E ++++  R LLHEG + L E  +++++Y+FLFDD L++TKIK+  +K +N    + P +                 +L+  T EG   +V  QP+ALDR SL  V         +K+AF++ H +R+QQ IA + +Q+ TE  K  WM ++  +   + E  + K
Sbjct:  303 WNEVISMHTA--ENTENLHKSNRRRQESVWELFTSECTYHLDQLLVLKKVFFSALQHLQSNDHLLDVDVVRLFANLEELIQESLNFAVGLLNTIKSR----ELGSTASFSPPLAGLLTKHFKDSLCLSHEVYCLNYTSAVIYLESLKQRDDFAIYLKWCEQHEQCRRLHLSDLLVAPLHRLTRYPLLLKNIWKQSTDVTEKIAIYSVKDKVESTLRDLEGKVKWLDKSQKYKQLQEVIVWPSLWERDKRFFIPEGLKHHFKEPNVESMLSSLNRDLLHEGKLILTESTRLLDVYLFLFDDFLLITKIKRNKRKSTNLEVNQYPCL---------------HPELQMVTKEGGYCKVVDQPIALDRLSLKTVDQYHVTVYGMKNAFMVQHENRYQQCIAAFILQAHTESEKKTWMSQIETAMSCYTETHRSK 712          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Xenopus
Match: PLEKHG7 (pleckstrin homology and RhoGEF domain containing G7 [Source:NCBI gene;Acc:100492548])

HSP 1 Score: 202.986 bits (515), Expect = 1.175e-57
Identity = 115/330 (34.85%), Postives = 183/330 (55.45%), Query Frame = 2
Query: 1151 EEFGQTSVLVKTLIRWSQHSRNGDVF--HSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSN-SFTEQPSMGDCDCFCGQKSNSDSSSQLRSPT-EGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEK 2128
            EE  Q +V       W  H ++        YCLNY +A+ YL++LK+ + F  + KWC + E+ +RL L+DLLVAP+   T+ PLLL +I K +T+  E+  +    DK E  LR L+ K+ WL   ++ +++Q  +VWPS+ + + R FIPE LKH       E ++++  R LLHEG + L E  +++++Y+FLFDD L++TKIK+  +K +N    + P +                 +L+  T EG   +V  QP+ALDR SL  V         +K+AF++ H +R+QQ IA + +Q+ TE  K  WM ++  +   + E  + K
Sbjct:   11 EELIQVNVFF-----WETHFKDSLCLSHEVYCLNYTSAVIYLESLKQRDDFAIYLKWCEQHEQCRRLHLSDLLVAPLHRLTRYPLLLKNIWKQSTDVTEKIAIYSVKDKVESTLRDLEGKVKWLDKSQKYKQLQEVIVWPSLWERDKRFFIPEGLKHHFKEPNVESMLSSLNRDLLHEGKLILTESTRLLDVYLFLFDDFLLITKIKRNKRKSTNLEVNQYPCL---------------HPELQMVTKEGGYCKVVDQPIALDRLSLKTVDQYHVTVYGMKNAFMVQHENRYQQCIAAFILQAHTESEKKTWMSQIETAMSCYTETHRSK 320          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Xenopus
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:100496612])

HSP 1 Score: 105.145 bits (261), Expect = 2.647e-22
Identity = 112/454 (24.67%), Postives = 199/454 (43.83%), Query Frame = 2
Query:  818 DSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTP--EEFGQTSVLVKTL-----IRWSQHSRNGDVFHSYCLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL----VWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQNR 2140
            D+YL    E  W ++I   E+P      ++  +  ++EA+WEL   E  ++   L V+   F+  L  LQ  G L  VEPD +F N+ E+  +  T            M P  E+  +T  L+  +      R+         +  YC+  E  M Y+  L + NE+F  +  W  K ++  RL+L+D+LV P Q  TK PLLL  I K T + + +  +   +   E ++  ++ ++   +  +RL  I S++       S TD   ++ + EF +  L+  P         RQLL EG + + EG +  +++Y FLF D+ ++TK  K  ++                                       +V +QPL +D+    ++ +          +F+LI+++ F+  +A YT Q+S +     W++    +Q   Q   +E L+N+
Sbjct:  356 DTYLT--LEDSWQEII---EVPE----TLTRRQCHQQEAIWELLHTEATYI-KKLKVITDLFLCCLLNLQESGILCEVEPDKLFSNIQEIIQLHSTV-----------MVPILEKARKTKSLLNPMDFQKGFRFKMFESLFKPYIRYCMEEEGCMEYMRNLHRDNELFKSYVTWSEKHKQCNRLKLSDMLVKPHQRLTKYPLLLKSILKKTDDLQVRESIILMISSVERFINHVNSRMRQRQEQQRLAAIISRIDSYEAVDSSTDEVDKI-LKEFCRLDLT-APMIGTSPEDTRQLLLEGSLKMKEGKDSKMDVYCFLFTDLFLITKPVKKAERT--------------------------------------KVIRQPLLVDKIVCRELKDP--------GSFLLIYLNEFRSAVAAYTFQASGQSLCRGWIEAFFNAQNLLQRMRQECLRNQ 740          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Xenopus
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:100496612])

HSP 1 Score: 105.145 bits (261), Expect = 2.719e-22
Identity = 112/454 (24.67%), Postives = 199/454 (43.83%), Query Frame = 2
Query:  818 DSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTP--EEFGQTSVLVKTL-----IRWSQHSRNGDVFHSYCLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL----VWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQNR 2140
            D+YL    E  W ++I   E+P      ++  +  ++EA+WEL   E  ++   L V+   F+  L  LQ  G L  VEPD +F N+ E+  +  T            M P  E+  +T  L+  +      R+         +  YC+  E  M Y+  L + NE+F  +  W  K ++  RL+L+D+LV P Q  TK PLLL  I K T + + +  +   +   E ++  ++ ++   +  +RL  I S++       S TD   ++ + EF +  L+  P         RQLL EG + + EG +  +++Y FLF D+ ++TK  K  ++                                       +V +QPL +D+    ++ +          +F+LI+++ F+  +A YT Q+S +     W++    +Q   Q   +E L+N+
Sbjct:  327 DTYLT--LEDSWQEII---EVPE----TLTRRQCHQQEAIWELLHTEATYI-KKLKVITDLFLCCLLNLQESGILCEVEPDKLFSNIQEIIQLHSTV-----------MVPILEKARKTKSLLNPMDFQKGFRFKMFESLFKPYIRYCMEEEGCMEYMRNLHRDNELFKSYVTWSEKHKQCNRLKLSDMLVKPHQRLTKYPLLLKSILKKTDDLQVRESIILMISSVERFINHVNSRMRQRQEQQRLAAIISRIDSYEAVDSSTDEVDKI-LKEFCRLDLT-APMIGTSPEDTRQLLLEGSLKMKEGKDSKMDVYCFLFTDLFLITKPVKKAERT--------------------------------------KVIRQPLLVDKIVCRELKDP--------GSFLLIYLNEFRSAVAAYTFQASGQSLCRGWIEAFFNAQNLLQRMRQECLRNQ 711          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Mouse
Match: Plekhg6 (pleckstrin homology domain containing, family G (with RhoGef domain) member 6 [Source:MGI Symbol;Acc:MGI:2682298])

HSP 1 Score: 111.694 bits (278), Expect = 1.526e-24
Identity = 100/407 (24.57%), Postives = 175/407 (43.00%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL-----VWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLK 2122
            ++EA+WEL   EL +L   L ++       L  LQ  G L  V  + +FGN+  L      F  + +  +  +      GQ    V     +    +    +  YCL  +  MAY  +    N +F  F +WC K +R  R  L DLL+ P Q  TK PLLL  +RK +  P  Q  L   ++  E +LR ++ ++      E L  +  ++     + PS  ++E +   P     +++  P   +     RQLL EG + + EG +  +++Y+FLF D+L++TK ++                           +D +            +V + PL L++     + +         ++F+LIH++ FQ V +  T+   +   +A W+++   +Q   Q KLK
Sbjct:  162 QQEALWELLTTELIYL-RKLKIMTDLLAAGLLNLQRVGLLTEVSAETLFGNVPNLIRAHRRFWEEVLQPILEDT--RTSGQPLDPVSLQNGFLTFGQRFQPYVQYCLRVKQTMAYAREQQDTNPLFHTFVQWCEKHKRSGRQTLGDLLIKPHQRITKYPLLLQAVRKRSPEPRAQEALNAMIEAVESFLRHINGQVRQGEEQESLMAVAQRIGPYEVLEPSSEEVE-KNLRPFSTLDLMT--PVLGVAPEYTRQLLLEGPVRVKEGREGKMDVYLFLFSDVLLVTKPQR--------------------------KADRA------------KVIRPPLMLEKLVCRPLRDP--------NSFLLIHLTEFQCVSSALTVHCPSSTERARWLEKTQHAQTTLQ-KLK 515          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Mouse
Match: Plekhg5 (pleckstrin homology domain containing, family G (with RhoGef domain) member 5 [Source:MGI Symbol;Acc:MGI:2652860])

HSP 1 Score: 105.531 bits (262), Expect = 1.592e-22
Identity = 97/408 (23.77%), Postives = 177/408 (43.38%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDM---EPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRF---SLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE 2113
            ++EAVWEL   E++++   L V+ + F+  L  LQ  G L  VE + +F N+ E+  +        +  +      E+  +T  L++           G +F  Y   C+  E  M Y+   L+ N++F  +  W  K ++ QRL+L+D+L  P Q  TK PLLL  + + T +P  +  +   +   E ++  ++  +   +  +RL  + S++    + +    E    + EFL H+    P         RQLL EG + + EG +  +++Y FLF D+L++TK  K  ++                                       +V + PL +D+     L D G+           F+LI+++ F   +  YT Q+S++     W+D +  +Q   Q+
Sbjct:  407 QQEAVWELLHTEVSYI-RKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVL-----EKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFL-HLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERT--------------------------------------KVIRPPLLVDKIVCRELRDPGS-----------FLLIYLNEFHSAVGAYTFQASSQALCRSWVDTIYNAQNQLQQ 758          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Mouse
Match: Plekhg5 (pleckstrin homology domain containing, family G (with RhoGef domain) member 5 [Source:MGI Symbol;Acc:MGI:2652860])

HSP 1 Score: 105.145 bits (261), Expect = 1.985e-22
Identity = 97/408 (23.77%), Postives = 177/408 (43.38%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDM---EPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRF---SLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE 2113
            ++EAVWEL   E++++   L V+ + F+  L  LQ  G L  VE + +F N+ E+  +        +  +      E+  +T  L++           G +F  Y   C+  E  M Y+   L+ N++F  +  W  K ++ QRL+L+D+L  P Q  TK PLLL  + + T +P  +  +   +   E ++  ++  +   +  +RL  + S++    + +    E    + EFL H+    P         RQLL EG + + EG +  +++Y FLF D+L++TK  K  ++                                       +V + PL +D+     L D G+           F+LI+++ F   +  YT Q+S++     W+D +  +Q   Q+
Sbjct:  407 QQEAVWELLHTEVSYI-RKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVL-----EKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFL-HLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERT--------------------------------------KVIRPPLLVDKIVCRELRDPGS-----------FLLIYLNEFHSAVGAYTFQASSQALCRSWVDTIYNAQNQLQQ 758          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Mouse
Match: Plekhg5 (pleckstrin homology domain containing, family G (with RhoGef domain) member 5 [Source:MGI Symbol;Acc:MGI:2652860])

HSP 1 Score: 105.145 bits (261), Expect = 2.022e-22
Identity = 97/408 (23.77%), Postives = 177/408 (43.38%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDM---EPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRF---SLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE 2113
            ++EAVWEL   E++++   L V+ + F+  L  LQ  G L  VE + +F N+ E+  +        +  +      E+  +T  L++           G +F  Y   C+  E  M Y+   L+ N++F  +  W  K ++ QRL+L+D+L  P Q  TK PLLL  + + T +P  +  +   +   E ++  ++  +   +  +RL  + S++    + +    E    + EFL H+    P         RQLL EG + + EG +  +++Y FLF D+L++TK  K  ++                                       +V + PL +D+     L D G+           F+LI+++ F   +  YT Q+S++     W+D +  +Q   Q+
Sbjct:  394 QQEAVWELLHTEVSYI-RKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVL-----EKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFL-HLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERT--------------------------------------KVIRPPLLVDKIVCRELRDPGS-----------FLLIYLNEFHSAVGAYTFQASSQALCRSWVDTIYNAQNQLQQ 745          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Mouse
Match: Plekhg5 (pleckstrin homology domain containing, family G (with RhoGef domain) member 5 [Source:MGI Symbol;Acc:MGI:2652860])

HSP 1 Score: 105.145 bits (261), Expect = 2.082e-22
Identity = 97/408 (23.77%), Postives = 177/408 (43.38%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDM---EPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRF---SLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE 2113
            ++EAVWEL   E++++   L V+ + F+  L  LQ  G L  VE + +F N+ E+  +        +  +      E+  +T  L++           G +F  Y   C+  E  M Y+   L+ N++F  +  W  K ++ QRL+L+D+L  P Q  TK PLLL  + + T +P  +  +   +   E ++  ++  +   +  +RL  + S++    + +    E    + EFL H+    P         RQLL EG + + EG +  +++Y FLF D+L++TK  K  ++                                       +V + PL +D+     L D G+           F+LI+++ F   +  YT Q+S++     W+D +  +Q   Q+
Sbjct:  375 QQEAVWELLHTEVSYI-RKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVL-----EKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFL-HLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERT--------------------------------------KVIRPPLLVDKIVCRELRDPGS-----------FLLIYLNEFHSAVGAYTFQASSQALCRSWVDTIYNAQNQLQQ 726          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. UniProt/SwissProt
Match: sp|Q6ZR37|PKHG7_HUMAN (Pleckstrin homology domain-containing family G member 7 OS=Homo sapiens OX=9606 GN=PLEKHG7 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.044e-54
Identity = 115/370 (31.08%), Postives = 197/370 (53.24%), Query Frame = 2
Query: 1001 FMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPT-EGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNF 2107
            FM  L+ LQ   +L+ V+   +F NL+EL   S  F       +   +   E   +   +  L ++ + S       +YCLNY  A+ YL++L++ + F  + KWC ++E+ +RL + +LLVAP+Q  T+ PLLL +I K + +  E+ ++    +K E  +R L+ K+ WL NF++ + +Q  +VWP + D + R FIPE LKHI      E +++   R LL+EG + L E  + +++Y+FLF+D L++TK K   KK+  S        D    C        + +L++   EG    V  QP+ LDR  +  +         +++AF++ H +R++Q IA + +Q+ TE  K  WM +++ +   F
Sbjct:    3 FMNTLRYLQTHEYLLDVDLWRLFANLEELTQTSLGFVNSLFGIIKDYVDASEISSSLDFISVLTKYFRGSLCQS-HQTYCLNYSAAIFYLESLRQRDDFGIYLKWCEQNEQCRRLHVPELLVAPLQRLTRYPLLLKNIWKRSMDSAEKIMIYSIKEKVEKSIRDLEGKVKWLDNFQKFRYLQEIIVWPPLWDRDKRFFIPECLKHIFKEHMAENILSPTSRHLLYEGKLTLAESTRFLDVYLFLFNDFLLVTKTKCNKKKLGGS--------DPGLMC-----PSLTPELQAVIKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCF 358          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. UniProt/SwissProt
Match: sp|Q8R0J1|PKHG6_MOUSE (Pleckstrin homology domain-containing family G member 6 OS=Mus musculus OX=10090 GN=Plekhg6 PE=2 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 1.067e-23
Identity = 100/407 (24.57%), Postives = 175/407 (43.00%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL-----VWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLK 2122
            ++EA+WEL   EL +L   L ++       L  LQ  G L  V  + +FGN+  L      F  + +  +  +      GQ    V     +    +    +  YCL  +  MAY  +    N +F  F +WC K +R  R  L DLL+ P Q  TK PLLL  +RK +  P  Q  L   ++  E +LR ++ ++      E L  +  ++     + PS  ++E +   P     +++  P   +     RQLL EG + + EG +  +++Y+FLF D+L++TK ++                           +D +            +V + PL L++     + +         ++F+LIH++ FQ V +  T+   +   +A W+++   +Q   Q KLK
Sbjct:  162 QQEALWELLTTELIYL-RKLKIMTDLLAAGLLNLQRVGLLTEVSAETLFGNVPNLIRAHRRFWEEVLQPILEDT--RTSGQPLDPVSLQNGFLTFGQRFQPYVQYCLRVKQTMAYAREQQDTNPLFHTFVQWCEKHKRSGRQTLGDLLIKPHQRITKYPLLLQAVRKRSPEPRAQEALNAMIEAVESFLRHINGQVRQGEEQESLMAVAQRIGPYEVLEPSSEEVE-KNLRPFSTLDLMT--PVLGVAPEYTRQLLLEGPVRVKEGREGKMDVYLFLFSDVLLVTKPQR--------------------------KADRA------------KVIRPPLMLEKLVCRPLRDP--------NSFLLIHLTEFQCVSSALTVHCPSSTERARWLEKTQHAQTTLQ-KLK 515          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. UniProt/SwissProt
Match: sp|Q3KR16|PKHG6_HUMAN (Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=1 SV=3)

HSP 1 Score: 109.768 bits (273), Expect = 3.695e-23
Identity = 109/444 (24.55%), Postives = 187/444 (42.12%), Query Frame = 2
Query:  842 EIHWSDLIP-HNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILS---RQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE-KLKEKLQNRN 2143
            E  W +L+P H E+  E           ++EA+WEL   EL ++   L ++       L  LQ  G LM V  + +FGN+  L     +F  + +       T EE   +   +  +   S     G  FH Y   CL  +  MAY  +  + N +F  F +WC K +R  R  L DLL+ P Q  TK PLLL  + K +     Q  L   ++  E +LR ++ ++      E L    +Q + P      P   + + L+   +     P   + +   RQLL EG + + EG +  +++Y+FLF D+L++TK ++   K                                       +V + PL L++     + +         ++F+LIH++ FQ V +   +   +   +A W+++  Q+Q   Q+ K +E +Q + 
Sbjct:  142 EKSWRELVPGHKEMSQELC--------HQQEALWELLTTELIYV-RKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGP-----TLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQMLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQESLA-AAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLLVTKPQRKADKA--------------------------------------KVIRPPLMLEKLVCQPLRDP--------NSFLLIHLTEFQCVSSALLVHCPSPTDRAQWLEKTQQAQAALQKLKAEEYVQQKR 524          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. UniProt/SwissProt
Match: sp|Q6RFZ7|PKHG5_RAT (Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus OX=10116 GN=Plekhg5 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 6.779e-23
Identity = 105/426 (24.65%), Postives = 185/426 (43.43%), Query Frame = 2
Query:  842 EIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDM---EPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRF---SLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDEL 2086
            E  W +LI  +E       K++  +  ++EAVWEL   E++++   L V+ + F+  L  LQ  G L  VE + +F N+ EL  +        +  +      E+  +T  L++           G +F  Y   C+  E  M Y+ +L + N++F  +  W  K ++ QRL+L+D+L  P Q  TK PLLL  + + T  P  +  +   +   E ++  ++  +   +  +RL  + S++    + +    E   F+ EFL H+    P         RQLL EG + + EG +  +++Y FLF D+L++TK  K  ++                                       +V + PL +D+     L D G+           F+LIH++ F   +  YT Q+S++     W+D L
Sbjct:  353 EDSWRELIDGHE-------KLTRRQCHQQEAVWELLHTEVSYI-RKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPELARLHRGLWSSVMVPVL-----EKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRSLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDEPRAKEAIITMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKFLKEFL-HLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERT--------------------------------------KVIRPPLLVDKIVCRELRDPGS-----------FLLIHLNEFHSAVGAYTFQASSQALCRSWVDTL 715          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. UniProt/SwissProt
Match: sp|Q66T02|PKHG5_MOUSE (Pleckstrin homology domain-containing family G member 5 OS=Mus musculus OX=10090 GN=Plekhg5 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.113e-21
Identity = 97/408 (23.77%), Postives = 177/408 (43.38%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDM---EPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRF---SLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE 2113
            ++EAVWEL   E++++   L V+ + F+  L  LQ  G L  VE + +F N+ E+  +        +  +      E+  +T  L++           G +F  Y   C+  E  M Y+   L+ N++F  +  W  K ++ QRL+L+D+L  P Q  TK PLLL  + + T +P  +  +   +   E ++  ++  +   +  +RL  + S++    + +    E    + EFL H+    P         RQLL EG + + EG +  +++Y FLF D+L++TK  K  ++                                       +V + PL +D+     L D G+           F+LI+++ F   +  YT Q+S++     W+D +  +Q   Q+
Sbjct:  407 QQEAVWELLHTEVSYI-RKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVL-----EKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFL-HLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERT--------------------------------------KVIRPPLLVDKIVCRELRDPGS-----------FLLIYLNEFHSAVGAYTFQASSQALCRSWVDTIYNAQNQLQQ 758          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. TrEMBL
Match: A0A4E0RJA9 (Pleckstrin domain-containing family G member OS=Fasciola hepatica OX=6192 GN=D915_000886 PE=4 SV=1)

HSP 1 Score: 606.675 bits (1563), Expect = 0.000e+0
Identity = 307/599 (51.25%), Postives = 419/599 (69.95%), Query Frame = 2
Query:  431 EGLTGTGRRGAMIAGKNYIEDTAEVTSVQSLDVDSKGNKSETDYKRSSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPSTSTFHTE---DSRRKGLSFLKLIDKKVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENL-------RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQNRNFSSPQTNKHSKVLNSMHK 2197
            E +   GRR A+I  KN I D+      +S   D     +       SI      + G   +  +  ++ LR+QHTI+++N    T  +    DS+R+   F+KLI+++ R +ES+ ++ EAL  L  S F+D YL S++E HWS L       N  +   S++EN        RREAVWELFK EL F LDHLMVLK+CFMEPLKKLQVDG+LMF+EP ++FGNLD+LCYVS+T CR+ I+ LTR+   +EFG T VL++ L RWS+HS++G+V+HSYCLNY++A++YLD+L+K + F EF+KWC +D R +RLQL DLLVAPMQH  K+PLLL+ IR+YT +  E+ +LT  ++K E+ L+SL+DK+ WL+NFERLQEIQSQL+WPSI++MEPRVFIPEFL+  +SRQPCERLIANPKRQLLHEG +  ++G+K+VE++ FLFDD L++T+IKK PKK                    KS S+++   RS TEG IF VY+Q +ALDRF++HD+G +EA AN ++HAFVL+ ++RFQQ+  VYT+Q++ EL K  W+++L QSQQ FQEKLK+KL   + S  QTNKHSKV+ + HK
Sbjct:  283 EAILRRGRRRAIIDEKNLIGDS------ESESQDGTSTGAPVAKGVDSISADASSMVGRVNVFRERQQRMLRKQHTIADLNTRIQTTISPQEFDSKRRQNVFMKLIERRSRSKESLLELSEALQRLTPSLFQDHYLESYRESHWSQL------ENTEASSASNLENAYPDREIRRREAVWELFKSELIFFLDHLMVLKNCFMEPLKKLQVDGYLMFIEPSNLFGNLDDLCYVSHTLCRELISNLTRDAKNKEFGSTDVLLRPLKRWSEHSKDGEVYHSYCLNYDSALSYLDSLRKVDHFNEFEKWCEQDPRCRRLQLTDLLVAPMQHYMKIPLLLASIRRYTADVSEREILTSCVNKVENSLKSLEDKMRWLKNFERLQEIQSQLIWPSISEMEPRVFIPEFLRQSMSRQPCERLIANPKRQLLHEGFLTFSDGSKIVEIFAFLFDDFLLITRIKKQPKK--------------------KSFSENTLNSRSLTEGGIFIVYRQAIALDRFTIHDLGLAEANANGLRHAFVLVLITRFQQITGVYTLQATNELDKIRWIEKLRQSQQLFQEKLKQKLYGID-SDHQTNKHSKVVLNKHK 848          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. TrEMBL
Match: A0A267H4N2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031346g1 PE=4 SV=1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 329/636 (51.73%), Postives = 428/636 (67.30%), Query Frame = 2
Query:  365 IDRCGSSNSLNGELRLEKFDP-PEGLTGTGRRGAMIAGKNYIEDTAEVTSVQSLDVDSKGNKSETDYKR--SSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPST-STFHTED----SRRKGLSFLKLIDKKV-RIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNE-----------NSP-----KISDI---ENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQ-NRNFSSPQTNKHSKVLN 2185
            I R GSS SL  +   ++ +P  E L   GRR A+   KN+I D     S      +S G  +E D KR  SS+ L ++++P V+ LKE+  K   + Q+T++++   T  +F T D     R  G+S LKLIDKK  + R+S  ++ + L  LK S FRD+YL SFK +HW DL    ++ +E           +SP     + +D+   E LRREAVWELFK EL FL+D+LMVLKHCF+EPLKKLQVDGHLMFVEP+D+FGN+DELCYVSYTF RD I+TL +E    +FG TS L+K   RWS  S++G+VFH+YCLNY  A+ YL+ L++ E F EF+K C  D R  RLQ+ DLLVAPMQHCTKMPLLL+ IRKYT+    + +LTE+L + E+ L+SL+DK+ WLRNFERLQ IQ QL+WP IT++E + FIP+FLK  LS QPCE+LIANPKRQL+HEGL+ L E N+  E+Y FLFDDIL++TK+KK PKK S                    N  SS    SPT+GA+F VY+QP+ALDRFS+HD+G  EA AN +KHAFVLIH+SRFQQ+I VYT+QS+ +  K  W+D L QSQQ FQEKLK KL      +SP+TN H ++++
Sbjct:  313 IKRHGSSASLTSDNEDQETEPTKENLHRRGRRAAIYNSKNFIGD---AKSPDRSPNESGGEDNEEDGKRRRSSLELSVEVLPRVDILKEKSKKILKK-QNTVADLTQKTLQSFATFDENSKKRGSGMSILKLIDKKRNKGRDSGAELHDILAALKPSEFRDTYLMSFKNLHWKDLFDKPDLESEAACAARSKEASSSPSRVDSRFADLPEKERLRREAVWELFKSELVFLIDYLMVLKHCFLEPLKKLQVDGHLMFVEPEDLFGNIDELCYVSYTFSRDLISTLCKEAKRGQFGTTSGLLKAFKRWSLSSKDGEVFHNYCLNYHCAITYLEILRRQEQFSEFEKRCEVDPRCHRLQITDLLVAPMQHCTKMPLLLAQIRKYTSEDCNKAMLTESLKRVENSLKSLEDKLKWLRNFERLQNIQQQLIWPPITELETKAFIPDFLKSSLSCQPCEKLIANPKRQLIHEGLLSLVETNRSTEVYCFLFDDILLLTKVKKPPKKRS-------------------VNESSSVYSMSPTDGALFVVYRQPIALDRFSIHDIGYVEANANGLKHAFVLIHISRFQQIIGVYTLQSAGDQQKLAWLDSLRQSQQRFQEKLKCKLAMTVAANSPRTNTHRRLMS 925          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. TrEMBL
Match: A0A267GES2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031346g2 PE=4 SV=1)

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 329/636 (51.73%), Postives = 428/636 (67.30%), Query Frame = 2
Query:  365 IDRCGSSNSLNGELRLEKFDP-PEGLTGTGRRGAMIAGKNYIEDTAEVTSVQSLDVDSKGNKSETDYKR--SSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPST-STFHTED----SRRKGLSFLKLIDKKV-RIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNE-----------NSP-----KISDI---ENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQ-NRNFSSPQTNKHSKVLN 2185
            I R GSS SL  +   ++ +P  E L   GRR A+   KN+I D     S      +S G  +E D KR  SS+ L ++++P V+ LKE+  K   + Q+T++++   T  +F T D     R  G+S LKLIDKK  + R+S  ++ + L  LK S FRD+YL SFK +HW DL    ++ +E           +SP     + +D+   E LRREAVWELFK EL FL+D+LMVLKHCF+EPLKKLQVDGHLMFVEP+D+FGN+DELCYVSYTF RD I+TL +E    +FG TS L+K   RWS  S++G+VFH+YCLNY  A+ YL+ L++ E F EF+K C  D R  RLQ+ DLLVAPMQHCTKMPLLL+ IRKYT+    + +LTE+L + E+ L+SL+DK+ WLRNFERLQ IQ QL+WP IT++E + FIP+FLK  LS QPCE+LIANPKRQL+HEGL+ L E N+  E+Y FLFDDIL++TK+KK PKK S                    N  SS    SPT+GA+F VY+QP+ALDRFS+HD+G  EA AN +KHAFVLIH+SRFQQ+I VYT+QS+ +  K  W+D L QSQQ FQEKLK KL      +SP+TN H ++++
Sbjct:   98 IKRHGSSASLTSDNEDQETEPTKENLHRRGRRAAIYNSKNFIGD---AKSPDRSPNESGGEDNEEDGKRRRSSLELSVEVLPRVDILKEKSKKILKK-QNTVADLTQKTLQSFATFDENSKKRGSGMSILKLIDKKRNKGRDSGAELHDILAALKPSEFRDTYLMSFKNLHWKDLFDKPDLESEAACAARSKEASSSPSRVDSRFADLPEKERLRREAVWELFKSELVFLIDYLMVLKHCFLEPLKKLQVDGHLMFVEPEDLFGNIDELCYVSYTFSRDLISTLCKEAKRGQFGTTSGLLKAFKRWSLSSKDGEVFHNYCLNYHCAITYLEILRRQEQFSEFEKRCEVDPRCHRLQITDLLVAPMQHCTKMPLLLAQIRKYTSEDCNKAMLTESLKRVENSLKSLEDKLKWLRNFERLQNIQQQLIWPPITELETKAFIPDFLKSSLSCQPCEKLIANPKRQLIHEGLLSLVETNRSTEVYCFLFDDILLLTKVKKPPKKRS-------------------VNESSSVYSMSPTDGALFVVYRQPIALDRFSIHDIGYVEANANGLKHAFVLIHISRFQQIIGVYTLQSAGDQQKLAWLDSLRQSQQRFQEKLKCKLAMTVAANSPRTNTHRRLMS 710          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. TrEMBL
Match: A0A267GEU5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030415g1 PE=4 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 329/636 (51.73%), Postives = 428/636 (67.30%), Query Frame = 2
Query:  365 IDRCGSSNSLNGELRLEKFDP-PEGLTGTGRRGAMIAGKNYIEDTAEVTSVQSLDVDSKGNKSETDYKR--SSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPST-STFHTED----SRRKGLSFLKLIDKKV-RIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNE-----------NSP-----KISDI---ENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQ-NRNFSSPQTNKHSKVLN 2185
            I R GSS SL  +   ++ +P  E L   GRR A+   KN+I D     S      +S G  +E D KR  SS+ L ++++P V+ LKE+  K   + Q+T++++   T  +F T D     R  G+S LKLIDKK  + R+S  ++ + L  LK S FRD+YL SFK +HW DL    ++ +E           +SP     + +D+   E LRREAVWELFK EL FL+D+LMVLKHCF+EPLKKLQVDGHLMFVEP+D+FGN+DELCYVSYTF RD I+TL +E    +FG TS L+K   RWS  S++G+VFH+YCLNY  A+ YL+ L++ E F EF+K C  D R  RLQ+ DLLVAPMQHCTKMPLLL+ IRKYT+    + +LTE+L + E+ L+SL+DK+ WLRNFERLQ IQ QL+WP IT++E + FIP+FLK  LS QPCE+LIANPKRQL+HEGL+ L E N+  E+Y FLFDDIL++TK+KK PKK S                    N  SS    SPT+GA+F VY+QP+ALDRFS+HD+G  EA AN +KHAFVLIH+SRFQQ+I VYT+QS+ +  K  W+D L QSQQ FQEKLK KL      +SP+TN H ++++
Sbjct:  189 IKRHGSSASLTSDNEDQETEPTKENLHRRGRRAAIYNSKNFIGD---AKSPDRSPNESGGEDNEEDGKRRRSSLELSVEVLPRVDILKEKSKKILKK-QNTVADLTQKTLQSFATFDENSKKRGSGMSILKLIDKKRNKGRDSGAELHDILAALKPSEFRDTYLMSFKNLHWKDLFDKPDLESEAACAARSKEASSSPSRVDSRFADLPEKERLRREAVWELFKSELVFLIDYLMVLKHCFLEPLKKLQVDGHLMFVEPEDLFGNIDELCYVSYTFSRDLISTLCKEAKRGQFGTTSGLLKAFKRWSLSSKDGEVFHNYCLNYHCAITYLEILRRQEQFSEFEKRCEVDPRCHRLQITDLLVAPMQHCTKMPLLLAQIRKYTSEDCNKAMLTESLKRVENSLKSLEDKLKWLRNFERLQNIQQQLIWPPITELETKAFIPDFLKSSLSCQPCEKLIANPKRQLIHEGLLSLVETNRSTEVYCFLFDDILLLTKVKKPPKKRS-------------------VNESSSVYSMSPTDGALFVVYRQPIALDRFSIHDIGYVEANANGLKHAFVLIHISRFQQIIGVYTLQSAGDQQKLAWLDSLRQSQQRFQEKLKCKLAMTVAANSPRTNTHRRLMS 801          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. TrEMBL
Match: A0A1I8H259 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 329/636 (51.73%), Postives = 428/636 (67.30%), Query Frame = 2
Query:  365 IDRCGSSNSLNGELRLEKFDP-PEGLTGTGRRGAMIAGKNYIEDTAEVTSVQSLDVDSKGNKSETDYKR--SSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPST-STFHTED----SRRKGLSFLKLIDKKV-RIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNE-----------NSP-----KISDI---ENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQ-NRNFSSPQTNKHSKVLN 2185
            I R GSS SL  +   ++ +P  E L   GRR A+   KN+I D     S      +S G  +E D KR  SS+ L ++++P V+ LKE+  K   + Q+T++++   T  +F T D     R  G+S LKLIDKK  + R+S  ++ + L  LK S FRD+YL SFK +HW DL    ++ +E           +SP     + +D+   E LRREAVWELFK EL FL+D+LMVLKHCF+EPLKKLQVDGHLMFVEP+D+FGN+DELCYVSYTF RD I+TL +E    +FG TS L+K   RWS  S++G+VFH+YCLNY  A+ YL+ L++ E F EF+K C  D R  RLQ+ DLLVAPMQHCTKMPLLL+ IRKYT+    + +LTE+L + E+ L+SL+DK+ WLRNFERLQ IQ QL+WP IT++E + FIP+FLK  LS QPCE+LIANPKRQL+HEGL+ L E N+  E+Y FLFDDIL++TK+KK PKK S                    N  SS    SPT+GA+F VY+QP+ALDRFS+HD+G  EA AN +KHAFVLIH+SRFQQ+I VYT+QS+ +  K  W+D L QSQQ FQEKLK KL      +SP+TN H ++++
Sbjct:  316 IKRHGSSASLTSDNEDQETEPTKENLHRRGRRAAIYNSKNFIGD---AKSPDRSPNESGGEDNEEDGKRRRSSLELSVEVLPRVDILKEKSKKILKK-QNTVADLTQKTLQSFATFDENSKKRGSGMSILKLIDKKRNKGRDSGAELHDILAALKPSEFRDTYLMSFKNLHWKDLFDKPDLESEAACAARSKEASSSPSRVDSRFADLPEKERLRREAVWELFKSELVFLIDYLMVLKHCFLEPLKKLQVDGHLMFVEPEDLFGNIDELCYVSYTFSRDLISTLCKEAKRGQFGTTSGLLKAFKRWSLSSKDGEVFHNYCLNYHCAITYLEILRRQEQFSEFEKRCEVDPRCHRLQITDLLVAPMQHCTKMPLLLAQIRKYTSEDCNKAMLTESLKRVENSLKSLEDKLKWLRNFERLQNIQQQLIWPPITELETKAFIPDFLKSSLSCQPCEKLIANPKRQLIHEGLLSLVETNRSTEVYCFLFDDILLLTKVKKPPKKRS-------------------VNESSSVYSMSPTDGALFVVYRQPIALDRFSIHDIGYVEANANGLKHAFVLIHISRFQQIIGVYTLQSAGDQQKLAWLDSLRQSQQRFQEKLKCKLAMTVAANSPRTNTHRRLMS 928          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Cavefish
Match: plekhg7 (pleckstrin homology domain containing, family G (with RhoGef domain) member 7 [Source:ZFIN;Acc:ZDB-GENE-070410-15])

HSP 1 Score: 243.432 bits (620), Expect = 2.170e-71
Identity = 139/396 (35.10%), Postives = 231/396 (58.33%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHS---YCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSN--SFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQS 2095
            R+EA+WELF  E  + LD LMVLK  F+  L  LQ+   L  ++   +F NL+ELC VS+     F+T+L R +        + + +TL+   + +    + H    YCLNY  A+ YLD+LK  E F  + KWC + E+ +RLQL DLLVAP+Q  T+ PLLL +I + ++  EE+  L   ++  +  +  L+ K+ WL N++++++++  LVW  + +++ +  +PE LKH+L     E L++N  R LL+EG + L E  K+ E+Y+FLFD+ L++TKIK+  KK     +   +P++G            +  + L+   EG  F V  QP++LDR  L ++    A A+++ H+F+L+H +R+QQ I V+ +Q+  E +K  W+ E+ ++
Sbjct:   24 RQEAIWELFTSECVYFLDQLMVLKEVFLTTLSDLQMRDCLQDIDSWGLFANLNELCLVSF----GFLTSLLRVIKELWATPETDVTQTLLAVMKKAFGESICHCLQKYCLNYTTAILYLDSLKTREDFGSYVKWCERKEQCRRLQLKDLLVAPLQRFTRYPLLLKNIERRSSGEEEEGGLQSVVELVDRAICDLEGKVKWLDNYQKVKQLKEALVWLPVWEIDKKAHVPESLKHLLKAVTLENLVSN--RVLLYEGKLILTENAKLHEVYLFLFDEFLLITKIKRSKKKSGGVEAHLLRPAVG-----------QELETLLQ---EGCSFTVLDQPISLDRLQLRNIDQLNATASSLHHSFILMHQNRYQQCIGVFVLQAQNESAKKAWLSEIEEA 399          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Cavefish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 85.5001 bits (210), Expect = 1.270e-16
Identity = 74/299 (24.75%), Postives = 132/299 (44.15%), Query Frame = 2
Query: 1241 LNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL-VWPSITDMEPRV--FIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKV-VEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRF---SLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQE 2113
            +  E+ M Y+ TL K NE+F  +  W    ++  RL+L D+LV P Q  TK PLLL  + K T +P  +  +T  +   E ++ S+D ++      ++L  I S++  + ++      V   + E+ +  L+  P      +  RQL  EG + + EG +  +++Y FLF D+L++TK  K  +KV                                      +V +QPL +       L D G           AF+LI+++ F+  +A Y  Q+++      W++ +  +Q   Q+
Sbjct:    1 MEEESCMEYMRTLLKDNELFRIYVTWAETHKQCSRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPAAREAVTRMIAVVEGFINSVDSQMRQREEKQKLTAIASRIEAYEAVEGASEEVEKILREYNQFDLT-APVMGASPDEIRQLHLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKV--------------------------------------KVIRQPLVIQNVVCRELKDPG-----------AFLLIYLNEFRTAVASYCFQANSATQGRSWVEAVYNAQNQLQK 249          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Cavefish
Match: plekhg6 (pleckstrin homology domain containing, family G (with RhoGef domain) member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-2517])

HSP 1 Score: 79.7221 bits (195), Expect = 8.781e-15
Identity = 89/428 (20.79%), Postives = 173/428 (40.42%), Query Frame = 2
Query:  830 ASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLD-TLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRV--FIPEFLKHILSRQPCERLIANPKRQLL-HEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQ 2101
            A   E  W+D++  +E        +S  +  ++EA+WEL + EL ++ + L ++    +  L+ +   G L+ V    +F NL  +      F RD +  +   +   + GQ    +K      Q +     +  YC   E  + +    L+ N  F  +  W     +  R++L D+   P Q  TK PLLL  I K T +   Q  L   L+    +L S++D + +  +   L ++  ++       M   +  FI E  +  L+  P + +     R+LL  E L      +  +E+   LF D+L++TK +K  +K                                       +V + P++L+R    ++ +         ++FVL+  S     + VY++ + +  S   W+  ++Q+++
Sbjct:  130 ADVLEKSWTDIVHSHE-------SMSKTQRHQQEALWELLQTELVYI-NKLTIITELVLSALEYVHQRGFLLEVTSAQLFSNLPSILEAHKLFWRDVMYPML--INVRQTGQPFDPLKLEPGCLQFAERFSAYLDYCWEEERNVEFTRRQLESNPQFQAYLLWVETHPQCVRMRLGDMQAKPHQRITKYPLLLKAILKTTEDTHTQGTLHRMLNSVGQFLDSINDYLQFKDDELALFDLSQRIEGYETQGMNEEIDKFIQEACRFDLT-SPVQGMGPTVIRKLLMEETLKVRGRKDSKLEVVALLFTDVLLLTKSQKKSEK--------------------------------------HKVVRPPVSLERTHCAELKDG--------YSFVLVEASDLGCAVNVYSVSAPSPESCTAWVSAINQAKE 500          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Cavefish
Match: arhgef12b (Rho guanine nucleotide exchange factor (GEF) 12b [Source:ZFIN;Acc:ZDB-GENE-070705-36])

HSP 1 Score: 78.9518 bits (193), Expect = 2.050e-14
Identity = 70/282 (24.82%), Postives = 130/282 (46.10%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHS---YCLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEG-LIFLNEGNKVVEMYMFLFDDILIM 1753
            R++ + ELF  E   L   L VL + F + + +  +   L   +  ++F NL+E+  +  +          +     E     ++   L+ W   +    + H+   +C N   A+  + +  KK++ F  F +    + + +RLQL D++   MQ  TK PLLL  I KYT + EE++ +    +   + L  ++ ++    N +RL++ Q +L   S+   E    I EF    L+           KR+++HEG L +    +K +E+Y  L +DIL++
Sbjct:  712 RQQVINELFYTERAHLR-MLKVLDNVFYQRMTRETI---LPPADIKNIFTNLEEIVQMHVSIMEQMTAIRKKN----ETAVVDIIGDDLLSWFSGAEEEKIKHAVGTFCSNQPFALELIKSRQKKDQRFASFVQDAESNRQCRRLQLKDMIPVEMQRLTKYPLLLESIAKYTDDAEEKSKVKRAGECCRNILNHVNQEVKEAENKQRLEDYQRRLDLSSLKQSE-HPMIAEFKNLDLT-----------KRKMVHEGPLSWKVNKDKTIELYTLLLEDILVL 973          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Cavefish
Match: arhgef12b (Rho guanine nucleotide exchange factor (GEF) 12b [Source:ZFIN;Acc:ZDB-GENE-070705-36])

HSP 1 Score: 78.5666 bits (192), Expect = 2.468e-14
Identity = 70/282 (24.82%), Postives = 130/282 (46.10%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHS---YCLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEG-LIFLNEGNKVVEMYMFLFDDILIM 1753
            R++ + ELF  E   L   L VL + F + + +  +   L   +  ++F NL+E+  +  +          +     E     ++   L+ W   +    + H+   +C N   A+  + +  KK++ F  F +    + + +RLQL D++   MQ  TK PLLL  I KYT + EE++ +    +   + L  ++ ++    N +RL++ Q +L   S+   E    I EF    L+           KR+++HEG L +    +K +E+Y  L +DIL++
Sbjct:  742 RQQVINELFYTERAHLR-MLKVLDNVFYQRMTRETI---LPPADIKNIFTNLEEIVQMHVSIMEQMTAIRKKN----ETAVVDIIGDDLLSWFSGAEEEKIKHAVGTFCSNQPFALELIKSRQKKDQRFASFVQDAESNRQCRRLQLKDMIPVEMQRLTKYPLLLESIAKYTDDAEEKSKVKRAGECCRNILNHVNQEVKEAENKQRLEDYQRRLDLSSLKQSE-HPMIAEFKNLDLT-----------KRKMVHEGPLSWKVNKDKTIELYTLLLEDILVL 1003          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006962.1 (pep scaffold:Pmarinus_7.0:GL481838:263808:335470:1 gene:ENSPMAG00000006236.1 transcript:ENSPMAT00000006962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 6.917e-8
Identity = 59/210 (28.10%), Postives = 99/210 (47.14%), Query Frame = 2
Query:  893 SPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDV---FGNLDELCYVSYTFCRDFITTLTREMT----------PEEFGQTSV-LVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQ----LNDLLVAPMQHCTKMPLLLSHIRKYT-TNPEEQTLLTETL 1465
            S ++++ + LR+  + EL + E +++ D L  L+  ++EPL+K        F+ PD +   FG L EL      F ++F+ TL + ++          P  F +    L  + + +S H +   ++ +YC ++  A   L+T K++  F  F      DER  R Q    L   L+ P+Q   K PLLL  +   T  + EE   LTE L
Sbjct:  554 SRQLTEADKLRK-VILELVETERSYVKD-LCTLQEIYVEPLQKE------AFLSPDQLEALFGTLREL----VIFQKEFLQTLEQGLSLAPDFETLEQPAHFRRVLFSLGGSFLYYSDHFK---LYSAYCASHPKAQKLLETAKRDPAFGAF-----LDERNPRRQHSSTLESYLIKPIQRVLKYPLLLRELVSLTDADSEENYHLTEAL 743          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Sea Lamprey
Match: dnmbp (dynamin binding protein [Source:NCBI gene;Acc:100005174])

HSP 1 Score: 54.6842 bits (130), Expect = 1.135e-7
Identity = 48/183 (26.23%), Postives = 89/183 (48.63%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFME---PLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWC--NKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYT--TNPEEQTL 1450
            R+  + EL + E ++L D    L+ C  E   PL+K QV      ++ + +FGNL+ +  V+  F      +    ++   +G   +L    I  +  S   +V+  YC N+++A++ L+  +K+E        C  N  ER   + L  LL+ P+Q   + PLLL+ +   T  ++P++ +L
Sbjct:  742 RKMVLEELLRTERDYLAD----LQFCREEIYIPLRKTQVAN----LDVEGLFGNLEAVLEVNARFYESLQLSADGRVS---YGDDVLLSPGEIFLAFKSELEEVYKVYCRNHDDAISLLEASEKDEDIKAQMAVCLKNMRERSNYINLGALLIKPVQRVMRYPLLLTELLGATPPSHPDQPSL 913          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002100.1 (pep scaffold:Pmarinus_7.0:GL476406:348473:416758:-1 gene:ENSPMAG00000001847.1 transcript:ENSPMAT00000002100.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.584e-7
Identity = 52/183 (28.42%), Postives = 78/183 (42.62%), Query Frame = 2
Query: 1223 VFHSYCLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEG-LIFLNEGNKVVEMYMFLFDDILIMTKIK 1765
            ++  YC   E A   ++ L +  E F      C   E   +  L DLLV PMQ   K  LLL  + K+TT+  E+T +   LD       +++D  M+L   +R  E   Q+V     +++ R F   F++                 +L  +G L  L  G    E Y+FLFD   +M K K
Sbjct:   97 IYGRYCSQLEGAHTCINRLLQTREDFKNKLDECTTKENGGKFSLRDLLVVPMQRVLKYHLLLKELHKHTTDQTEKTQVKRALD-------AMEDLAMYLNEVKRDNETLKQIV-----EIQ-RSFDSSFVQ------------GEDYGKLKMDGDLKVLQVGRAKQERYVFLFDKAALMCKRK 254          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Nematostella
Match: EDO49694 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG07])

HSP 1 Score: 332.798 bits (852), Expect = 4.434e-98
Identity = 178/463 (38.44%), Postives = 276/463 (59.61%), Query Frame = 2
Query:  764 SVTDVQEALLNLKKSNFR---DSYLASFKEIHWSDLIPH---NEIP-NENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQ-VDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIR--WSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQ-TLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKL 2119
            +V D +E L  L+ ++     +  L  +K+ HW+  +     N  P ++ +  +SD EN RREA+WELF  E+ +L+DH++VL+  F+EPL+ +Q ++ +L  V+P+ +F N++ELC VS  F +D +     + +  +FG T+ +V       W  H +    +  YCLNY   + YLD  KK+E F EF KWC  D R +RLQL DLLVAP+QH TK PLLL +IRK T+  ++Q + L+  +   E  ++ L+ K+  L N ERLQE+Q  LVWPSI +++P+ ++PEFL+ IL++QPCE L+ +  RQLLHEG + L+E  K  ++Y FLFDD+L++T+ +KL  K     +     G        +S   +    R       + VYKQP+ LDRF + D   + A  N +K++F++IH SRF+Q I +YT+Q+ T+  K  W   L  +Q ++ E +
Sbjct:  616 TVEDFREVLTGLRDTSRHLVIEHELDEYKDSHWTQFMSSPQGNRRPLSDGASGLSDQENKRREALWELFHSEVVYLMDHVLVLREVFLEPLRIVQQMEEYLQNVDPNMIFCNVEELCEVSAKFAKDLLLVFKGDQSNSQFGSTAAVVNAFTEFGWRVHPQ----YQEYCLNYSKVLGYLDQCKKSEDFQEFVKWCEADPRCKRLQLTDLLVAPLQHLTKYPLLLKNIRKRTSEGDDQHSSLSSVIKSVELSIKELEGKVKSLANLERLQELQKCLVWPSIVELDPKTYVPEFLRGILAKQPCEGLLTSANRQLLHEGHLVLHESTK-QDVYAFLFDDMLLLTRYRKLQPKAVKKLSLAGMAGAVAGGT--ESPPPTPPITRKTYHNVQYTVYKQPIPLDRFIVFDAEATHA-GNTLKNSFIIIHYSRFKQTIGLYTLQAPTQNLKETWTSRLKAAQSSWSEAV 1070          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Nematostella
Match: EDO39608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N2])

HSP 1 Score: 102.834 bits (255), Expect = 3.433e-22
Identity = 88/405 (21.73%), Postives = 186/405 (45.93%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERL--QRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL-----VWPSITDMEPRVFIP----EFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQ 2101
            ++EA+WEL   E+ ++   L ++K  F+  L+ +Q +G L+ VE + +F N++++  ++Y+F  D +  +  +    + G+    +     +    +  + + +YC+     + Y  + + +NE F  +  WC ++ RL   RL+L D LV PMQ  TK PLLL  I K T + E +  + + +   E  L  ++  +  +    +L+ + +++     V  ++ +   ++ +     + ++HI           +  R ++HEG + L E    +++++FLF D+L++TK KK  K                                       ++V K P+ +D+  +H        A+     F+L++V+ +  V+  + +Q S    +  WMD + ++Q+
Sbjct:  417 QQEAIWELLFTEVTYI-HKLSIVKKLFILCLRNVQSEGFLLDVEIEKLFSNIEDIYELNYSFWVDCLCEVAEKS--RKTGKPLNPMDMNEAFPMFDKRFEPYITYCMEESRCLKYFKEKIIENEDFRTYITWC-EEHRLCTNRLKLTDYLVKPMQRLTKYPLLLKAIHKKTQDEEMKEGIWKMILTVESLLSKVNGAMREMYERNKLRSVANRIQDNYTVIEAVNEEMEKILVNYNSLDLMEHIPG--------MDIPRCVIHEGPLRLVEKQGKMDVHVFLFTDLLLITKPKKADK---------------------------------------YRVIKPPMMVDKLYVH--------ASKDPGTFLLVYVNEYNTVVHAFALQGSN-ADQTQWMDAIRKAQK 761          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Nematostella
Match: EDO41824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3B5])

HSP 1 Score: 51.6026 bits (122), Expect = 1.625e-6
Identity = 48/148 (32.43%), Postives = 68/148 (45.95%), Query Frame = 2
Query: 1004 MEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTP--EEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYLDTL-KKNEIFMEF-DKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYT 1426
            ME    +Q  G L+      +F NL EL  V+  F      +L   +     EF Q ++    L        N D F SY   C     A A L++L KKNE+   F +  C ++ + +++ L   L+AP+Q   K PLLLS IRK T
Sbjct:  963 MEFYSPMQSGGILIPEHLAAIFLNLQELVEVNSKFSSRLQHSLEESVAKGDAEFCQVNIGSVFL-------ENVDFFQSYKIYCSKQNAASALLESLQKKNELLKIFLNVTCRENPKCRKMDLTSFLLAPVQRIMKYPLLLSRIRKST 1103          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Nematostella
Match: EDO39595 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9L2])

HSP 1 Score: 50.8322 bits (120), Expect = 2.017e-6
Identity = 76/306 (24.84%), Postives = 131/306 (42.81%), Query Frame = 2
Query:  902 ISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDD---VFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTL--IRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIM----WLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIF---------LNEGNKVVEMYMFLFDDILIMTKIK 1765
            I   E  R+EA++E+   E ++L   L +L   FM+   +LQ D     VE      +FGN+  +   S      F+T L +        + S ++ T+  I     ++  D++  YC +       L  L KN  F+E  +   +    Q L     LV PMQ  T++PLL+  I        ++ +      +T+  L+S++  +       R  ER++E+ +         ++P +   EF     + +P   + +N  R LL  G +          L +  K   +YMFLF+D+L+M K K
Sbjct:   18 IDPTERKRQEAMFEVITSEASYL-KSLNILGSHFMDS-PELQADTAQSVVEKSQQRVLFGNVKGVLEAS----EKFLTALRQRQ------RKSYVISTISDIIEEHATQYFDIYIKYCSHQVYQDRILKELGKNPRFVEAVRRLEQCSTAQCLSFQSFLVLPMQRITRLPLLVDAICHRCEEGSDEFV------RTDKALKSINKVVHDCNEGARKMERMEELIA---------LQPLI---EF-----AVKPVALVSSN--RWLLRRGEVLLVTEEFKSPLRKKIKTKPVYMFLFNDLLLMCKKK 286          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Medaka
Match: plekhg7 (pleckstrin homology and RhoGEF domain containing G7 [Source:NCBI gene;Acc:101166867])

HSP 1 Score: 248.44 bits (633), Expect = 4.013e-70
Identity = 136/388 (35.05%), Postives = 221/388 (56.96%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDEL 2086
            R+EA+WELF  E  + LD LMVL   F+  L  LQ+   L  V    +F N++ELC VS +F R+ +  +   +   E G  ++L   L+  +      +    YCLNY +A+ YLD+LK  E F  + KWC + E+ +RLQL DLLVAP+Q  T+  LLL ++ K     EE+  +    ++ +  +  L+ K+ WL NF++++ ++  LVW  + + + R FIPE LKH+L     + LI++  R LLHEG + L E  K+++ Y+FLFD+ L++TKIKK  K+   S        D +    Q+ N +    L+   EG+ F V  QP++LDR  L ++    A  + + H+F+++H +R+QQ I  + +Q+++E +K  W+ ++
Sbjct:  332 RQEAIWELFTSECVYFLDQLMVLNEVFLVTLSNLQLRNCLTDVNVWSLFANVNELCLVSSSFLRNLLNVIKDTLEITESGGPTLL--ELLSKAFKESICNSLQKYCLNYSSALLYLDSLKLREDFGSYLKWCERKEQCRRLQLRDLLVAPLQRLTRYSLLLRNVAKRCQEEEERRGMQVIAEQVDTSICDLEGKVKWLHNFQKVKLLRDALVWTPVWERDKRAFIPETLKHLLKTVTADNLISH--RSLLHEGKLVLTENTKLIDAYLFLFDEFLLITKIKKNKKRSLTS--------DQNPLRVQQQNLELDQLLK---EGSTFTVLDQPISLDRLQLKNIDQLNASTSGLPHSFIIMHHNRYQQCIGAFILQAASESAKREWISKI 704          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Medaka
Match: plekhg7 (pleckstrin homology and RhoGEF domain containing G7 [Source:NCBI gene;Acc:101166867])

HSP 1 Score: 227.254 bits (578), Expect = 1.630e-65
Identity = 133/391 (34.02%), Postives = 217/391 (55.50%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILI---MTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDEL 2086
            R+EA+WELF  E  + LD LMVL   F+  L  LQ+   L  V    +F N++ELC VS +F R+ +  +   +   E G  ++L   L+  +      +    YCLNY +A+ YLD+LK  E F  + KWC + E+ +RLQL DLLVAP+Q  T+  LLL ++ K     EE+  +    ++ +  +  L+ K+ WL NF++++ ++  LVW  + + + R FIPE LKH+L     + LI++  R LLHEG + L E  K+++ Y+FLFD+ L+   + K KK P +V                  Q+ N +    L+   EG+ F V  QP++LDR  L ++    A  + + H+F+++H +R+QQ I  + +Q+++E +K  W+ ++
Sbjct:   25 RQEAIWELFTSECVYFLDQLMVLNEVFLVTLSNLQLRNCLTDVNVWSLFANVNELCLVSSSFLRNLLNVIKDTLEITESGGPTLL--ELLSKAFKESICNSLQKYCLNYSSALLYLDSLKLREDFGSYLKWCERKEQCRRLQLRDLLVAPLQRLTRYSLLLRNVAKRCQEEEERRGMQVIAEQVDTSICDLEGKVKWLHNFQKVKLLRDALVWTPVWERDKRAFIPETLKHLLKTVTADNLISH--RSLLHEGKLVLTENTKLIDAYLFLFDEFLLITKIKKNKKNPLRV------------------QQQNLELDQLLK---EGSTFTVLDQPISLDRLQLKNIDQLNASTSGLPHSFIIMHHNRYQQCIGAFILQAASESAKREWISKI 390          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Medaka
Match: plekhg6 (pleckstrin homology and RhoGEF domain containing G6 [Source:NCBI gene;Acc:101169881])

HSP 1 Score: 107.457 bits (267), Expect = 2.618e-23
Identity = 117/484 (24.17%), Postives = 202/484 (41.74%), Query Frame = 2
Query:  842 EIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREM--TPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYL-DTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLV----WPSITDMEPRVFIPEFLKHILSRQPCERLIANP---KRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQ---NFQE---KLKEKLQNRNFSSPQTNKHSKVLNSMHKPN-IDSNAPYYQDSPT 2242
            E  W+DL+       +N   ++ ++  ++EA+WEL   EL ++ + L ++K   +  L  L   G L  V PD +F NL  +      F ++ +  + +E+  T + F    +    L    Q      V+  YC   EN++ +    ++ N  F  F +W     + +R++L D+   P Q  TK PLLL  + K+T  P  Q  L   L     +L S++D  M  ++ E+   I ++ V       IT+ E   ++ E  K  L    C     NP   ++ LL E L      ++ +E+   LF D++++TKI+K                                       G   +V + PLALDR         E +A     +F+L+ V   Q V+ V    + T LS + W+  ++Q+++   N +E   K +E L+ +     +            KPN I+ +    QD P+
Sbjct:  149 EKSWTDLV-------QNHLTMTKMQRHQQEALWELISTELIYI-NKLKIIKDLVIAALLNLHQRGFLQEVSPDQLFYNLPSILQAHQLFWQEVVYPMVQEVRQTGKPFDPMGLEEGCL----QFHNRFLVYREYCWEEENSLDFTRKQMESNPHFQTFIQWVESHPQGERMRLGDMQAKPHQRITKYPLLLKAVLKHTVEPPVQLALIGMLSSVNIFLESIND-YMQKKDDEQALYISARRVEGYEVEGITE-EIDKYVQEICKFNLE---CPIRGVNPEVVRKLLLEENLKVRVRKDQKLEVVALLFSDVILLTKIQK--------------------------------------RGEGLKVVRPPLALDRI--------ECIALKDGSSFLLVEVGELQSVMNVLIFVAGTSLSCSKWVSTINQAKEMLKNLRELETKRQEGLRAQQMEGKKVKGEDMETEEPPKPNAINGSHKAGQDQPS 569          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Medaka
Match: plekhg5b (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:101161470])

HSP 1 Score: 105.531 bits (262), Expect = 1.298e-22
Identity = 97/410 (23.66%), Postives = 173/410 (42.20%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRD-FITTLTREMTPEEFGQTSVLVKTL----IRWSQHSRNGDVFHSYCLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL-VWPSITDMEPRV--FIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTK-IKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRF---SLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQ 2110
            ++EA+WEL   E  ++   L V+   F+  L  LQ  G L  VEP  +F N+ E+  +  +      +  L R          ++L         R+  + R       YC+  E+ M Y+ TL + NE+F ++  W    ++  RL+L D+L  P Q  TK PLLL  + K T     + +++  +   E ++ S+D ++   +  ++L  I +++  + ++      V   + E+ +  L   P         RQL  EG + + EG +  +++Y FLF D+L++TK +K+L K                                        +V +QPL +       L D G           +F+LI+++ F   +A YT Q+++      W+D +   Q   Q
Sbjct:  401 QQEAIWELLNTEAAYI-KKLRVITDLFLSGLLNLQESGLLSEVEPTRLFSNIQEIVRLHTSLWNQVMLPVLHRAREARALLDPTLLYDGFRTFDTRFQPYIR-------YCMEEESCMEYMRTLLRDNELFRKYITWAETKKQCNRLKLADMLAKPHQRLTKYPLLLKSVLKKTDELSARDIVSSMVVMVESFINSVDSQMRQRQERQKLATISARIDCYEAVEGSSEEVEKILKEYNRFDL-MAPMRGTSPEETRQLQLEGALRMKEGKDSRMDVYCFLFTDLLLITKPVKRLEK---------------------------------------VKVIRQPLLIHNIVCKELKDPG-----------SFILIYLNEFNSAVAAYTFQANSATQGRCWIDAIYNIQNQLQ 751          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Medaka
Match: plekhg5b (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:101161470])

HSP 1 Score: 104.375 bits (259), Expect = 2.336e-22
Identity = 97/410 (23.66%), Postives = 173/410 (42.20%), Query Frame = 2
Query:  923 RREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRD-FITTLTREMTPEEFGQTSVLVKTL----IRWSQHSRNGDVFHSYCLNYENAMAYLDTL-KKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQL-VWPSITDMEPRV--FIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTK-IKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRF---SLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQ 2110
            ++EA+WEL   E  ++   L V+   F+  L  LQ  G L  VEP  +F N+ E+  +  +      +  L R          ++L         R+  + R       YC+  E+ M Y+ TL + NE+F ++  W    ++  RL+L D+L  P Q  TK PLLL  + K T     + +++  +   E ++ S+D ++   +  ++L  I +++  + ++      V   + E+ +  L   P         RQL  EG + + EG +  +++Y FLF D+L++TK +K+L K                                        +V +QPL +       L D G           +F+LI+++ F   +A YT Q+++      W+D +   Q   Q
Sbjct:  357 QQEAIWELLNTEAAYI-KKLRVITDLFLSGLLNLQESGLLSEVEPTRLFSNIQEIVRLHTSLWNQVMLPVLHRAREARALLDPTLLYDGFRTFDTRFQPYIR-------YCMEEESCMEYMRTLLRDNELFRKYITWAETKKQCNRLKLADMLAKPHQRLTKYPLLLKSVLKKTDELSARDIVSSMVVMVESFINSVDSQMRQRQERQKLATISARIDCYEAVEGSSEEVEKILKEYNRFDL-MAPMRGTSPEETRQLQLEGALRMKEGKDSRMDVYCFLFTDLLLITKPVKRLEK---------------------------------------VKVIRQPLLIHNIVCKELKDPG-----------SFILIYLNEFNSAVAAYTFQANSATQGRCWIDAIYNIQNQLQ 707          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Planmine SMEST
Match: SMESG000022039.1 (SMESG000022039.1)

HSP 1 Score: 1722.6 bits (4460), Expect = 0.000e+0
Identity = 838/839 (99.88%), Postives = 839/839 (100.00%), Query Frame = 2
Query:  236 MPVKSTKNVLIRGKFRVLKRVNTVHSPDYMDELDNYMNVSGIQIDRCGSSNSLNGELRLEKFDPPEGLTGTGRRGAMIAGKNYIEDTAEVTSVQSLDVDSKGNKSETDYKRSSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPSTSTFHTEDSRRKGLSFLKLIDKKVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQNRNFSSPQTNKHSKVLNSMHKPNIDSNAPYYQDSPTTYSENFEWPRSCLTSLPXXXXXXXXXXXXVLSSVDKDSKNSNYHRQGTDYLHHQPPTDLSFLMTTAPFSPPLSPTLHQDFPTLPCGKIENHIERMLGTINDQTDCRGRSYSQPTRSPSENETNSGTRSVSINVTANIGFRGDLIRHHQSNLSRQNSESDESLETVKANEH 2752
            MPVKSTKNVLIRGKFRVLKRVNTVHSPDYMDELDNYMNVSGIQIDRCGSSNSLNGELRLEKFDPPEGLTGTGRRGAMIAGKNYIEDTAEVTSVQSLDVDSKGNKSETDYKRSSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPSTSTFHTEDSRRKGLSFLKLIDKKVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQNR+FSSPQTNKHSKVLNSMHKPNIDSNAPYYQDSPTTYSENFEWPRSCLTSLPTSGTSGQSTKTTVLSSVDKDSKNSNYHRQGTDYLHHQPPTDLSFLMTTAPFSPPLSPTLHQDFPTLPCGKIENHIERMLGTINDQTDCRGRSYSQPTRSPSENETNSGTRSVSINVTANIGFRGDLIRHHQSNLSRQNSESDESLETVKANEH
Sbjct:    1 MPVKSTKNVLIRGKFRVLKRVNTVHSPDYMDELDNYMNVSGIQIDRCGSSNSLNGELRLEKFDPPEGLTGTGRRGAMIAGKNYIEDTAEVTSVQSLDVDSKGNKSETDYKRSSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPSTSTFHTEDSRRKGLSFLKLIDKKVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQNRDFSSPQTNKHSKVLNSMHKPNIDSNAPYYQDSPTTYSENFEWPRSCLTSLPTSGTSGQSTKTTVLSSVDKDSKNSNYHRQGTDYLHHQPPTDLSFLMTTAPFSPPLSPTLHQDFPTLPCGKIENHIERMLGTINDQTDCRGRSYSQPTRSPSENETNSGTRSVSINVTANIGFRGDLIRHHQSNLSRQNSESDESLETVKANEH 839          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Planmine SMEST
Match: SMESG000056370.1 (SMESG000056370.1)

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 366/755 (48.48%), Postives = 489/755 (64.77%), Query Frame = 2
Query:  245 KSTKNVLIRGKFRVLKRVNTVHSPDYMDELDNYMNVSGIQIDRCGSSNSLNGELRLEKFDPPEGLTGTGRRGAMIAGKNYI-EDTAEVTSVQSLDVDSKGNKSETDYKRSSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPSTSTFHT----EDSRRKGL-SFLKLIDKKVRIRESVTDVQEALLNLKKSNFRDSYLASFKEIHWSDLIPH-NEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKKNEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLFDDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTEGAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVYTIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQNRNFSSPQTNKHSKVLNSMHKPNIDSNAPYYQDSPTTYSENFEWPR--SCLTSLPXXXXXXXXXXXXVLSSVDKDSKNSNYHRQGTDYLHHQPPTDLSFLMTTAPFSPPLSPTLHQDF 2482
            +  + V+++GKFRVLKR NT+H+        + M+       R GSS+S+  +   +  +  E ++  GRR A+I   N I E +   ++   L  D   N  E+             IP V  +KEQ  KK L++Q+TI+++   TS+  +    +D RRK   SFLKLIDKK + +ES+ D+QEAL  +K S F DS L S+ ++HW+DLIPH N++  E    + D+E  RR+AVWELFK EL FL+DHL+VLKHCFMEPLK LQV+GHLMF+EP D++GNLDELCYVSY FCRDFIT LT+E T  EFG T  L++   +WSQHS++G+VFH+YC+NYE A+  LD L+K E F+EF++WC  D R  RLQL+DLLVAPMQH TKMPLLLS IRKYT    E+  LT +L K E+ LR+L+DK+ WL+NFERLQEIQSQL+W  I++MEPR+FIPEFLKH LS QPCERLIANPKR L+HEG +FLN+  K VE+Y FLFDD  ++ KIKK PK                    +KS S+S+ Q RSPT+GA+F VY+QP+ALDRF++HDVG  EA AN +++AFVL+ ++RFQQ+I VYT+QS+T++ K  W+++L   QQ FQEKLK KLQ+  +S  QTNKHSK+LN +        +  Y +  +  S +    R  S  T +  +          +L      + NS       + L ++P       +T   FSPPLSPT+H DF
Sbjct:    3 REGRGVVVKGKFRVLKRTNTMHASTNFHHSKSLMS-------RSGSSHSIASDPE-DCSEGNEAISRRGRRSAIIDNLNIIGESSNSQSNNNPLKTDQTSNAPESKINNIIETNVQTTIPSVNIIKEQQ-KKILKKQNTIADLTAKTSSVSSSTLSDDGRRKSAKSFLKLIDKKSKSKESMLDLQEALKTIKPSEFHDSLLMSYYDLHWTDLIPHSNKLETETL--VPDMECRRRDAVWELFKSELVFLVDHLLVLKHCFMEPLKALQVEGHLMFIEPQDLYGNLDELCYVSYNFCRDFITALTKEATVLEFGTTDFLLRAFTKWSQHSKDGEVFHNYCINYECALTLLDILQKYEPFLEFERWCEMDPRCHRLQLSDLLVAPMQHYTKMPLLLSCIRKYTIPITEKQQLTTSLHKFENSLRNLEDKMRWLKNFERLQEIQSQLIWLPISEMEPRIFIPEFLKHSLSNQPCERLIANPKRTLMHEGYLFLNDSGKTVEVYGFLFDDFFLIAKIKKTPK--------------------KKSVSESNIQTRSPTDGALFIVYRQPIALDRFTIHDVGYVEANANGLRNAFVLVIMTRFQQIIGVYTLQSATDIMKNTWIEKLRIGQQQFQEKLKFKLQSDGYSQ-QTNKHSKLLNQIKSIQNCKESSIYLNVESNPSSSPLSSRHGSLSTLITNASDMQLKIPCDILYDSLSLNSNSTSVPTTPEKLPNRPDDIQYTSLTPGSFSPPLSPTIH-DF 724          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.333e-14
Identity = 77/297 (25.93%), Postives = 138/297 (46.46%), Query Frame = 2
Query:  923 RREAVWELFKCELNFL-----LDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYLDTLKK-NEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQS-----QLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKK 1768
            ++ A+WEL   E NFL     +  + V+    + P        +   V  +++F NL ++  VS+ F +  I  +      E +  T  + K  +      + G++   Y   C       + + +L+K NE+F E+ KW    E   R  L D L  P    TK  +LL  I+KY +  +E+  + E +D  + ++  +++KI      ++LQ + S      ++ P   D+ P   I ++ K  L+  P +       R++L +G + L EG +K V++ +FL  DIL++TK KK
Sbjct:  130 QQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRP-------KYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVI-----ENYETTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKY-SGIDEKKEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIP--IINQYSKLDLT-APIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKK 410          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.717e-14
Identity = 77/297 (25.93%), Postives = 138/297 (46.46%), Query Frame = 2
Query:  923 RREAVWELFKCELNFL-----LDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYLDTLKK-NEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQS-----QLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKK 1768
            ++ A+WEL   E NFL     +  + V+    + P        +   V  +++F NL ++  VS+ F +  I  +      E +  T  + K  +      + G++   Y   C       + + +L+K NE+F E+ KW    E   R  L D L  P    TK  +LL  I+KY +  +E+  + E +D  + ++  +++KI      ++LQ + S      ++ P   D+ P   I ++ K  L+  P +       R++L +G + L EG +K V++ +FL  DIL++TK KK
Sbjct:  116 QQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRP-------KYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVI-----ENYETTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKY-SGIDEKKEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIP--IINQYSKLDLT-APIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKK 396          
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 75.485 bits (184), Expect = 5.531e-14
Identity = 77/297 (25.93%), Postives = 138/297 (46.46%), Query Frame = 2
Query:  923 RREAVWELFKCELNFL-----LDHLMVLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLTREMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSY---CLNYENAMAYLDTLKK-NEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNPEEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQS-----QLVWPSITDMEPRVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEG-NKVVEMYMFLFDDILIMTKIKK 1768
            ++ A+WEL   E NFL     +  + V+    + P        +   V  +++F NL ++  VS+ F +  I  +      E +  T  + K  +      + G++   Y   C       + + +L+K NE+F E+ KW    E   R  L D L  P    TK  +LL  I+KY +  +E+  + E +D  + ++  +++KI      ++LQ + S      ++ P   D+ P   I ++ K  L+  P +       R++L +G + L EG +K V++ +FL  DIL++TK KK
Sbjct:   82 QQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRP-------KYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVI-----ENYETTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKY-SGIDEKKEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIP--IINQYSKLDLT-APIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKK 362          
The following BLAST results are available for this feature:
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHG78.045e-6831.18pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG74.257e-5531.08pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG67.287e-2424.55pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG67.694e-2424.55pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG67.694e-2424.55pleckstrin homology and RhoGEF domain containing G... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prhg-11.369e-9536.91pep chromosome:WBcel235:I:912415:926562:-1 gene:WB... [more]
prhg-11.558e-9536.91pep chromosome:WBcel235:I:912415:919147:-1 gene:WB... [more]
prhg-11.699e-9536.91pep chromosome:WBcel235:I:912415:926562:-1 gene:WB... [more]
prhg-11.809e-9536.91pep chromosome:WBcel235:I:912415:926877:-1 gene:WB... [more]
prhg-11.847e-9536.91pep chromosome:WBcel235:I:912415:926877:-1 gene:WB... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG426744.584e-1422.91gene:FBgn0261556 transcript:FBtr0332698[more]
CG426744.584e-1422.91gene:FBgn0261556 transcript:FBtr0302716[more]
CG426745.414e-1422.91gene:FBgn0261556 transcript:FBtr0332699[more]
CG426747.681e-1422.91gene:FBgn0261556 transcript:FBtr0302715[more]
CG426748.417e-1422.91gene:FBgn0261556 transcript:FBtr0302713[more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg73.235e-7433.19pleckstrin homology domain containing, family G (w... [more]
plekhg74.841e-7235.64pleckstrin homology domain containing, family G (w... [more]
plekhg5a2.764e-2223.84pleckstrin homology domain containing, family G (w... [more]
plekhg5a3.261e-2223.84pleckstrin homology domain containing, family G (w... [more]
plekhg5a3.261e-2223.84pleckstrin homology domain containing, family G (w... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHG72.567e-7431.51pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG71.025e-7034.11pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG71.175e-5734.85pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG52.647e-2224.67pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG52.719e-2224.67pleckstrin homology and RhoGEF domain containing G... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plekhg61.526e-2424.57pleckstrin homology domain containing, family G (w... [more]
Plekhg51.592e-2223.77pleckstrin homology domain containing, family G (w... [more]
Plekhg51.985e-2223.77pleckstrin homology domain containing, family G (w... [more]
Plekhg52.022e-2223.77pleckstrin homology domain containing, family G (w... [more]
Plekhg52.082e-2223.77pleckstrin homology domain containing, family G (w... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6ZR37|PKHG7_HUMAN2.044e-5431.08Pleckstrin homology domain-containing family G mem... [more]
sp|Q8R0J1|PKHG6_MOUSE1.067e-2324.57Pleckstrin homology domain-containing family G mem... [more]
sp|Q3KR16|PKHG6_HUMAN3.695e-2324.55Pleckstrin homology domain-containing family G mem... [more]
sp|Q6RFZ7|PKHG5_RAT6.779e-2324.65Pleckstrin homology domain-containing family G mem... [more]
sp|Q66T02|PKHG5_MOUSE1.113e-2123.77Pleckstrin homology domain-containing family G mem... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RJA90.000e+051.25Pleckstrin domain-containing family G member OS=Fa... [more]
A0A267H4N20.000e+051.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GES20.000e+051.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GEU50.000e+051.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H2590.000e+051.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg72.170e-7135.10pleckstrin homology domain containing, family G (w... [more]
plekhg5a1.270e-1624.75pleckstrin homology domain containing, family G (w... [more]
plekhg68.781e-1520.79pleckstrin homology domain containing, family G (w... [more]
arhgef12b2.050e-1424.82Rho guanine nucleotide exchange factor (GEF) 12b [... [more]
arhgef12b2.468e-1424.82Rho guanine nucleotide exchange factor (GEF) 12b [... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006962.16.917e-828.10pep scaffold:Pmarinus_7.0:GL481838:263808:335470:1... [more]
dnmbp1.135e-726.23dynamin binding protein [Source:NCBI gene;Acc:1000... [more]
ENSPMAT00000002100.11.584e-728.42pep scaffold:Pmarinus_7.0:GL476406:348473:416758:-... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO496944.434e-9838.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396083.433e-2221.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418241.625e-632.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395952.017e-624.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg74.013e-7035.05pleckstrin homology and RhoGEF domain containing G... [more]
plekhg71.630e-6534.02pleckstrin homology and RhoGEF domain containing G... [more]
plekhg62.618e-2324.17pleckstrin homology and RhoGEF domain containing G... [more]
plekhg5b1.298e-2223.66pleckstrin homology and RhoGEF domain containing G... [more]
plekhg5b2.336e-2223.66pleckstrin homology and RhoGEF domain containing G... [more]
back to top
BLAST of Pleckstrin homology domain-containing family G member 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022039.10.000e+099.88SMESG000022039.1[more]
SMESG000056370.10.000e+048.48SMESG000056370.1[more]
SMESG000023540.14.333e-1425.93SMESG000023540.1[more]
SMESG000023540.14.717e-1425.93SMESG000023540.1[more]
SMESG000023540.15.531e-1425.93SMESG000023540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000338 ID=SMED30000338|Name=Pleckstrin homology domain-containing family G member 7|organism=Schmidtea mediterranea sexual|type=transcript|length=2826bp
CTGAAACAGATGACAAACGACATACAAGTTCGATAGAGAAAAAATATCCG
TACTTTATGAGTTAGGAATTATTACATCGTCATCAAATTCATTTCTACTA
ATTTGCTCAGTTGAATCAATTCCTTAATCATTGTTGATTCATTCGCTGTT
TATTTCAACTTGGTTTTATCGTTCAATTAGATTTATTCGACGAATTATTC
TGAAAAACCTCCGGATAATACAATATAATCTTATTATGCCAGTCAAAAGC
ACGAAAAATGTTTTAATAAGAGGAAAATTTCGAGTTCTCAAGCGCGTTAA
TACTGTTCATAGTCCTGATTATATGGATGAATTAGACAATTATATGAATG
TATCAGGAATACAGATTGATAGATGTGGAAGCTCAAACAGTCTTAATGGT
GAATTAAGACTTGAAAAATTTGATCCTCCAGAAGGTCTGACTGGAACCGG
AAGAAGAGGAGCTATGATTGCAGGAAAAAATTACATCGAAGATACTGCTG
AAGTAACTTCTGTGCAAAGTCTAGATGTGGACAGCAAAGGTAACAAAAGT
GAAACAGACTACAAACGATCCTCTATTGTTCTTGGAATGCAAATGATCCC
AGGAGTAGAAACTTTAAAAGAGCAGCATAATAAAAAAACGCTCAGAAGAC
AACACACGATAAGTGAAATAAATCCGAGTACTTCTACTTTTCACACAGAA
GATTCTCGAAGGAAAGGTTTATCATTTCTGAAATTGATTGACAAAAAAGT
GCGGATACGTGAGAGTGTCACAGATGTTCAAGAAGCTTTATTAAATCTTA
AAAAATCAAATTTTCGGGACAGTTACTTGGCTTCTTTTAAGGAAATCCAT
TGGTCAGATCTTATACCACATAACGAAATTCCGAATGAAAATTCTCCTAA
AATATCAGATATTGAAAATCTTCGTAGAGAAGCCGTTTGGGAACTCTTTA
AATGTGAACTTAATTTTTTACTGGATCACTTAATGGTGTTGAAACACTGC
TTCATGGAACCGTTGAAAAAGTTGCAAGTAGACGGGCATTTGATGTTTGT
TGAGCCAGACGATGTCTTTGGGAATCTCGATGAGCTTTGCTATGTTAGTT
ATACATTTTGTCGAGATTTTATTACAACACTAACAAGAGAGATGACTCCA
GAAGAATTCGGTCAAACGTCAGTACTGGTGAAAACGTTAATAAGGTGGAG
TCAGCATTCAAGAAATGGGGACGTTTTCCACAGTTATTGTTTGAATTATG
AAAATGCAATGGCTTATTTAGATACATTGAAAAAAAATGAAATTTTTATG
GAATTTGATAAGTGGTGTAACAAAGACGAAAGACTGCAAAGACTTCAACT
TAATGATTTGTTGGTAGCTCCTATGCAACATTGCACCAAAATGCCTCTTT
TATTAAGTCATATCAGAAAATATACTACTAATCCAGAAGAACAAACGTTG
CTCACTGAGACATTAGATAAAACTGAACATTATTTGAGAAGTCTTGATGA
TAAAATTATGTGGCTACGTAATTTTGAGCGATTACAAGAAATACAGAGTC
AACTTGTTTGGCCATCAATAACAGACATGGAACCTAGGGTTTTCATTCCG
GAATTTCTCAAGCATATACTTTCCAGACAGCCCTGTGAAAGATTAATTGC
AAATCCCAAACGACAGCTTCTCCACGAAGGACTTATTTTTTTAAATGAAG
GAAATAAAGTAGTTGAGATGTACATGTTTCTCTTTGATGATATTCTAATT
ATGACAAAAATTAAAAAGCTTCCAAAAAAAGTATCAAACAGTTTCACAGA
GCAGCCATCAATGGGAGATTGTGATTGCTTCTGTGGTCAAAAATCCAATT
CAGATTCAAGTAGCCAACTTCGATCTCCAACTGAAGGTGCTATCTTTCAA
GTATATAAACAACCTTTAGCTTTGGACAGGTTTAGTTTGCATGACGTCGG
AAATTCAGAAGCATTAGCCAATAATATTAAACATGCCTTTGTATTAATCC
ATGTGAGCAGATTCCAGCAAGTCATCGCGGTCTATACGATTCAATCCAGT
ACAGAATTAAGTAAAGCAGTTTGGATGGATGAACTTTCTCAAAGCCAACA
AAATTTTCAAGAGAAATTAAAAGAAAAATTGCAAAATCGAAATTTTTCCA
GTCCTCAAACTAATAAGCACAGTAAAGTATTGAACAGTATGCACAAACCA
AACATTGATTCTAATGCTCCATATTATCAAGATTCTCCAACAACTTATTC
TGAAAATTTTGAATGGCCAAGATCATGTTTGACATCTTTACCCACAAGCG
GTACATCAGGTCAATCAACGAAAACTACAGTTTTATCATCGGTTGATAAA
GATAGCAAAAATTCAAATTATCACAGACAAGGTACAGATTATCTCCATCA
TCAGCCTCCAACTGATTTATCATTTTTAATGACAACTGCTCCGTTTTCTC
CTCCACTTTCTCCAACACTTCATCAAGATTTTCCCACTTTGCCGTGTGGA
AAAATTGAAAACCACATTGAAAGAATGCTTGGGACCATAAATGACCAAAC
TGATTGTAGAGGGCGATCCTACAGTCAACCAACGAGAAGTCCGTCTGAAA
ACGAAACCAATTCCGGAACTCGAAGCGTTTCAATAAATGTTACTGCAAAT
ATAGGATTTCGTGGAGATCTAATTCGACATCATCAATCAAATCTTTCAAG
ACAGAATTCGGAATCTGACGAATCGCTGGAGACCGTCAAAGCGAATGAAC
ATTGACAATCCAGTTTATTGTCTATAGAAAAAAATTGTGTTTTGAGTGAT
TTTTTCTCAAAGATTTTTGATTTGTC
back to top

protein sequence of SMED30000338-orf-1

>SMED30000338-orf-1 ID=SMED30000338-orf-1|Name=SMED30000338-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=840bp
MPVKSTKNVLIRGKFRVLKRVNTVHSPDYMDELDNYMNVSGIQIDRCGSS
NSLNGELRLEKFDPPEGLTGTGRRGAMIAGKNYIEDTAEVTSVQSLDVDS
KGNKSETDYKRSSIVLGMQMIPGVETLKEQHNKKTLRRQHTISEINPSTS
TFHTEDSRRKGLSFLKLIDKKVRIRESVTDVQEALLNLKKSNFRDSYLAS
FKEIHWSDLIPHNEIPNENSPKISDIENLRREAVWELFKCELNFLLDHLM
VLKHCFMEPLKKLQVDGHLMFVEPDDVFGNLDELCYVSYTFCRDFITTLT
REMTPEEFGQTSVLVKTLIRWSQHSRNGDVFHSYCLNYENAMAYLDTLKK
NEIFMEFDKWCNKDERLQRLQLNDLLVAPMQHCTKMPLLLSHIRKYTTNP
EEQTLLTETLDKTEHYLRSLDDKIMWLRNFERLQEIQSQLVWPSITDMEP
RVFIPEFLKHILSRQPCERLIANPKRQLLHEGLIFLNEGNKVVEMYMFLF
DDILIMTKIKKLPKKVSNSFTEQPSMGDCDCFCGQKSNSDSSSQLRSPTE
GAIFQVYKQPLALDRFSLHDVGNSEALANNIKHAFVLIHVSRFQQVIAVY
TIQSSTELSKAVWMDELSQSQQNFQEKLKEKLQNRNFSSPQTNKHSKVLN
SMHKPNIDSNAPYYQDSPTTYSENFEWPRSCLTSLPTSGTSGQSTKTTVL
SSVDKDSKNSNYHRQGTDYLHHQPPTDLSFLMTTAPFSPPLSPTLHQDFP
TLPCGKIENHIERMLGTINDQTDCRGRSYSQPTRSPSENETNSGTRSVSI
NVTANIGFRGDLIRHHQSNLSRQNSESDESLETVKANEH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005089Rho guanyl-nucleotide exchange factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035899DBL_dom_sf
IPR040181PKHG5/7
IPR000219DH-domain
IPR001849PH_domain
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 614..634
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 771..798
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 686..706
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 768..798
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 817..839
NoneNo IPR availablePANTHERPTHR13217:SF6PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY G MEMBER 7coord: 128..641
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 464..623
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 478..624
e-value: 6.9E-4
score: 28.9
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 477..622
score: 7.831
IPR000219Dbl homology (DH) domainSMARTSM00325RhoGEF_3coord: 233..422
e-value: 4.6E-16
score: 69.4
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 234..416
e-value: 5.2E-22
score: 79.0
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 229..423
score: 22.101
IPR000219Dbl homology (DH) domainCDDcd00160RhoGEFcoord: 230..412
e-value: 1.59748E-21
score: 90.82
IPR035899Dbl homology (DH) domain superfamilyGENE3DG3DSA:1.20.900.10coord: 204..441
e-value: 2.3E-43
score: 150.4
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 217..443
IPR040181Pleckstrin homology domain-containing family G member 5/7PANTHERPTHR13217FAMILY NOT NAMEDcoord: 128..641