MFS domain-containing protein

Overview
NameMFS domain-containing protein
Smed IDSMED30000319
Length (bp)1531
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS domain-containing protein (SMED30000319) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30000319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS domain-containing protein (SMED30000319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30000319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000319SMESG000069685.1 PL05003A2D04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30000319SMESG000069685.1 dd_Smed_v4_6986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: Y59A8B.21 (pep chromosome:WBcel235:V:17986260:17994546:1 gene:WBGene00013353.1 transcript:Y59A8B.21.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y59A8B.21)

HSP 1 Score: 95.5153 bits (236), Expect = 7.142e-21
Identity = 99/423 (23.40%), Postives = 182/423 (43.03%), Query Frame = 1
Query:   85 SSSKFRGLFVIL-GAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWII---GVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLIS---------------GSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKY--SRILGSISDHHIHLVGPISSCLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDE-QFHDWFLA--VCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLE 1281
            S S F  + VIL GA  I+LT G           M  YM N++     V     +WI    G   F M I    G    S   P ++   G ++ + S  +  + ++   ++  I YGL+ G+G G+AY   +ST   W P++ G++ GIV +G       F  +Q+ +++                 +  +P  F  L  IY  +Q +  IV+  PP       E+       +++E    + ++  ++D  +++   +++    F+ L+   F  SF+       Y  Y  S I   +       +  +++ + +I WG+L D TSF+  +   T  +SVF+    +   + +  F  W +   +C+GA         ++F     K FG ++   NYG L  S T+S ++ + + + +L+
Sbjct:   17 SFSPFNRICVILFGAVSIHLTIGTYHTFGNMLPYMASYMRNFTDPS--VRIEHMMWIPTFQGCFPFAMVI----GGLTSSTFSPRVSAFIGCFLVTSSVALSAYAIQHSFALFFIVYGLLFGLGSGIAYVTAVSTAINWAPDKIGVISGIVAAGFGLSSSIFAPIQTMIVNPLNLPATKDGYFLQPELLHRVPALFTKLAVIYGIMQAMALIVVCDPPFRKSRSTESILEEDDEDMDEDY-ERPVFDNDEDTTIQMTSSEMLKSPTFYCLFASLFCCSFYANMFYNLYKTYGESFIEDDMFMAMAFSIASVANAIARIGWGYLTDRTSFQIALSTATCLASVFLLTMPMTRELGKMAFLFWLVGTFICMGA-------THALFITATVKCFGNRHKANNYGYLILSTTTSGILLAAISQFYLK 425          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 86.6557 bits (213), Expect = 5.373e-18
Identity = 96/408 (23.53%), Postives = 178/408 (43.63%), Query Frame = 1
Query:  100 RGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYS--SIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLIS---------------GSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELD---FWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLG---KIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVIC 1254
            R   V++G  +  +TFGIV        +++ Y+ +Y    ++  +  GQ IW+  +++ G+ + M +G  +E K G     L G  I++      +++++   +  ++  G I  +G  +AY  +L T  +WFP+  GL  GI++ G          LQ+  I+                 ++ +P  F+ +   +   Q IG I I  P  DI  + EN                    +  ++E+ ++  ++  +L    F +L++    N+ W+   +  Y  Y +     SD  + L+G ISS      ++FWG + D TS++  M I  +CS   +  F+ +P +    +D      V  +F    G  S+FP +  K F   NF   YG L  +V+ + +I 
Sbjct:   16 RPWAVLVGGVMCMVTFGIVYTCG----NLLPYLVSYFRWKMYPDMRTGQLIWLQTLLS-GLPMGMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVNDQGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIHVETEN-------------------LIGTNSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFID-SDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSI--VCSLGAVLAFS-MPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIA 395          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693542:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 86.6557 bits (213), Expect = 5.373e-18
Identity = 96/408 (23.53%), Postives = 178/408 (43.63%), Query Frame = 1
Query:  100 RGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYS--SIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLIS---------------GSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELD---FWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLG---KIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVIC 1254
            R   V++G  +  +TFGIV        +++ Y+ +Y    ++  +  GQ IW+  +++ G+ + M +G  +E K G     L G  I++      +++++   +  ++  G I  +G  +AY  +L T  +WFP+  GL  GI++ G          LQ+  I+                 ++ +P  F+ +   +   Q IG I I  P  DI  + EN                    +  ++E+ ++  ++  +L    F +L++    N+ W+   +  Y  Y +     SD  + L+G ISS      ++FWG + D TS++  M I  +CS   +  F+ +P +    +D      V  +F    G  S+FP +  K F   NF   YG L  +V+ + +I 
Sbjct:   16 RPWAVLVGGVMCMVTFGIVYTCG----NLLPYLVSYFRWKMYPDMRTGQLIWLQTLLS-GLPMGMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVNDQGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIHVETEN-------------------LIGTNSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFID-SDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSI--VCSLGAVLAFS-MPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIA 395          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 86.6557 bits (213), Expect = 5.497e-18
Identity = 96/407 (23.59%), Postives = 178/407 (43.73%), Query Frame = 1
Query:  100 RGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYS--SIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLIS---------------GSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELD---FWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLG---KIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVI 1251
            R   V++G  +  +TFGIV        +++ Y+ +Y    ++  +  GQ IW+  +++ G+ + M +G  +E K G     L G  I++      +++++   +  ++  G I  +G  +AY  +L T  +WFP+  GL  GI++ G          LQ+  I+                 ++ +P  F+ +   +   Q IG I I  P  DI  + EN                    +  ++E+ ++  ++  +L    F +L++    N+ W+   +  Y  Y +     SD  + L+G ISS      ++FWG + D TS++  M I  +CS   +  F+ +P +    +D      V  +F    G  S+FP +  K F   NF   YG L  +V+ + +I
Sbjct:   30 RPWAVLVGGVMCMVTFGIVYTCG----NLLPYLVSYFRWKMYPDMRTGQLIWLQTLLS-GLPMGMVIGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVNDQGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIHVETEN-------------------LIGTNSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFID-SDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSI--VCSLGAVLAFS-MPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLI 408          
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Match: slc16a9a (solute carrier family 16 member 9a [Source:ZFIN;Acc:ZDB-GENE-040426-1364])

HSP 1 Score: 51.2174 bits (121), Expect = 2.125e-6
Identity = 37/121 (30.58%), Postives = 60/121 (49.59%), Query Frame = 1
Query:  229 NQGQTIWIIGVMTFGMGISMS--LGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLIS 585
             +G T W+ G M  G+ +  S     C+++  G     +F G + +    +  F     +S +I  YG++ G+G GL Y   L+   Q+F  RRGL  GIV +G +  G  +  LQ++LI 
Sbjct:   50 GKGMTAWV-GSMVSGVALITSPVCSACVDN-FGARPVTIFSGVMVAGGLMLSAFAPN--ISFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSVGGFIYATLQNELIE 166          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q51330|OXLT_OXAFO (Oxalate:formate antiporter OS=Oxalobacter formigenes OX=847 GN=oxlT PE=1 SV=3)

HSP 1 Score: 72.0182 bits (175), Expect = 2.942e-12
Identity = 73/328 (22.26%), Postives = 138/328 (42.07%), Query Frame = 1
Query:  310 SKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGL--IGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILG--------SISDHHIHLVGPISSCLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGV 1263
             K GP + ++FGG     +  +  +T    +  V   Y L  + G G+G+ YG+ ++T  +WFP++RGL  G   +G     + F  L S ++   ++ +  +F++ G I   +  + + VI+ P                    +    K I   + D        +++    FW+LW  FF  +F    + A    Y R LG         +S  ++   G    C  + FWGF+ D     + M ++   ++V + +F  I  + +      LA+     FF   G+ ++FP+  + +FG      NYG  + +  ++ +   G+
Sbjct:   78 DKFGPRIPLMFGG-----AMVLAGWTFMGMVDSVPALYALYTLAGAGVGIVYGIAMNTANRWFPDKRGLASGFTAAGYGLGVLPFLPLISSVL--KVEGVGAAFMYTGLIMGILIILIAFVIRFP-------------------GQQGAKKQIVVTDKD----FNSGEMLRTPQFWVLWTAFFSVNFGGLLLVANSVPYGRSLGLAAGVLTIGVSIQNLFNGG----C--RPFWGFVSDKIGRYKTMSVVFGINAVVLALFPTIAALGDVAFIAMLAIA----FFTWGGSYALFPSTNSDIFGTAYSARNYGFFWAAKATASIFGGGL 365          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|P37662|YHJX_ECOLI (Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) OX=83333 GN=yhjX PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 5.472e-9
Identity = 75/335 (22.39%), Postives = 145/335 (43.28%), Query Frame = 1
Query:  238 QTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKS-YLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFF---INSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAV-CVGAIFFFNSGNS-SVFPAMCAKLFGMKNFVFNYGMLF 1224
            Q  +  G+++ G+ IS S+   L+ + G     +  G +        + T  S  L ++ +  G++ G+  G  Y + LS   +WFP R+GL+    +       + F  + ++L+      L  +FV  G I   +   G+ ++K  P       E  +S+G  E +        Y+L +      KP        +W+L ++F    ++  ++  +    ++    L  +S  +   V  I++  G++  G L D  +  R++ I  + S V +      P     F   F A+ CV     FN G + +VFP++ ++ FG+ N   NYG+++
Sbjct:   47 QVAFSFGLLSLGLAISSSVAGKLQERFGVKRVTMASGILLGLG---FFLTAHSDNLMMLWLSAGVLVGLADGAGYLLTLSNCVKWFPERKGLISAFAIGSYGLGSLGFKFIDTQLL--ETVGLEKTFVIWGAIALLMIVFGATLMKDAPKQ-----EVKTSNGVVEKD--------YTLAESMR---KPQ-------YWMLAVMFLTACMSGLYVIGVAKDIAQSLAHLDVVSAANAVTVISIANLSGRLVLGILSDKIARIRVITIGQVISLVGMAALLFAPLNAVTF---FAAIACVA----FNFGGTITVFPSLVSEFFGLNNLAKNYGVIY 346          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|A0LNN5|SFMCT_SYNFM (L-lactate transporter OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) OX=335543 GN=Sfum_3364 PE=1 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 5.376e-7
Identity = 73/331 (22.05%), Postives = 127/331 (38.37%), Query Frame = 1
Query:  250 IIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPI--SSCLGKIFWGFLIDITSFK-RIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNS-SVFPAMCAKLFGMKNFVFNYGMLFTS 1230
            I G+MTF  G        L  K+GP   V+ GG + +    +  F    Y   + I YG+I G G G+ Y   ++T  +W+P+RR L  G  + G          L + +I          F + G     +  I    ++ PP            +G       +         D    E K      +  FW+L++ +F  SF    +    + + R  G  +      V  +  S+   +I  G+ +D    +     +  + ++  I IF +   +        +A+ +G    +N G   ++FPA C + +G      NYG+LFT+
Sbjct:   59 IFGLMTFPAGR-------LSDKMGPRKVVMTGGVLLAIGFILSGFIQSKY--QLYITYGVIAGFGGGMIYLPPIATAPKWWPDRRALATGFAVVGLGLGSFLMGPLATYIIEKPGMGWRYVFWYCGVAMGIMALIAGAFLEPPP-------AGWKPAGYTPPAPPAGAAAPKVTRDWTYEEAKG-----DTKFWLLYLAYFCGSFAGLMVIGHLAGFGRDAGLTAMAAAGAVSSLAFSNAATRILSGWFVDKIGIRVYFAALFALQTAAMIAIFQLGGSVVGLS---IVAIVIG----WNYGAMFTLFPATCLQFYGPTAQGSNYGLLFTA 361          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HL50 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.418e-60
Identity = 135/463 (29.16%), Postives = 240/463 (51.84%), Query Frame = 1
Query:   91 SKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGS--------------------IQNLPISFVFLGTIYAGIQFIGSIVIKGP-PPDIPEDLE------NNSSSGKWEINETSFTKNI-----YSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLG---KIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGCALSLLAALITIFFR 1374
            + ++G+  ++G F+I+ T G +         +V YM  +S   + +      WI G+  FG G SM+ G  +E +IG  +T L G WI S    + YF VKS+L ++++ YGL+ G+G G+AY V ++    WFP+RRGLV GIV++G     + FD+ Q+  I+                      I  +P  FVFLG IYA +Q +G  +++ P   ++ E  E      +++++ +  ++E S +K +        N   E++  P Q++ +  FW+LW  F +NS  + +I   Y  +    G ++DH++ +VG +++      ++ WG L D  +++ +M +++   +V +  F +          W+  + V A+F   +GN ++FPA CAKL+G  N   NYG+LFT+  +S +I + ++   L+D+    I +  +  +G A S L A+ T+ F 
Sbjct:    3 TPWKGIGAVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSH-SKWIGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKG-LNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTL------SGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGA-LLTTVLKDA----IGWLGLFLLGAAFSTLGAVFTLLFE 452          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A267H5U2 (MFS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000477g2 PE=4 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.703e-60
Identity = 135/463 (29.16%), Postives = 240/463 (51.84%), Query Frame = 1
Query:   91 SKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGS--------------------IQNLPISFVFLGTIYAGIQFIGSIVIKGP-PPDIPEDLE------NNSSSGKWEINETSFTKNI-----YSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLG---KIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGCALSLLAALITIFFR 1374
            + ++G+  ++G F+I+ T G +         +V YM  +S   + +      WI G+  FG G SM+ G  +E +IG  +T L G WI S    + YF VKS+L ++++ YGL+ G+G G+AY V ++    WFP+RRGLV GIV++G     + FD+ Q+  I+                      I  +P  FVFLG IYA +Q +G  +++ P   ++ E  E      +++++ +  ++E S +K +        N   E++  P Q++ +  FW+LW  F +NS  + +I   Y  +    G ++DH++ +VG +++      ++ WG L D  +++ +M +++   +V +  F +          W+  + V A+F   +GN ++FPA CAKL+G  N   NYG+LFT+  +S +I + ++   L+D+    I +  +  +G A S L A+ T+ F 
Sbjct:    5 TPWKGIGAVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSH-SKWIGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKG-LNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTL------SGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGA-LLTTVLKDA----IGWLGLFLLGAAFSTLGAVFTLLFE 454          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HYG0 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 6.283e-60
Identity = 135/463 (29.16%), Postives = 239/463 (51.62%), Query Frame = 1
Query:   91 SKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGS--------------------IQNLPISFVFLGTIYAGIQFIGSIVIKGP-PPDIPEDLE------NNSSSGKWEINETSFTKNI-----YSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLG---KIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGCALSLLAALITIFFR 1374
            + ++G+  ++G F+I+ T G +         +V YM  +S   + +      WI G+  FG G SM+ G  +E +IG  +T L G WI S    + YF VKS+L ++++ YGL+ G+G G+AY V ++    WFP+RRGLV GIV++G     + FD+ Q+  I+                      I  +P  FVFLG IYA +Q +G  +++ P   ++ E  E      +++++ +  ++E S +K +        N   E +  P Q++ +  FW+LW  F +NS  + +I   Y  +    G ++DH++ +VG +++      ++ WG L D  +++ +M +++   +V +  F +          W+  + V A+F   +GN ++FPA CAKL+G  N   NYG+LFT+  +S +I + ++   L+D+    I +  +  +G A S L A+ T+ F 
Sbjct:    3 TPWKGIGAVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSH-SKWIGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGESDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKG-LNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTL------SGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGA-LLTTVLKDA----IGWLGLFLLGAAFSTLGAVFTLLFE 452          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8H205 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.511e-58
Identity = 136/469 (29.00%), Postives = 243/469 (51.81%), Query Frame = 1
Query:   91 SKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGS--------------------IQNLPISFVFLGTIYAGIQFIGSIVIKGP-PPDIPEDLE------NNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLG---KIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGCALSLLAALITIFF----RGKSLIIE 1395
            + ++G+  ++G F+I+ T G +         +V YM  +S   + +      WI G+  FG G SM+ G  +E +IG  +T L G WI S    + YF VKS+L ++++ YGL+ G+G G+AY V ++    WFP+RRGLV GIV++G     + FD+ Q+  I+                      I  +P  FVFLG IYA +Q +G  +++ P   ++ E  E      +++++ +  ++E S +K   +      ++  P Q++ +  FW+LW  F +NS  + +I   Y  +    G ++DH++ +VG +++      ++ WG L D  +++ +M +++   +V +  F +          W+  + V A+F   +GN ++FPA CAKL+G  N   NYG+LFT+  +S +I + ++   L+D+    I +  +  +G A S L A+ T+ F    R + L+ E
Sbjct:    3 TPWKGIGAVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSH-SKWIGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKP-RAWKPRRRMDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKG-LNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTL------SGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGA-LLTTVLKDA----IGWLGLFLLGAAFSTLGAVFTLLFEVAGRRQELVGE 457          

HSP 2 Score: 100.138 bits (248), Expect = 1.621e-18
Identity = 62/244 (25.41%), Postives = 126/244 (51.64%), Query Frame = 1
Query:  667 IKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSL-----NDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLG---KIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGCALSLLAALITIFFR 1374
            + G   ++  +  +++++ +  ++E S +K +        N   E +  P Q++ +  FW+LW  F +NS  + +I   Y  +    G ++DH++ +VG +++      ++ WG L D  +++ +M +++   +V +  F +          W+  + V A+F   +GN ++FPA CAKL+G  N   NYG+LFT+  +S +I + ++   L+D+    I +  +  +G A S L A+ T+ F 
Sbjct:  447 VAGRRQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGESDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKG-LNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTL------SGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGA-LLTTVLKDA----IGWLGLFLLGAAFSTLGAVFTLLFE 678          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A0H3YF10 (Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=slc16a-10 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 1.689e-57
Identity = 140/422 (33.18%), Postives = 224/422 (53.08%), Query Frame = 1
Query:   88 SSKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQN--------LPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINS-FWIYFI--TATYSKYSRILGSISDHHIHLV---GPISSCLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNV--------IPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDS 1287
            +SK+     + G F+++++ G +         ++ YM+   +  R+V+     WIIG+ TFG G SMSLG  +E ++G S T++ GG+I SF   + YFT+  ++  V + YGLI GIG G+AYGV ++ P QWFP   GL+ GI+LSG     + FD + S  I   I N        +P+SF+ +G IY  IQ I + +IK  P  + E +  N               N+    +  ++ELKPHQLI  ++FWI+W+ + +NS F + FI     + KY      ISD  + +    G I S  G+I WG+L D   +K ++   T+  ++    F +         P+ + +F  + + V +  +FF  SGN S+FPA+CAK+FG+++F  N+G+L+T  + + VI   +V     D 
Sbjct:    7 NSKYACYVAVFGGFLVHISLGGIFTYGSMFPYILQYMNLNQTNVRVVHPTDVGWIIGMATFGRGASMSLGGFIEHRLGASFTIVTGGFIMSFGYILTYFTISLHIIPVAVSYGLIVGIGTGIAYGVAMTIPTQWFPKHPGLLSGIILSGFGIGSVGFDLIHSYFIDDDITNSTLVNPSRVPVSFIAMGCIYFMIQLIAAPLIK-RPETVEESVNQN---------------NLNIFGETTKIELKPHQLIFYVNFWIIWITYALNSAFSLLFILLQKMWGKYLE----ISDLRLLIATCTGGIFSIFGRIIWGYLTDRFGYKIVIWTSTLLFAIMFSTFYICSEVGKLSTPNGNNRFAMYLIWVII--MFFLISGNFSIFPAICAKVFGIQHFTGNFGVLYTGYSFTAVITPIIVLRVFADQ 406          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000010927.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002229.1:6659:13971:1 gene:ENSAMXG00000010636.2 transcript:ENSAMXT00000010927.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 1.703e-6
Identity = 80/364 (21.98%), Postives = 158/364 (43.41%), Query Frame = 1
Query:  142 TFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISG-SIQNLPISFVFLGTIYAGIQFIGSI---VIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILE---LDFWILWMIFFINSFWIYFITATYSKYSRIL---------GSISDHHIHLVG--PISSCLGKIFWGFLIDITSFKR--IMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAI-FFFNSGNSSVFPAM 1170
            T+GI+ +   F  D+   MS++   +  V+     WI+ +  F M  +  L   L ++ G    V+FGG + S  T    FT    ++ + I  GL+ G+G  L +   ++  +Q+F  RR LV  +  +G  F         S L +    +N     V +G + A +   G++   +I  P    PE+       G+   +++S    + S++  ++  LK   ++ +   LDF +L    FI  + ++ + AT   ++  L         G   +   +++    ++   G++  G++++    ++  I+LI T+  S+ + +F  +         W LA C  A  F F +  S+  P +
Sbjct:   40 TYGIIKIFGIFLQDL---MSHFEETNSRVS-----WIVSICVFVMTFTAPLSTVLSNRFGCRPVVMFGGLLISLGTISTAFT--HSINQMYITVGLVSGLGYCLTFLPTVTILSQYFNKRRSLVTSVASTGECFSLFALTPALSILKAHVGWRN---CLVVIGLMQASLIAFGALLRPIIIQPKLSSPEE----EKEGRSLPSKSSVDSGVQSIS-SSKTNLKEEPVVAQPKLLDFSVLRDCSFI-CYSLFGLFATLGFFAPQLYIIDLSVSCGLERNQATYMLSTMAVAEIFGRLSIGWILNRRPVRKIYILLICTMLLSLVLALFTAVSEF------WGLACCCAAFGFLFGTVGSTHIPML 378          
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Match: slc16a9a (monocarboxylate transporter 9-like [Source:NCBI gene;Acc:103027375])

HSP 1 Score: 49.6766 bits (117), Expect = 5.240e-6
Identity = 36/133 (27.07%), Postives = 62/133 (46.62%), Query Frame = 1
Query:  187 VIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLIS 585
            V+Y    ++ H    +G T W+  +++    I+  L        G     +F G + +    +  F     +S +I  YG++ G+G GL Y   L+   Q+F  RRGL  GIV +G +  G  +  +Q++LI 
Sbjct:   33 VLYPEWLNAFHE--GKGTTAWVGSLVSGVALIASPLCSACVDNFGARPVTIFSGVMVAGGLMLSAFAPN--VSFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSAGGFLYATVQNELIE 161          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069685.1 (SMESG000069685.1)

HSP 1 Score: 812.372 bits (2097), Expect = 0.000e+0
Identity = 422/425 (99.29%), Postives = 422/425 (99.29%), Query Frame = 1
Query:   76 MRNSSSKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGCALSLLA 1350
            MRNSSSKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMI FINSFWIYFITATYSKYSRILGSISDHHIHLVGPIS CLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSENFRIEFRNIIFIGCALSLL 
Sbjct:    1 MRNSSSKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMILFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISICLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSENFRIEFRNIIFIGCALSLLG 425          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069685.1 (SMESG000069685.1)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 394/397 (99.24%), Postives = 394/397 (99.24%), Query Frame = 1
Query:  160 MLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGCALSLLA 1350
            MLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMI FINSFWIYFITATYSKYSRILGSISDHHIHLVGPIS CLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSENFRIEFRNIIFIGCALSLL 
Sbjct:    1 MLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMILFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISICLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSENFRIEFRNIIFIGCALSLLG 397          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069668.1 (SMESG000069668.1)

HSP 1 Score: 321.627 bits (823), Expect = 4.800e-105
Identity = 197/443 (44.47%), Postives = 273/443 (61.63%), Query Frame = 1
Query:   91 SKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGS----IQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDL--ENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPIS---SCLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGCALSLLAALITIFFRGKSLII 1392
             K +   ++LGAF I LT G        Q  +V +M NYSS    V    ++WI GV+  GMG ++SLG  +E +IGP+ TVL GGW+ SF+ C+++ T+KSYLS+VII YGLIGG GMG+AYGV L TP ++FP  +GL+FGIV+SG +F  I FD +Q  +I       +  LP+SF+ LG IY+ IQ +GSI++K    D  E+   +N S        +  F K +  LN  N  EL+ H L+  LDFWILWMI F+NSF +  IT+ +++YS +L + +  ++ ++  I+   +C G+IFWGF ID  SFK +MLIIT+  S  IGI  VI  +   +H    AV    I FF SG  S+FP +C KLFGMK FV NYG+LFTS +    I S V+     +  +  + FRN++ IG  LS LAAL+T+ +RGKS I+
Sbjct:    4 EKNQNYLIVLGAFFIQLTLGGFYTSGNIQPIIVNFMQNYSSSQTSVTMENSVWIFGVLLLGMGAAISLGGFIEMQIGPTKTVLIGGWVMSFNICLMFVTMKSYLSIVIISYGLIGGFGMGVAYGVSLGTPLKYFPKCKGLIFGIVVSGISFSSIIFDAVQDSIIYKGKEIIMNRLPMSFLILGFIYSVIQLVGSILMKKRTKDKKEERSSQNYSPEASDGDQKLDFPK-LKILN--NPPELQTHHLLFVLDFWILWMIMFLNSFCVSLITSLFNRYSAVLVNETSFNLKVIVTIAKIFNCFGRIFWGFAIDKQSFKMLMLIITLTISFMIGILPVISTLKVSWHLPTFAVWFIVIHFFLSGTFSIFPIVCCKLFGMKYFVCNYGLLFTSCSVGGTIISLVIMLVFPEFSSTPLVFRNMVIIGVILSFLAALLTLLYRGKSAIV 443          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069681.1 (SMESG000069681.1)

HSP 1 Score: 319.316 bits (817), Expect = 3.659e-104
Identity = 179/444 (40.32%), Postives = 273/444 (61.49%), Query Frame = 1
Query:   91 SKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLI---SGSIQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILGSISDHHI----HLVGPISSCLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGC-ALSLLAALITIFFRGKSLIIEN 1398
             K+R   V+ G+++I L+ G +      Q ++V YM+NYS     VN G T+ IIG +TFG+G S+S+G   E KIGP  T+L G W+ S +  +++FT+KSYLSVV+I YG I G+G+G AYGV L  P +WFP  +GLV GIV+SG       F+ +Q   +   + +I +LP SF+ L  I+A +Q IGSI+++    D  E+   NS S    +  + +   ++  +     E++PHQ+ILE DFW+LW++FF+NSF +YFI+A+Y+ Y +    I +  I     ++  + +  G+IF+G+LID   FK +M IIT+  ++FIG    +  +   +  +   V +G IFFF  GN +VFPA+CA+LFG+KNFVF YG+L+TS + S ++ S +   FL D+ +   +   I+   C ++SL+AA  T FFRGKSL+I  
Sbjct:    6 EKYRCYIVLFGSYLIQLSLGSLFTFGHIQPEIVKYMNNYSFSGSSVNSGNTVSIIGALTFGVGASLSIGGYAEQKIGPGKTILIGAWLMSLNIGLMFFTLKSYLSVVVITYGFIAGLGLGFAYGVSLGRPIKWFPEHKGLVIGIVISGFGISSAIFNSVQDAFLDEKNTNINSLPKSFLILAGIFAVLQLIGSILVRQNSDDKLEETLINSVS----VRSSKYKPILFDYSSIGNNEIEPHQIILERDFWVLWIVFFLNSFMVYFISASYALYFKTQTQIKNEIILKIYFIITSLCNGAGRIFFGYLIDRKPFKIVMYIITLSCTLFIGTLP-LTSLKNTYFPYIYGVSIGVIFFFTGGNYTVFPAVCAQLFGLKNFVFKYGILYTSCSVSGIVVSALSASFLSDATSHSYDITFIV---CGSISLIAAGFTSFFRGKSLLIHR 441          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000069675.1 (SMESG000069675.1)

HSP 1 Score: 294.664 bits (753), Expect = 1.817e-94
Identity = 183/447 (40.94%), Postives = 261/447 (58.39%), Query Frame = 1
Query:   88 SSKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVI--YMSNYSSIHRLVNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCMLYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIVLSGCTFYGITFDRLQSKLISGS-----IQNLPISFVFLGTIYAGIQFIGSIVIKGPPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELDFWILWMIFFINSFWIYFITATYSKYSRILG----SISDH--HIHLVGPISSCLGKIFWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGAIFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPFLEDSXXXXXXXXXXXXXGCALSLLAALITIFFRGKSLI 1389
            S K R  FV+LGAF+I L+ G  S  S   +D +I  YM N+S     V   ++ WI  +M FGMG S SLG  +E+ IG S T L GGW+ SF+ C+++ T+++Y ++V + YGL+ G+G+G+AYGV L+ P ++FP  RGL+FGI +SG       FD +Q KL+        ++ LP SF+ LG IYA IQ IGS++I     D  E    NS S +  I     TK+         V+L+PH++ILELDFWILW++ FINSFWIY+ +  Y KY   L      +S++   I +V  + +  G+IFWG L D   FK+++LIIT+   +  G  ++          +     +  I   NSGNS  FP +CAKLFG+ NFV+NYGMLFTS ++S  I SG++  F+         F     +  A+S LAALIT+ +RG+SL+
Sbjct:   13 SYKNRRYFVLLGAFLIQLSLG--SFYSFVNIDELIVDYMQNHSYSGLKVTIYKSPWIYSIMVFGMGASFSLGGFIENLIGSSSTALIGGWLVSFNICLMFVTMRTYFAIVALSYGLMAGLGIGIAYGVSLAAPVKYFPKNRGLIFGITVSGFGISATIFDAIQDKLMRNVNNKKIMEKLPGSFLILGIIYAFIQAIGSLLINVENNDEVETKSGNSISAQSWIETNEQTKS---------VDLEPHKIILELDFWILWILMFINSFWIYYFSPMYKKYENHLSGTDLDLSEYLKRISIVSSVFNFAGRIFWGILTDKILFKKVILIITLSCCLLYGALSICLRFISSPMIYIYGTFLVLINLVNSGNSLFFPTVCAKLFGINNFVYNYGMLFTSFSTS-AIFSGLLSSFINPG---GQTFEISCSVASAVSFLAALITLAYRGRSLM 444          
The following BLAST results are available for this feature:
BLAST of MFS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y59A8B.217.142e-2123.40pep chromosome:WBcel235:V:17986260:17994546:1 gene... [more]
F10G7.55.373e-1823.53pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
F10G7.55.373e-1823.53pep chromosome:WBcel235:II:4693542:4696408:1 gene:... [more]
F10G7.55.497e-1823.59pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc16a9a2.125e-630.58solute carrier family 16 member 9a [Source:ZFIN;Ac... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q51330|OXLT_OXAFO2.942e-1222.26Oxalate:formate antiporter OS=Oxalobacter formigen... [more]
sp|P37662|YHJX_ECOLI5.472e-922.39Uncharacterized MFS-type transporter YhjX OS=Esche... [more]
sp|A0LNN5|SFMCT_SYNFM5.376e-722.05L-lactate transporter OS=Syntrophobacter fumaroxid... [more]
back to top
BLAST of MFS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HL502.418e-6029.16MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267H5U22.703e-6029.16MFS domain-containing protein (Fragment) OS=Macros... [more]
A0A1I8HYG06.283e-6029.16MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8H2059.511e-5829.00MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A0H3YF101.689e-5733.18Slc16a-10 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000010927.21.703e-621.98pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
slc16a9a5.240e-627.07monocarboxylate transporter 9-like [Source:NCBI ge... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069685.10.000e+099.29SMESG000069685.1[more]
SMESG000069685.10.000e+099.24SMESG000069685.1[more]
SMESG000069668.14.800e-10544.47SMESG000069668.1[more]
SMESG000069681.13.659e-10440.32SMESG000069681.1[more]
SMESG000069675.11.817e-9440.94SMESG000069675.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000319 ID=SMED30000319|Name=MFS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1531bp
TGAAGTTTTCTATTCATCAGTGATTGGTTATATATCTATAAATAATTTCT
TAAAATTAATTTCTGTTATTTATTTATGCGCAACTCCAGCAGTAAGTTTA
GAGGGTTATTTGTTATATTAGGAGCATTTGTTATTAACTTAACATTTGGC
ATAGTTTCCATGTTAAGCCGTTTTCAGTTGGATATGGTTATTTATATGAG
TAATTATTCCAGTATTCATCGGTTGGTAAATCAAGGCCAAACTATATGGA
TTATTGGAGTAATGACATTTGGCATGGGTATTTCCATGTCTTTGGGTCAA
TGTTTAGAGAGTAAAATTGGCCCATCGATGACAGTATTATTTGGAGGTTG
GATATTCAGTTTCAGTACATGCATGCTGTATTTCACAGTTAAATCTTATT
TGTCAGTTGTAATTATTTGTTATGGACTAATTGGAGGAATCGGGATGGGA
TTGGCTTACGGTGTGCTATTGAGCACGCCCGCTCAATGGTTTCCAAATAG
AAGAGGATTAGTATTTGGAATCGTTCTTTCTGGATGTACCTTTTATGGCA
TCACTTTTGACAGATTACAATCCAAATTAATTTCAGGAAGTATTCAAAAT
TTACCAATTTCATTTGTATTTTTGGGTACAATATATGCTGGAATTCAATT
CATCGGATCTATCGTCATTAAAGGGCCACCTCCTGATATACCTGAAGACT
TAGAGAATAATTCCTCTTCTGGGAAATGGGAAATAAATGAAACTTCTTTT
ACAAAGAATATTTATTCACTTAATGACGATAATGAAGTCGAACTGAAGCC
CCATCAACTCATTTTAGAACTAGATTTTTGGATTTTGTGGATGATTTTCT
TTATTAATTCATTCTGGATCTATTTCATTACCGCAACATACTCTAAATAT
TCCCGGATTCTTGGTTCAATCAGTGATCATCACATTCATTTAGTTGGTCC
GATTTCCAGTTGTTTGGGGAAAATATTCTGGGGCTTCTTGATTGACATAA
CTTCCTTTAAGAGAATTATGCTCATAATAACTATATGTTCGTCAGTGTTT
ATAGGGATCTTTAATGTTATCCCACATATTGATGAACAATTCCATGATTG
GTTTCTTGCAGTCTGTGTCGGAGCTATTTTCTTTTTCAATTCAGGCAACT
CTTCAGTGTTTCCGGCAATGTGTGCGAAACTATTCGGAATGAAGAACTTT
GTTTTTAATTATGGGATGCTTTTCACATCTGTGACTTCCTCCCATGTAAT
ATGCAGTGGGGTTGTAAAGCCATTTTTGGAAGATTCTGAAAATTTCCGAA
TAGAATTCAGAAATATTATTTTCATTGGATGCGCTCTTTCATTACTCGCT
GCTTTGATAACTATTTTCTTCAGAGGAAAATCTTTGATTATAGAGAATGT
TTGACATAATTTATTCCAGTGATTTTTGTATTTTTTGTATAAAATCTGAA
TTTTGATATTATATTTTTAATAATAATATCTTGTTATAATCCCATGAAGT
CTTGCATGTTCTAAATTTTGTGAGTCAAAAC
back to top

protein sequence of SMED30000319-orf-1

>SMED30000319-orf-1 ID=SMED30000319-orf-1|Name=SMED30000319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=443bp
MRNSSSKFRGLFVILGAFVINLTFGIVSMLSRFQLDMVIYMSNYSSIHRL
VNQGQTIWIIGVMTFGMGISMSLGQCLESKIGPSMTVLFGGWIFSFSTCM
LYFTVKSYLSVVIICYGLIGGIGMGLAYGVLLSTPAQWFPNRRGLVFGIV
LSGCTFYGITFDRLQSKLISGSIQNLPISFVFLGTIYAGIQFIGSIVIKG
PPPDIPEDLENNSSSGKWEINETSFTKNIYSLNDDNEVELKPHQLILELD
FWILWMIFFINSFWIYFITATYSKYSRILGSISDHHIHLVGPISSCLGKI
FWGFLIDITSFKRIMLIITICSSVFIGIFNVIPHIDEQFHDWFLAVCVGA
IFFFNSGNSSVFPAMCAKLFGMKNFVFNYGMLFTSVTSSHVICSGVVKPF
LEDSENFRIEFRNIIFIGCALSLLAALITIFFRGKSLIIENV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 13..378
e-value: 9.5E-15
score: 54.4
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 5..207
e-value: 4.6E-8
score: 34.6
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 248..436
e-value: 2.5E-11
score: 45.3
NoneNo IPR availablePANTHERPTHR11360:SF3OXALATE/FORMATE ANTIPORTERcoord: 7..432
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 7..432
NoneNo IPR availableCDDcd17353MFS_OFA_likecoord: 9..432
e-value: 1.41282E-36
score: 136.201
NoneNo IPR availableTMHMMTMhelixcoord: 375..397
NoneNo IPR availableTMHMMTMhelixcoord: 110..132
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 54..73
NoneNo IPR availableTMHMMTMhelixcoord: 86..105
NoneNo IPR availableTMHMMTMhelixcoord: 176..198
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 412..434
NoneNo IPR availableTMHMMTMhelixcoord: 144..161
NoneNo IPR availableTMHMMTMhelixcoord: 251..272
NoneNo IPR availableTMHMMTMhelixcoord: 340..362
NoneNo IPR availableTMHMMTMhelixcoord: 287..306
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 10..433