Interferon-induced GTP-binding protein Mx1

Overview
NameInterferon-induced GTP-binding protein Mx1
Smed IDSMED30000316
Length (bp)3430
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Interferon-induced GTP-binding protein Mx1 (SMED30000316) t-SNE clustered cells

Violin plots show distribution of expression levels for Interferon-induced GTP-binding protein Mx1 (SMED30000316) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Interferon-induced GTP-binding protein Mx1 (SMED30000316) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Interferon-induced GTP-binding protein Mx1 (SMED30000316) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000316

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
secretory systemSMED30000316SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000316SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30000316SMESG000002219.1 SMESG000002217.1 SMESG000002216.1 SMESG000002004.1 Contig6798newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000316SMESG000002219.1 SMESG000002217.1 SMESG000002216.1 SMESG000002004.1 Contig6798uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30000316SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig32248uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000316SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig32248newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000316SMESG000002217.1 SMESG000002216.1 SMESG000002032.1 SMESG000002023.1 SMESG000002004.1 Contig9176uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000316SMESG000002217.1 SMESG000002216.1 SMESG000002032.1 SMESG000002023.1 SMESG000002004.1 Contig9176newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000316SMESG000068632.1 SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig47704uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000316SMESG000068632.1 SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig47704newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000316SMESG000077847.1 SMESG000057533.1 SMESG000027782.1 SMESG000026563.1 SMESG000004883.1 SMESG000002217.1 SMESG000002216.1 SMESG000002023.1 SMESG000002004.1 Contig18771uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000316SMESG000077847.1 SMESG000057533.1 SMESG000027782.1 SMESG000026563.1 SMESG000004883.1 SMESG000002217.1 SMESG000002216.1 SMESG000002023.1 SMESG000002004.1 Contig18771newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30000316SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000316SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000316SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000316SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000316SMESG000002217.1 SMESG000002216.1 SMESG000002032.1 SMESG000002023.1 SMESG000002004.1 Contig10607uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000316SMESG000002217.1 SMESG000002216.1 SMESG000002032.1 SMESG000002023.1 SMESG000002004.1 Contig10607newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30000316SMESG000002219.1 SMESG000002216.1 SMESG000002004.1 dd_Smed_v4_3169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000316SMESG000002219.1 SMESG000002216.1 SMESG000002004.1 dd_Smed_v4_3169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000316SMESG000002219.1 SMESG000002216.1 SMESG000002004.1 dd_Smed_v4_3169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30000316SMESG000002219.1 SMESG000002216.1 SMESG000002004.1 dd_Smed_v4_3169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000316SMESG000002219.1 SMESG000002216.1 SMESG000002004.1 dd_Smed_v4_3169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30000316SMESG000002219.1 SMESG000002216.1 SMESG000002004.1 dd_Smed_v4_3169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30000316SMESG000002219.1 SMESG000002216.1 SMESG000002004.1 dd_Smed_v4_3169_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30000316SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30000316SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30000316SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000316SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: MX2 (MX dynamin like GTPase 2 [Source:HGNC Symbol;Acc:HGNC:7533])

HSP 1 Score: 149.828 bits (377), Expect = 1.757e-36
Identity = 83/225 (36.89%), Postives = 129/225 (57.33%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKST----ETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K        RI  +      +D    E EI + Q     N   I+ + I++ I SPE   LTIIDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P N DI TT  +  A E +P+  R IG+LTK D +D      +  ++RN   P++KGY
Sbjct:  101 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGY 322          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: DNM1 (dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972])

HSP 1 Score: 142.124 bits (357), Expect = 2.261e-36
Identity = 84/228 (36.84%), Postives = 130/228 (57.02%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTETRIQIKY-RSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            I  ++ ++  FSA   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+  +T    +  + + + F D  +   EI+    + T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++
Sbjct:   10 IPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVV 235          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: MX1 (MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:HGNC:7532])

HSP 1 Score: 141.354 bits (355), Expect = 1.531e-34
Identity = 85/234 (36.32%), Postives = 139/234 (59.40%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQTTAFNNE---ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K     + R ++ Y+    +  D S+ E EI + Q  A   E   I+ + IT+ I S +   LT+IDLPG+ +  V  Q  D+  K   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D+     + +++RN    ++KGY
Sbjct:   46 EEKVRPCIDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQN-AIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGY 275          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: MX1 (MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:HGNC:7532])

HSP 1 Score: 142.895 bits (359), Expect = 1.982e-34
Identity = 83/227 (36.56%), Postives = 136/227 (59.91%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQTTAFNNE---ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K     + R ++ Y+    +  D S+ E EI + Q  A   E   I+ + IT+ I S +   LT+IDLPG+ +  V  Q  D+  K   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D+     + +++RN    ++KGY
Sbjct:   53 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQN-AIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGY 275          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Match: MX1 (MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:HGNC:7532])

HSP 1 Score: 142.895 bits (359), Expect = 1.982e-34
Identity = 83/227 (36.56%), Postives = 136/227 (59.91%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQTTAFNNE---ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K     + R ++ Y+    +  D S+ E EI + Q  A   E   I+ + IT+ I S +   LT+IDLPG+ +  V  Q  D+  K   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D+     + +++RN    ++KGY
Sbjct:   53 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQN-AIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGY 275          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 136.732 bits (343), Expect = 2.004e-32
Identity = 103/318 (32.39%), Postives = 158/318 (49.69%), Query Frame = 2
Query: 1292 EKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYH 2224
            +  I  IN + +  S+    V  + +LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+ +   E    +  +   F D      EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  V  Q  D+ ++  ++   F+ +E  LI+ V PAN D+ T+  +K A E +P   R IGVLTKLD +DE   T   EI+ N+   + +GY G++     DI+   +       E+K       +  + D  R G S     L  +L   I  TLP LR+++ K +      +  +  Y 
Sbjct:    9 QALIPVINRVQDAFSQLGTSV--SFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG--TDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMAD--RLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQ 320          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 136.732 bits (343), Expect = 2.052e-32
Identity = 104/325 (32.00%), Postives = 162/325 (49.85%), Query Frame = 2
Query: 1292 EKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQK 2245
            +  I  IN + +  S+    V  + +LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+ +   E    +  +   F D      EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  V  Q  D+ ++  ++   F+ +E  LI+ V PAN D+ T+  +K A E +P   R IGVLTKLD +DE   T   EI+ N+   + +GY G++     DI+   +       E+K       +  + D  R G S     L  +L   I  TLP LR+++ K +      +  +  Y  ++  +K
Sbjct:    9 QALIPVINRVQDAFSQLGTSV--SFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG--TDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMAD--RLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRK 327          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 115.546 bits (288), Expect = 5.882e-26
Identity = 74/227 (32.60%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 1358 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------RKSTETRIQIKYR------SEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + ++LPQI+VVG QS+GKSS+L+ + G   LPRG   VTR P+++Q+           R+S  T +   +       S+ F D      EI++   + T  N  I+  PI++ I S   V+L+++DLPG+ K  V  Q  ++ E+  E+   ++   +S+I+ V PANQD  T+  IK A E +    R + VLTKLD +D+    +  +++  + +P++ G  G++
Sbjct:   23 DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAM--DVLMGKVIPVKLGIIGVV 247          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 115.546 bits (288), Expect = 5.882e-26
Identity = 74/227 (32.60%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 1358 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------RKSTETRIQIKYR------SEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + ++LPQI+VVG QS+GKSS+L+ + G   LPRG   VTR P+++Q+           R+S  T +   +       S+ F D      EI++   + T  N  I+  PI++ I S   V+L+++DLPG+ K  V  Q  ++ E+  E+   ++   +S+I+ V PANQD  T+  IK A E +    R + VLTKLD +D+    +  +++  + +P++ G  G++
Sbjct:   23 DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAM--DVLMGKVIPVKLGIIGVV 247          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 115.546 bits (288), Expect = 5.882e-26
Identity = 74/227 (32.60%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 1358 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------RKSTETRIQIKYR------SEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + ++LPQI+VVG QS+GKSS+L+ + G   LPRG   VTR P+++Q+           R+S  T +   +       S+ F D      EI++   + T  N  I+  PI++ I S   V+L+++DLPG+ K  V  Q  ++ E+  E+   ++   +S+I+ V PANQD  T+  IK A E +    R + VLTKLD +D+    +  +++  + +P++ G  G++
Sbjct:   23 DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAM--DVLMGKVIPVKLGIIGVV 247          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074122)

HSP 1 Score: 142.51 bits (358), Expect = 3.205e-34
Identity = 112/371 (30.19%), Postives = 184/371 (49.60%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYH-GSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETF 2395
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR+ + K +     ++E F  +  G   I+ K M + I+++++  +  +      + N  ++    +  RI    HE   F
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIF---HERLRF 368          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074121)

HSP 1 Score: 142.51 bits (358), Expect = 3.205e-34
Identity = 112/371 (30.19%), Postives = 184/371 (49.60%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYH-GSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETF 2395
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR+ + K +     ++E F  +  G   I+ K M + I+++++  +  +      + N  ++    +  RI    HE   F
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIF---HERLRF 368          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074119)

HSP 1 Score: 142.51 bits (358), Expect = 3.205e-34
Identity = 112/371 (30.19%), Postives = 184/371 (49.60%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYH-GSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETF 2395
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR+ + K +     ++E F  +  G   I+ K M + I+++++  +  +      + N  ++    +  RI    HE   F
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIF---HERLRF 368          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0111037)

HSP 1 Score: 142.51 bits (358), Expect = 3.205e-34
Identity = 112/371 (30.19%), Postives = 184/371 (49.60%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYH-GSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETF 2395
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR+ + K +     ++E F  +  G   I+ K M + I+++++  +  +      + N  ++    +  RI    HE   F
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIF---HERLRF 368          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074118)

HSP 1 Score: 142.51 bits (358), Expect = 3.205e-34
Identity = 112/371 (30.19%), Postives = 184/371 (49.60%), Query Frame = 2
Query: 1310 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYH-GSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETF 2395
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    +  +    E+K       +  + D  R G       L  +L   I  TLP LR+ + K +     ++E F  +  G   I+ K M + I+++++  +  +      + N  ++    +  RI    HE   F
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQSDFERTIEGSGSALVNTNELSGGAKINRIF---HERLRF 368          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: mxa (myxovirus (influenza) resistance A [Source:NCBI gene;Acc:360142])

HSP 1 Score: 148.673 bits (374), Expect = 1.425e-36
Identity = 113/343 (32.94%), Postives = 183/343 (53.35%), Query Frame = 2
Query: 1241 KFSSTLSQSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFG-LSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSE 2233
            K S T SQ        +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M ++ +      RI  K   E F D ++ E +I++ Q         I+++ I++ I S     LT+IDLPG+ +  V+GQ  ++ ++   + R F+ ++ ++ + V+P N DI TT  ++ A   +PD  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I+     +E  +TE    K+   +S    + F  +    + L  EL   I K+LP L E ++  LA+T  +LE +     SE
Sbjct:    3 KLSYTFSQQ------YEEKIRPCIDTIDNLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVPLPRGSGIVTRCPLELKMIRTKDQDKWHGRISYKTYEEDFDDPAEVEKKIRQAQDEMAGAGVGISEELISLQITSANVPDLTLIDLPGIARVAVKGQPENIGDQIKRLIRKFVTRQETINLVVVPCNVDIATTEALQMAQAEDPDGERTLGILTKPDLVDKGTEGTVVDIVHNEVIHLTKGY--MIVRCRGQKEIMDQVTLNEATETESAFFKDHPHFSKLYEEGFATIPKLAEKLTIELVHHIQKSLPRLEEQIETKLAETQKELEAYGNGPPSE 334          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: si:dkeyp-110c12.3 (si:dkeyp-110c12.3 [Source:ZFIN;Acc:ZDB-GENE-131126-68])

HSP 1 Score: 148.673 bits (374), Expect = 1.763e-36
Identity = 116/378 (30.69%), Postives = 193/378 (51.06%), Query Frame = 2
Query: 1238 LKFSSTLSQSKKRMTVAKEKWIKK----INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETR---IQIKYRS--EPFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV--NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSE-EIQKKYMSEKIKEIENKTKYLLVNGKHEIQN 2326
            L F S+     +   +  ++W  +    I  ID MR      +   L LP I VVGDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK +        I Y    E F + +  ES +++ Q     +   I  D I++ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   +   F+ ++ ++ + V+P N DI TT  ++ A   +PD SR + +LTK D +D+     I ++++ + +P++KGY  +      DI +  +  E  + EK+       +S L + +R   S  +  L  EL   I  +LP LR+ +   L+    +L +++     E E    Y+S+KI E  ++   L   G+ E  N
Sbjct:    8 LDFDSSDENGHENSGIFLQQWDAQVRPYIEMIDFMRR---IGIERELALPAIAVVGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKMSSGSGWTAVISYNDVRETFHEPAQVESFVRKAQNMLAGDGVGICDDLISLEITSPDVCDLTLIDLPGITRVPVKGQPEDIGDQIRRLILKFIAKKETINLVVVPCNVDIATTEALRMAQGVDPDGSRTLAILTKPDLVDKGAEADILQVLQGKVVPLKKGYTIVRCRGQSDINENVSLSEATRQEKEFFSNHPHFSYLLEEQRATTSCLSTRLTKELVEHIKASLPSLRDQIHINLSAVRIELRSYADGPPLETERMGPYLSKKILEFSDQISELCRTGESETGN 382          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: si:dkeyp-110c12.3 (si:dkeyp-110c12.3 [Source:ZFIN;Acc:ZDB-GENE-131126-68])

HSP 1 Score: 147.902 bits (372), Expect = 2.268e-36
Identity = 114/352 (32.39%), Postives = 184/352 (52.27%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETR---IQIKYRS--EPFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSE-EIQKKYMSEKIKEIENKTKYLLVNGKHEIQN 2326
            I  ID MR      +   L LP I VVGDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK +        I Y    E F + +  ES +++ Q     +   I  D I++ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   +   F+ ++ ++ + V+P N DI TT  ++ A   +PD SR + +LTK D +D+     I ++++ + +P++KGY   IV      DI +  +  E  + EK+       +S L + +R   S  +  L  EL   I  +LP LR+ +   L+    +L +++     E E    Y+S+KI E  ++   L   G+ E  N
Sbjct:   20 IEMIDFMRR---IGIERELALPAIAVVGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKMSSGSGWTAVISYNDVRETFHEPAQVESFVRKAQNMLAGDGVGICDDLISLEITSPDVCDLTLIDLPGITRVPVKGQPEDIGDQIRRLILKFIAKKETINLVVVPCNVDIATTEALRMAQGVDPDGSRTLAILTKPDLVDKGAEADILQVLQGKVVPLKKGY--TIVRCRGQSDINENVSLSEATRQEKEFFSNHPHFSYLLEEQRATTSCLSTRLTKELVEHIKASLPSLRDQIHINLSAVRIELRSYADGPPLETERMGPYLSKKILEFSDQISELCRTGESETGN 366          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: mxg (myxovirus (influenza virus) resistance G [Source:ZFIN;Acc:ZDB-GENE-030721-10])

HSP 1 Score: 146.747 bits (369), Expect = 6.194e-36
Identity = 86/226 (38.05%), Postives = 132/226 (58.41%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET---RIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +RS     +++ L LP I+V+GDQSSGKSS+L+ +SG+ LPRG   VTRCP+ ++++K T     +  I YR +   F D S  E  +K  Q     N   I  + IT+ + SP+   LT+IDLPG+ +  V GQ  D+  +  ++   F+  + ++ + V+P N DI TT  +K A E +P+  R I VLTK D +D+     I  I++N+ +P+ KGY
Sbjct:   53 IDLIDTLRS---VGIHKDLALPTIVVIGDQSSGKSSVLETLSGVALPRGNGIVTRCPLELRLKKVTGGVSWKAVISYREKRTEFADPSMVERHVKTAQDELAGNGVGICDELITLEVMSPDVCNLTLIDLPGIARVPVAGQPDDIANQIKKLIIKFIVMQETINLVVVPCNIDIATTEALKLAQEVDPEGKRTIAVLTKPDIIDKGTEKNILAIVQNKVIPLRKGY 275          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 146.362 bits (368), Expect = 9.026e-36
Identity = 107/337 (31.75%), Postives = 176/337 (52.23%), Query Frame = 2
Query: 1241 KFSSTLSQSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDIL-KLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFS 2215
            K S T SQ        +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M +S E      RI  +   E F D ++ E +I+E Q         I+++ I++ I S     LT+IDLPG+ +  V+GQ  ++ ++   + R F+ ++ ++ + V+P N DI TT  ++ A   +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I+ ++T  +  +              L +     +    + L  EL   I ++LP L E +   LA+T  +LE + 
Sbjct:    3 KMSYTFSQQ------YEEKIRPCIDTIDNLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVPLPRGSGIVTRCPLELKMIRSKEDEKWHGRISYQNHEEDFDDPAEVEKKIREAQDEMAGAGVGISEELISLQITSANVPDLTLIDLPGIARVAVKGQPENIGDQIKRLIRMFITKQETINLVVVPCNVDIATTEALQMAQAEDPEGERTLGILTKPDLVDKGTEGTVVDIVHNEVIHLTKGY--MIVRCRGQKEIMDQVTLNEATETESAFFKDHPHFRKLYEEGFATIPKLAEKLTIELVHHIQRSLPRLEEQIQTKLAETQKELEAYG 328          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: rnpepl1 (arginyl aminopeptidase (aminopeptidase B)-like 1 [Source:Xenbase;Acc:XB-GENE-986293])

HSP 1 Score: 150.599 bits (379), Expect = 1.437e-38
Identity = 107/301 (35.55%), Postives = 164/301 (54.49%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEI--QTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENV-DKLLA 2185
            I  ++ ++  FSA   N  + LPQI VVG QS+GKSS+L+ + G   LPRG   +TR P+V+Q+  S TE    +  +   + D S+   EI+E   + T  N  I+  PI++ I SP  + L++IDLPG+ K  V  Q  D+  +  ++  +F+ +EN LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   EI+ N+ LP+ +GY G++     DI    N +   + E+        +  + D  R G S+    L  +L   I +TLP LR  + D+LL+
Sbjct:   12 IPLVNRLQDAFSAIGQNYQVDLPQIAVVGGQSAGKSSVLENLVGRDFLPRGAGIITRRPLVLQLITSNTEYAEFLHCKGTKYTDFSEVRQEIEEETERATGLNKGISAIPISLRIYSPHVLNLSLIDLPGVTKVPVGDQPADIETQIRDMIMNFISRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TNAQEILENKLLPLRRGYVGVVNRSQKDIDGKKNINAALQAEQMFFLTHPAYRHMAD--RMGTSHLQKMLNQQLTNHIRETLPDLRSKLQDQLLS 308          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: krt17 (keratin 17 [Source:Xenbase;Acc:XB-GENE-490369])

HSP 1 Score: 143.665 bits (361), Expect = 3.730e-37
Identity = 81/233 (34.76%), Postives = 137/233 (58.80%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYRSEPFK--DISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++++K+ +      +I YR    K    +D E E+K  Q         I+ + I++ + SP+   LT+IDLPG+ +  +  Q  D+ ++  ++ R +++++ ++ + V+P+N DI TT  ++ A E +P+  R +G+LTK D +D    T +  ++RN    + KGY
Sbjct:   10 EEKIRPCIDLIDSLRA---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVTLPRGSGIVTRCPLELKLKKAMKKTTWSGKISYRDHEIKIASAADVEEEVKRAQNLMAGSGKGISDELISLEVISPDVPDLTLIDLPGITRVALPDQPKDIEQQIKKMIRKYIQKQETINLVVVPSNVDIATTEALEMAREVDPNGERTLGILTKPDLVDRGAETDVISVVRNLVYSLNKGY 239          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: krt17 (keratin 17 [Source:Xenbase;Acc:XB-GENE-490369])

HSP 1 Score: 142.51 bits (358), Expect = 7.260e-37
Identity = 81/233 (34.76%), Postives = 137/233 (58.80%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYRSEPFK--DISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++++K+ +      +I YR    K    +D E E+K  Q         I+ + I++ + SP+   LT+IDLPG+ +  +  Q  D+ ++  ++ R +++++ ++ + V+P+N DI TT  ++ A E +P+  R +G+LTK D +D    T +  ++RN    + KGY
Sbjct:   10 EEKIRPCIDLIDSLRA---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVTLPRGSGIVTRCPLELKLKKAMKKTTWSGKISYRDHEIKIASAADVEEEVKRAQNLMAGSGKGISDELISLEVISPDVPDLTLIDLPGITRVALPDQPKDIEQQIKKMIRKYIQKQETINLVVVPSNVDIATTEALEMAREVDPNGERTLGILTKPDLVDRGAETDVISVVRNLVYSLNKGY 239          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 139.428 bits (350), Expect = 5.917e-33
Identity = 104/320 (32.50%), Postives = 161/320 (50.31%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQK 2245
            I  ++ ++  FS+   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+   STE    +  + + F D  +   EI+    + T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    +       E+K       +  L D  R G      AL  +L   I  TLP LR  +   L     ++E +  +   +  +K
Sbjct:   10 IPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLAD--RMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARK 325          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Match: ei24 (etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-990260])

HSP 1 Score: 139.043 bits (349), Expect = 7.328e-33
Identity = 104/320 (32.50%), Postives = 161/320 (50.31%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQK 2245
            I  ++ ++  FS+   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+   STE    +  + + F D  +   EI+    + T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    +       E+K       +  L D  R G      AL  +L   I  TLP LR  +   L     ++E +  +   +  +K
Sbjct:   10 IPLVNRLQDAFSSIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLVNSSTEYGEFLHCKGKKFTDFDEIRLEIEAETDRATGTNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPVDIEFQIRDMLMQFVTKENCLVLAVSPANSDLANSDALKIAKEVDPKGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDIQAALAAERKFFLSHPSYRHLAD--RMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKNFRPDDPARK 325          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Mx1 (MX dynamin-like GTPase 1 [Source:MGI Symbol;Acc:MGI:97243])

HSP 1 Score: 143.665 bits (361), Expect = 2.209e-37
Identity = 84/233 (36.05%), Postives = 133/233 (57.08%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRS--EPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IGVLTK D +D      + +++RN   P++KGY
Sbjct:   11 EEKVRPCIDLIDTLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLKEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGVLTKPDLVDRGAEGKVLDVMRNLVYPLKKGY 240          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Mx1 (MX dynamin-like GTPase 1 [Source:MGI Symbol;Acc:MGI:97243])

HSP 1 Score: 142.895 bits (359), Expect = 1.022e-34
Identity = 84/233 (36.05%), Postives = 133/233 (57.08%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRS--EPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IGVLTK D +D      + +++RN   P++KGY
Sbjct:   12 EEKVRPCIDLIDTLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLKEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGVLTKPDLVDRGAEGKVLDVMRNLVYPLKKGY 241          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Mx2 (MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MGI:97244])

HSP 1 Score: 140.969 bits (354), Expect = 3.320e-34
Identity = 123/410 (30.00%), Postives = 202/410 (49.27%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRS--EPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDI---LKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYS 2476
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D      + +++RN    ++KGY  +IV      DI   L LT   + ++   K     ++  LED K   +    + L  EL   I K+LP+L   + +            S    SEE+QK  M   I E +++  + L+          KI  +   + I + +   E        +F+ L KEF S  +E+  +++
Sbjct:   39 EEKVRPCIDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLNEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDRGTEDKVVDVVRNLVYHLKKGY--MIVKCRGQQDIQEQLSLTEALQNEQIFFKEHPHFRVL-LEDGKAT-VPCLAERLTAELISHICKSLPLLENQIKE------------SHQSASEELQKYGMD--IPEDDSEKTFFLIE---------KINAF--NQDITALVQGEENVAEGECRLFTRLRKEFLSWSKEIEKNFA 416          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Mx2 (MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MGI:97244])

HSP 1 Score: 141.739 bits (356), Expect = 3.829e-34
Identity = 123/410 (30.00%), Postives = 202/410 (49.27%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYR--SEPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDI---LKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYS 2476
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D      + +++RN    ++KGY  +IV      DI   L LT   + ++   K     ++  LED K   +    + L  EL   I K+LP+L   + +            S    SEE+QK  M   I E +++  + L+          KI  +   + I + +   E        +F+ L KEF S  +E+  +++
Sbjct:   39 EEKVRPCIDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLNEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDRGTEDKVVDVVRNLVYHLKKGY--MIVKCRGQQDIQEQLSLTEALQNEQIFFKEHPHFRVL-LEDGKAT-VPCLAERLTAELISHICKSLPLLENQIKE------------SHQSASEELQKYGMD--IPEDDSEKTFFLIE---------KINAF--NQDITALVQGEENVAEGECRLFTRLRKEFLSWSKEIEKNFA 416          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Match: Mx2 (MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MGI:97244])

HSP 1 Score: 140.969 bits (354), Expect = 5.287e-34
Identity = 129/435 (29.66%), Postives = 212/435 (48.74%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYR--SEPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDI---LKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLE--DINKKNRTENIPVFISSTLF 2566
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D      + +++RN    ++KGY  +IV      DI   L LT   + ++   K     ++  LED K   +    + L  EL   I K+LP+L   + +            S    SEE+QK  M   I E +++  + L+          KI  +   + I + +   E        +F+ L KEF S  +E+  +++  Y +  Y E     K+ R   +P F++   F
Sbjct:   46 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLNEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDRGTEDKVVDVVRNLVYHLKKGY--MIVKCRGQQDIQEQLSLTEALQNEQIFFKEHPHFRVL-LEDGK-ATVPCLAERLTAELISHICKSLPLLENQIKE------------SHQSASEELQKYGMD--IPEDDSEKTFFLIE---------KINAF--NQDITALVQGEENVAEGECRLFTRLRKEFLSWSKEIEKNFAKGY-AVLYNEVWAFEKQYRGRELPGFVNYKTF 447          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|Q91192|MX1_ONCMY (Interferon-induced GTP-binding protein Mx1 OS=Oncorhynchus mykiss OX=8022 GN=mx1 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 5.153e-42
Identity = 136/434 (31.34%), Postives = 223/434 (51.38%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQY---LEDINKKNRTENIPVFISSTLF 2566
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   E  +D SD E +I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I++  +  E  + EK   KE    S L D     +    + L  EL   I+K+LP L E ++  L++T+ +LE +    G  E   + +            Y L++         K+  + +    LS+  E ++ + L   VFS L KEF     +L  + SG+  + +    ++D  K  R   +P FI+   F
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKISYQDHEEEIEDPSDVEKKIREAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFIMKQETISLVVVPCNVDIATTEALKMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIVHNEVIHLTKGY--MIVKCRGQKEIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKLSETHAELERYGT--GPPEDSAERL------------YFLID---------KVTAFTQDAINLSTGEEMKSGVRL--NVFSTLRKEFGK--WKLHLERSGEIFNQRIEGEVDDYEKTYRGRELPGFINYKTF 418          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|Q91196|MX2_ONCMY (Interferon-induced GTP-binding protein Mx2 OS=Oncorhynchus mykiss OX=8022 GN=mx2 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.423e-41
Identity = 112/318 (35.22%), Postives = 180/318 (56.60%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLE 2206
            +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  + R E  +D SD E++I++ Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I++  +  E  + EK   KE    S L D     +    + L  EL   I+K++P L+E +++ L +T   LE
Sbjct:   10 EEKVRPSIDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKISYQDREEEIEDPSDVENKIRKAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVDIVHNEVIQLTKGY--MIVKCRGQKEIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVQHIEKSMPRLKEQIEEKLEETRTALE 322          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|Q91197|MX3_ONCMY (Interferon-induced GTP-binding protein Mx3 OS=Oncorhynchus mykiss OX=8022 GN=mx3 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 4.213e-41
Identity = 109/314 (34.71%), Postives = 177/314 (56.37%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFS 2215
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   E  +D SD E +I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  ++ A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I++  +  E  + EK   KE    S L D     +    + L  EL   I+K+LP L E ++  L++T+ +LE + 
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKREGEEWHGKISYQDHEEEIEDPSDVEKKIREAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFIMKQETINLVVVPCNVDIATTEALQMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIVHNEVIHLTKGY--MIVKCRGQKEIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKLSETHAELERYG 325          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|P20593|MX_PERFL (Interferon-induced GTP-binding protein Mx (Fragment) OS=Perca fluviatilis OX=8168 GN=mx PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.196e-40
Identity = 85/233 (36.48%), Postives = 142/233 (60.94%), Query Frame = 2
Query: 1289 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   +  +D +D E +I++ Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ ++   + + F++++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + +I+ N+ +P++KGY
Sbjct:   11 EEKVRPCIDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRRQEGEEWYGKISYQDCEKEIEDPADVEKKIRDAQDEMAGVGVGISDDLISLEIASPDVPDLTLIDLPGIARVAVKGQPENIGDQIKRLIQKFIKRQETISLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVDIVHNEVIPLKKGY 240          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Match: sp|Q6PW23|MX_EPICO (Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides OX=94232 GN=mx PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 2.260e-40
Identity = 106/326 (32.52%), Postives = 181/326 (55.52%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETR---IQIKYRS--EPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVN-----DDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKY 2251
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I YR   +  +D SD E++I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + + F+ ++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + EI+ N+ + ++KGY  +IV      +   K++  + ++  +          +L +  +  +    + L  EL   I+++LP L E ++  L +T  +LE +     S+  +K +
Sbjct:   16 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWYGKISYRGCEKELEDPSDVENKIREAQDEMAGVGVGISDDLISLEIASPDVPDLTLIDLPGIARVAVKGQPEDIGKQIKGLIQRFITRQETISLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVEIVHNEVIHLKKGY--MIVRCRGQKEITEKVSLTEALESEKAFFRDHVHFHTLYNEGQATVPKLAEKLTLELVHHIERSLPRLEEQIEDKLEQTQAELERYGSGPPSDATEKLF 336          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: A0A060YH96 (Dynamin-type G domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00005088001 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.088e-41
Identity = 137/438 (31.28%), Postives = 230/438 (52.51%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDIN---KKNRTENIPVFISSTLFKKIVNEAL 2590
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   E  +D SD E +I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  ++ A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +I  + I++  +  E  + EK   KE    S L D     +    + L  EL   I+K+LP L E ++  L++T+ +LE +    G  E      +E+I        Y L++         K+  + +    LS+  E ++ + L   VFS L +EF     +L  D SG+  + +  E+++   K  R   +P FI+   F+ +V + +
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKREGEEWHGKISYQDHEEEIEDPSDVEKKIREAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFIMKQETINLVVVPCNVDIATTEALQMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIVHNEVIHLTKGY--MIGPEGIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKLSETHAELERYGT--GPPEDS----AERI--------YFLID---------KVTAFTQDAINLSTGEELKSGVRL--NVFSTLRQEFGK--WKLHLDRSGENFNQRIEEEVSNYEKTYRGRELPGFINYKTFEVMVKDQI 422          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: Q98991 (Mx2 protein OS=Salmo salar OX=8030 GN=mx2 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 4.276e-41
Identity = 141/435 (32.41%), Postives = 225/435 (51.72%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLE----DINKKNRTENIPVFISSTLF 2566
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   E  +D SD E +I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I++  +  E  + EK   KE    S L D     +    + L  EL   I+K+LP L E ++  LA+T+ +LE +    G  E   + M            Y L++         K+  +      LS+  E ++ + L   VFS L KEF     +L  D+SG+ + +Q +E    D  K +R   +P FI+   F
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKISYQDHEEEIEDPSDVEKKIREAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIVHNEVIHLTKGY--MIVKCRGQKEIMERVSLSEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKLAETHAELERYGT--GPPEDSAERM------------YFLID---------KVTAFTHDAINLSTGEELKSGVRL--NVFSTLRKEFGK--WKLHLDHSGE-NFNQRIEGEVADYEKTSRGRELPGFINYKTF 418          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: Q98990 (Mx1 protein OS=Salmo salar OX=8030 GN=mx1 PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 8.277e-41
Identity = 141/435 (32.41%), Postives = 224/435 (51.49%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLE----DINKKNRTENIPVFISSTLF 2566
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   E  +D SD E +I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I++  +  E  + EK   KE    S L D     +    + L  EL   I+K+LP L E ++  LA+T+ +LE +    G  E   + M            Y L++         K+  +      LS+  E ++ + L   VFS L KEF     +L  D+SG+ + +Q +E    D  K  R   +P FI+   F
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKISYQDHEEEIEDPSDVEKKIREAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIVHNEVIHLTKGY--MIVKCRGQKEIMERVSLSEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKLAETHAELERYGT--GPPEDSAERM------------YFLID---------KVTAFTHDAINLSTGEELKSGVRL--NVFSTLRKEFGK--WKLHLDHSGE-NFNQRIEGEVADYEKTYRGRELPGFINYKTF 418          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: A0A556TK77 (Interferon-induced GTP-binding protein Mx1 OS=Bagarius yarrelli OX=175774 GN=Baya_1118 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 3.411e-40
Identity = 137/433 (31.64%), Postives = 227/433 (52.42%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYRS--EPFKDISDTESEIKEIQTTAFNNE-ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQ-KKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSD--QYLEDINKKNRTENIPVFISSTLF 2566
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M KS    +   +I+Y+S  +  K+  D +  I E Q      + I+ + I++ + S +   LT+IDLPG+V+  V+GQ  D+ E++ ++++ F+E++ ++I+ V+P N DI TT  +K A E +P   R +G+LTK D +D+    ++  II N+ + + KGY  +IV      DI       E    E+   K    +S L +  +  +SN    L  EL   I  +LP + E + K LA+   +L+ +     +E  Q  ++++EKI E+  K    L  G+ E++N T +        I SS+ EH                  F+ ++++  D +GK+     + LE+  KK R   +P F+    F
Sbjct:   17 IDLIDSLRA---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGNGMVTRCPLELKMVKSKNKDMWHGKIRYKSHEQNIKNPKDVDKFIIEAQENIVGAKGISDELISLEVTSADVPDLTLIDLPGIVRVSVKGQPEDIGEQSKKLSQRFIEKQGTIILVVVPCNVDIATTEALKMAQEVDPKGERTLGILTKPDLVDKGTEDVVVSIINNEIIYLNKGY--MIVKCRGQQDIDNSVPLYESVAIERDFFKNHPQFSILYEEGKATISNLAKKLTVELVSHIVHSLPQMEEQIHKRLAEIQAELDRYGSEPPTEPDQIIRFLNEKI-EVFTKDASKLAAGE-ELRNMTHVN-------IFSSLREH------------------FAAWKKILDDSAGKFDESIIKELEEYEKKYRGRELPGFLDFKTF 417          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Match: R9XK21 (Mx protein OS=Epinephelus coioides x Epinephelus malabaricus OX=1338336 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.423e-40
Identity = 138/464 (29.74%), Postives = 225/464 (48.49%), Query Frame = 2
Query: 1241 KFSSTLSQSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKY-MSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQEL-FADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEAL 2590
            K  STL+Q        +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++MR+  E      +I    + E   D +D E  I+E Q         I+ D I++ I SP    LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  ++ A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      DI+   +  E    E    ++   +S L D     +    + L  EL   I+K+LP L E ++  +A+T   LE +     +E  ++ Y +  K+         L +    E++N  K+                         +FS+L  EF     +L F+ +S +   D+ + D     R   +P FI+   F+ +V + L
Sbjct:   11 KMGSTLNQH------YEEKVRPCIDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMRRLKEDEPWHGKISYNGKEEEMYDPADVEKMIREAQDEMAGVGVGISDDLISLEISSPGVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFITKQETINLVVVPCNVDIATTEALQMAQEVDPEGDRTLGILTKPDLVDKGTEEAVVDIVHNEVIHLTKGY--MIVKCRGQKDIIDRVSLSEATDKETAFFQDHAHFSTLLDEGFATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKVAETQADLERYGDGPPTEPAERMYFLINKVTAFNQDIINLTIG--EELKNGYKL------------------------NLFSDLRAEFGEWKAQLDFSGHSFQKRVDEEVNDFEANYRGRELPGFINYKTFEVLVKDQL 437          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: ENSAMXT00000057014.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19594915:19607580:1 gene:ENSAMXG00000040238.1 transcript:ENSAMXT00000057014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 1.969e-41
Identity = 89/226 (39.38%), Postives = 137/226 (60.62%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R      + E L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK     + R  I YR E   F D S   + ++E Q     +   I  D IT+ I SPE   LT+IDLPG+ +  V+GQ  D+ ++   + R+F+E++ ++ + V+P N DI TT  ++ A E +P+  R + +LTK D +D+     + +I++NQ +P+ KGY
Sbjct:    1 IDLIDSLRQ---LGIEEDLALPSIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKLKGGVQWRATISYRDEYIEFDDPSLVGTYVEEAQNELAGDGVGICDDLITLEIMSPEVCDLTLIDLPGIARVPVKGQPDDIGDQIKSLIRNFIEKDQTINLVVVPCNVDIATTEALRMAQEVDPEGKRTLAILTKPDLVDKGTEKNVLDIVKNQVIPLSKGY 223          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: ENSAMXT00000030993.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19620289:19647832:1 gene:ENSAMXG00000043681.1 transcript:ENSAMXT00000030993.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 2.727e-41
Identity = 89/226 (39.38%), Postives = 137/226 (60.62%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R      + E L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK     + R  I YR E   F D S  E+ ++E Q     +   I  D IT+ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + + F+E+E ++ + V+P N DI TT  ++ A E +P+  R + +LTK D +D+     I ++++NQ +P+ KGY
Sbjct:   34 IDLIDSLRQ---LGIEEDLALPSIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKIKGGVQWRATISYRDEYIEFDDPSLVETYVEEAQNELAGDGVGICDDLITLEIMSPDVCDLTLIDLPGIARVPVKGQPDDIGDQIKSLIQSFIEKEQTINLVVVPCNVDIATTEALRMAQEVDPEGKRTLAILTKPDLVDKGTEKNILDVVKNQVIPLSKGY 256          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: ENSAMXT00000016255.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19660250:19682854:1 gene:ENSAMXG00000015797.2 transcript:ENSAMXT00000016255.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 5.442e-41
Identity = 90/226 (39.82%), Postives = 135/226 (59.73%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R      + E L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK     + R  I YR E   F D S   + ++E Q     +   I  D IT+ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + R F+E+E ++ + V+P N DI TT  ++ A E +P+  R + +LTK D +D+     I +I+ NQ +P+ KGY
Sbjct:   30 IDLIDSLRQ---LGIEEDLALPSIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKIKGGVQWRATISYRDEYIEFDDPSLVGTYVEEAQNELAGDGVGICDDLITLEIMSPDVCDLTLIDLPGIARVPVKGQPDDIGDQIKSLIRSFIEKEQTINLVVVPCNVDIATTEALRMAQEVDPEGKRTLAILTKPDLVDKGTEKNILDIVNNQVIPLSKGY 252          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: mxa (interferon-induced GTP-binding protein Mx1-like [Source:NCBI gene;Acc:103043862])

HSP 1 Score: 160.614 bits (405), Expect = 1.438e-40
Identity = 137/442 (31.00%), Postives = 228/442 (51.58%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTE-----TRIQIKYRSEPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINK---KNRTENIPVFISSTLFKKIVNEAL 2590
            I+ ID +RS+    V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I      E   D ++ ES+I+E Q         I+ D I++ I S     LT+IDLPG+ +  V+GQ  D+ ++   + R F+ ++ ++ + V+P N DI TT  +K A   +P+  R +G+LTK D +D+     + EI+ N+ + + KGY  +IV      +I+   +  E  + EK   ++   +S L D  +  +    + L  EL   I+K+LP L E ++  LA+T  +LE   KY     ++    SE+I        Y L++         K+  + +    L+   E  T  +L   +FSNL  +F S  Q L  D SG+  + +  +++ +   K R   +P FI+   F+ +V + +
Sbjct:   17 IDLIDSLRSQ---GVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRCREEDSWHGKISYDGYEEELDDPAEVESKIREAQDKIAGVGVGISDDLISLEITSSNVPDLTLIDLPGIARVAVKGQPEDIGDQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQVEDPNGERTLGILTKPDLVDKGTEETVVEIVNNEIINLTKGY--MIVRCRGQKEIIDRVSLTEATEKEKAFFRDHPHFSVLYDDGKATVPKLAEKLTLELVHHIEKSLPRLEEQIEAKLAETQDELE---KYGNGPPMEP---SERI--------YYLID---------KVTAFTQDALNLTMGEELRTAPHL--NIFSNLRIKFESWKQHL--DQSGETFNRRIEKEVQEYEVKYRGRELPGFINYKTFEVMVKDQI 426          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Match: mxa (interferon-induced GTP-binding protein Mx1-like [Source:NCBI gene;Acc:103043862])

HSP 1 Score: 160.614 bits (405), Expect = 1.438e-40
Identity = 137/442 (31.00%), Postives = 228/442 (51.58%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTE-----TRIQIKYRSEPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXWS-LEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINK---KNRTENIPVFISSTLFKKIVNEAL 2590
            I+ ID +RS+    V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I      E   D ++ ES+I+E Q         I+ D I++ I S     LT+IDLPG+ +  V+GQ  D+ ++   + R F+ ++ ++ + V+P N DI TT  +K A   +P+  R +G+LTK D +D+     + EI+ N+ + + KGY  +IV      +I+   +  E  + EK   ++   +S L D  +  +    + L  EL   I+K+LP L E ++  LA+T  +LE   KY     ++    SE+I        Y L++         K+  + +    L+   E  T  +L   +FSNL  +F S  Q L  D SG+  + +  +++ +   K R   +P FI+   F+ +V + +
Sbjct:   17 IDLIDSLRSQ---GVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRCREEDSWHGKISYDGYEEELDDPAEVESKIREAQDKIAGVGVGISDDLISLEITSSNVPDLTLIDLPGIARVAVKGQPEDIGDQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQVEDPNGERTLGILTKPDLVDKGTEETVVEIVNNEIINLTKGY--MIVRCRGQKEIIDRVSLTEATEKEKAFFRDHPHFSVLYDDGKATVPKLAEKLTLELVHHIEKSLPRLEEQIEAKLAETQDELE---KYGNGPPMEP---SERI--------YYLID---------KVTAFTQDALNLTMGEELRTAPHL--NIFSNLRIKFESWKQHL--DQSGETFNRRIEKEVQEYEVKYRGRELPGFINYKTFEVMVKDQI 426          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 139.043 bits (349), Expect = 4.057e-34
Identity = 79/229 (34.50%), Postives = 130/229 (56.77%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKST---ETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITIS-------IQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 1966
            I+ ID +R      V++ + LP + V+GDQSSGKSS+L+A+SG++LPRG   VTRCP+ ++++++      RI+ + +        DT   + +    A  +E+T D + +S       + S     LT+IDLPG+ +  + GQA D+  +  ++ RD + ++ ++ + V+P N DI TT  +K A   +P   R +GVLTK D +DE        I++NQ  P+ KGY
Sbjct:   31 IDLIDTLRY---LGVDQDVGLPAVAVIGDQSSGKSSVLEALSGVQLPRGSGIVTRCPLALKLKRAPGPWHGRIKYRVQGRTINTKLDTPESVGDAVLQA-QSELTGDDLGVSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTERNALRILQNQVFPLSKGY 255          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 8.283e-27
Identity = 78/256 (30.47%), Postives = 135/256 (52.73%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------------RKSTETRIQ-------------IKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            I  I++++  F+   +E+++LPQI+VVG QSSGKSS+L+++ G   LPRG   VTR P+V+Q+                   ST  R+              +  +++ + D ++   EI+    + T  N  I+ + I + I SP  + LT++DLPG+ K  V  Q  D+ ++  E+   F+   NS+I+ V  AN D+ T+  +K A E + D  R + V+TKLD +D     +  +I+  + +P++ G  G++
Sbjct:    5 IPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHVIPDERIRPGGEENGTASTAARLILFAGVEAEEWGKFLHTKNKVYSDFNEIRQEIENETERITGTNKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAGTDAM--DILTGRVIPVKLGIIGVV 258          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 2.812e-25
Identity = 67/182 (36.81%), Postives = 102/182 (56.04%), Query Frame = 2
Query: 1445 LPRGVNTVTRCPVVMQ-MRKSTETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            LPRG   VTR P+++Q M    E    +  + + F D  +  +EI E +T   T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  E+   F+ +EN LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +D+   T   +I+ N+ LP+ +GY G++
Sbjct:    4 LPRGSGIVTRRPLILQLMFCKAEYAEFLHCKGKKFTDFEEVRAEI-EAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDDG--TDARDILENKLLPLRRGYIGVV 182          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 90.8929 bits (224), Expect = 1.059e-18
Identity = 62/228 (27.19%), Postives = 120/228 (52.63%), Query Frame = 2
Query: 1334 SKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKL-PRGVN-TVTRCPVVMQMRKSTETRIQIKYRSEPFK-----DIS--DTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVT---LIPEIIRNQKLPIEK-GYYGLI 1978
            S + A+ N   +LP+++VVGDQSSGK+S+L+ I+  ++ PRG    +TR PV + + +        K  S  F      D++    E EI+  ++    + ++ + I++S++ P    + ++DLPG++     G A D  +    +++ +M+  N++I+C+   + D   +      +  +P   R I VLTK+D L EK +     I +I+  +  P++  GY+ ++
Sbjct:  208 SDYDANYNTQDQLPRVVVVGDQSSGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVAIFKDSSREFDLTKEDDLAALRKEIEIRMKKSVKEGHTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVD-LAEKNLASPNRIQQILDGKLFPMKALGYFAVV 434          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 90.5077 bits (223), Expect = 1.184e-18
Identity = 62/228 (27.19%), Postives = 120/228 (52.63%), Query Frame = 2
Query: 1334 SKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKL-PRGVN-TVTRCPVVMQMRKSTETRIQIKYRSEPFK-----DIS--DTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVT---LIPEIIRNQKLPIEK-GYYGLI 1978
            S + A+ N   +LP+++VVGDQSSGK+S+L+ I+  ++ PRG    +TR PV + + +        K  S  F      D++    E EI+  ++    + ++ + I++S++ P    + ++DLPG++     G A D  +    +++ +M+  N++I+C+   + D   +      +  +P   R I VLTK+D L EK +     I +I+  +  P++  GY+ ++
Sbjct:  218 SDYDANYNTQDQLPRVVVVGDQSSGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVAIFKDSSREFDLTKEDDLAALRKEIEIRMKKSVKEGHTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVD-LAEKNLASPNRIQQILDGKLFPMKALGYFAVV 444          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 116.701 bits (291), Expect = 4.231e-27
Identity = 85/277 (30.69%), Postives = 135/277 (48.74%), Query Frame = 2
Query: 1292 EKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----RKSTETRIQI--------------KYRSEPFKDISDTESE---------------------------IKEI-QTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            E  I  IN + +  +         + LPQI VVG QSSGKSS+L+ I G   LPRG   VTR P+V+Q+     +KS   ++                K + E  K  ++ +SE                           +KE  + T  N+ I+  PI + I SP  +TLT++DLPGL K  V  Q  D+  +  ++   ++ + N++I+ V  AN D+  +  +K A E +P+ +R IGVLTK+D +D+   T + +I+  + +P+  GY  +I
Sbjct:    3 EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQG--TDVIDILAGRVIPLRYGYIPVI 277          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 108.227 bits (269), Expect = 1.949e-24
Identity = 77/253 (30.43%), Postives = 123/253 (48.62%), Query Frame = 2
Query: 1358 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTE------------------TRIQ--------IKYRSEP-----------------FKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + L LP + VVG QSSGKSSIL+ + G   LPRG   VTR P+V+Q+   +                   T+I         ++YR +                  F D  D + EI+    +    +  I+K PI + + SP  + LT++DLPG+ K  +  Q  D+ ++   +  D++   N LI+ V PAN D+  + ++K A E +P   R IGV+TKLD +D     L  +I+  +  P++ G+ G++
Sbjct:   24 DTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL--DILSGKMYPLKLGFVGVV 274          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 106.301 bits (264), Expect = 9.594e-24
Identity = 63/211 (29.86%), Postives = 119/211 (56.40%), Query Frame = 2
Query: 1364 LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTET-RIQIKY---RSEPFKDISDTESEIKEIQTTAFNNE-ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            L LP I+V+G QSSGKSS+L++I G + LP+G N VTR P+ + +  +  +  +   +   R    KD  + +  + E+      +E ++++PI ++I+S     L+++DLPG ++ +   Q  ++  K  ++   ++   N +I+ +  A+ D+  ++ +K +   +P   R IGV+TKLD +D ++      I+ N+K P+  GY G+I
Sbjct:  208 LTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRMLMELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDPEKAR---SILNNKKYPLSMGYVGVI 414          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 141.354 bits (355), Expect = 2.297e-35
Identity = 79/209 (37.80%), Postives = 125/209 (59.81%), Query Frame = 2
Query: 1364 LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTETRIQIKY-RSEPFKDISDTESEI--KEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q++ S     +  + R++ F D  + + EI  +  + T  N  I+  PI + + SP  ++LT++DLPG+ K  V  Q  D+  +   +  +F+ +EN LI+ V PAN D+  +  +K A E +P  +R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++
Sbjct:   29 IDLPQIAVVGSQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLQPSKSEYAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEG--TDARDILENRVLPLRRGYIGIV 235          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 126.716 bits (317), Expect = 8.534e-30
Identity = 83/262 (31.68%), Postives = 141/262 (53.82%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM----RKSTETRIQI---------KYRSEP-------------FKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTN 2008
            I  I++++  F+   +E+++LPQI+VVG QSSGKSS+L+ + G   LPRG   VTR P+++Q+     ++ E +I            + +EP             F+D +    EI+    + T  N  I+ +PI + I SP+ + LT++DLPG+ K  V  Q  D+ ++   +   ++   NS+I+ V PAN D+ T+  +K A E +PD  R + V TKLD +D     +  +++  + +P++ G  G +VN   L + N
Sbjct:    5 IPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLENLVGRDFLPRGSGVVTRRPLILQLVHVPPRAKEKKINELPDKKEAAEDHDAEPAEWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHGTDAM--DVLYGRVIPVKLGIIG-VVNRSQLDINN 263          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 92.8189 bits (229), Expect = 3.151e-19
Identity = 59/230 (25.65%), Postives = 119/230 (51.74%), Query Frame = 2
Query: 1325 EMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKL-PRGVNTV-TRCPVVMQMRKSTETRIQIKYRSEPF-----KDISDT--ESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEV--TLIPEIIRNQKLPIEK-GYYGLI 1978
            ++ +++    N    LP+++VVGDQS+GK+S+L+ I+  ++ PRG   + TR PV++ + +      Q K  S  F     K++ D   E E++  ++      ++ + I+++++ P    + ++DLPG++     G A        +I+R +ME  N++I+C+     D   +      +  +P   R I VLTK+D  ++ E   + I +I+     P++  GY+ ++
Sbjct:   14 DLLAEYDVSYNTTDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGQMMTRSPVMVTLSEGPNHIAQFKGNSRQFDLTQEKELKDLRHEVELRMKRSVKQGQTVSPEVISMTVKGPGLHRMVLVDLPGIIGTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQNETSPSRIKQILEGNLFPMKALGYFAVV 243          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: mxb (interferon-induced GTP-binding protein Mx [Source:NCBI gene;Acc:101163162])

HSP 1 Score: 153.68 bits (387), Expect = 2.520e-38
Identity = 128/434 (29.49%), Postives = 223/434 (51.38%), Query Frame = 2
Query: 1310 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYR--SEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----NDDILKLTNXXXXXXXXXXXXXXXXXW-SLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSG---KYHSDQYLEDINKKNRTENIPVFISSTLF 2566
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M+K T+ +    +I YR  +E  ++ ++ E  I + Q         I+ + I++ I SP    LT+IDLPG+ +  V+GQ  ++ E+  ++   F+ ++ ++ + V+P N DI TT  +K A E +P+  R +G+LTK D +D+     + +II N+ +P++KGY  +IV      +I K  +     + E+   +E   + +L       +    + L  EL   I K+LP L E ++  L +T  KL+       SE       SEK+  + +K           + ++T+   YL K   L   ++ + F         ++ ++ F+ +  L  D SG    ++ ++ +   ++K R + +P FI+   F
Sbjct:   16 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKKITKGQKWNGKIHYRDFAEEIQEPANVEQNICQAQDKMAGVGVGISDELISLEIASPNVPDLTLIDLPGITRVAVKGQPANIGEQIKKLIWKFIGKQETINLVVVPCNVDIATTEALKMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIINNKAIPLKKGY--MIVRCRGQKEITKKVSLTTALEKERNFFQEHSHFQTLYYDGHASVPKLAEKLTLELVHHIQKSLPHLEEQIETKLKQTQSKLDNLGCGPPSEP------SEKLGFLIDK-----------VTSFTQDAVYLSKGEDLRCGYKSKIF---------SVLRQRFASWNLLIED-SGTTFSWNIEKEVAQYDRKYRGKELPGFINYKTF 417          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: ENSORLT00000002352.2 (pep primary_assembly:ASM223467v1:4:3837959:3851307:-1 gene:ENSORLG00000001885.2 transcript:ENSORLT00000002352.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.969 bits (354), Expect = 3.464e-36
Identity = 80/213 (37.56%), Postives = 124/213 (58.22%), Query Frame = 2
Query: 1352 VNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTETRIQIKY-RSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            + ++L+LPQ+ VVG QSSGKSS+L+ + G   LPRG   VTR P+++Q+  ST    +  + + + F D +    EI+    + T  N  I   PI + I SP  + LT++DLPG+ K  V  Q  D+  +  +I   ++  EN LI+ V+PAN D+  +  +K A + +P   R  GV+TKLD +DE   T   EI+ N+ LP+ +GY G++
Sbjct:   28 LGQSLQLPQVAVVGGQSSGKSSVLENLVGRDFLPRGSGIVTRTPLILQLLHSTAEYGEFSHCKGKKFTDFNQIRMEIEAETCRLTGSNKGICSAPIVLQIHSPHVLNLTLVDLPGMTKVPVEDQPADIEYQIRDIIMQYICNENCLILAVVPANTDLPNSDALKLAKDVDPQGLRTFGVITKLDLMDEG--TDAKEILENRFLPLRRGYVGVV 238          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 143.665 bits (361), Expect = 2.071e-34
Identity = 86/228 (37.72%), Postives = 130/228 (57.02%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            I  ++ M+  F+A   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+  S TE    +  + + F D  +   EI+    + T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++
Sbjct:   10 IPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVV 235          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 143.28 bits (360), Expect = 2.275e-34
Identity = 86/228 (37.72%), Postives = 130/228 (57.02%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            I  ++ M+  F+A   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+  S TE    +  + + F D  +   EI+    + T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++
Sbjct:   10 IPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVV 235          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 143.28 bits (360), Expect = 2.289e-34
Identity = 86/228 (37.72%), Postives = 130/228 (57.02%), Query Frame = 2
Query: 1310 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 1978
            I  ++ M+  F+A   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+  S TE    +  + + F D  +   EI+    + T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++
Sbjct:   10 IPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEIEAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVV 235          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002004.1 (SMESG000002004.1)

HSP 1 Score: 1162.52 bits (3006), Expect = 0.000e+0
Identity = 626/633 (98.89%), Postives = 631/633 (99.68%), Query Frame = 2
Query: 1277 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFXXXXXXXXXXXXHXXXXXXXXXXXXXXXDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQPTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC 3175
            M +AKE+WIKKI+FIDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVT+CPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFT ALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDKCVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQPTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC
Sbjct:    1 MYLAKEEWIKKIDFIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTKCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTYALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDKCVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQPTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC 633          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002216.1 (SMESG000002216.1)

HSP 1 Score: 1157.51 bits (2993), Expect = 0.000e+0
Identity = 622/633 (98.26%), Postives = 630/633 (99.53%), Query Frame = 2
Query: 1277 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFXXXXXXXXXXXXHXXXXXXXXXXXXXXXDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQPTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC 3175
            M +AKE+WIKKI+FIDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVT+CPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDIL+LTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKY+SDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVD+CVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQ TENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEK EIERLRQTKLMLEEYSSKLNDYHC
Sbjct:    1 MYLAKEEWIKKIDFIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTKCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILQLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYYSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDECVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQSTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKVEIERLRQTKLMLEEYSSKLNDYHC 633          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002004.1 (SMESG000002004.1)

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 530/535 (99.07%), Postives = 532/535 (99.44%), Query Frame = 2
Query: 1571 EIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFXXXXXXXXXXXXHXXXXXXXXXXXXXXXDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQPTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC 3175
            +I  +QTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFT ALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDKCVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQPTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC
Sbjct:    7 KIHSVQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTYALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDKCVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQPTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC 541          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002216.1 (SMESG000002216.1)

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 526/534 (98.50%), Postives = 530/534 (99.25%), Query Frame = 2
Query: 1574 IKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFXXXXXXXXXXXXHXXXXXXXXXXXXXXXDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQPTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC 3175
            I  +QTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDIL+LTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKY+SDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVD+CVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQ TENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEK EIERLRQTKLMLEEYSSKLNDYHC
Sbjct:    8 IHSVQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILQLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYYSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDECVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQSTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKVEIERLRQTKLMLEEYSSKLNDYHC 541          
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Match: SMESG000002011.1 (SMESG000002011.1)

HSP 1 Score: 949.888 bits (2454), Expect = 0.000e+0
Identity = 517/635 (81.42%), Postives = 575/635 (90.55%), Query Frame = 2
Query: 1277 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNXXXXXXXXXXXXXXXXXWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFXXXXXXXXXXXXHXXXXXXXXXXXXXXXDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTG--QNAPQPTENLQTRNGRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC 3175
            M +AKE+WIKKI+FIDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEI++IQTTAFN+EITK+PITISIQSPESVTLTIIDLPGLVK +V+GQ+  +I+KTHEIARDFM+QENSLIICVLPANQDICTTTTI+EA +CNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPI+KGYYGLIV+D+IL+LTNKDEI + EK+ILKEKKLW+LEDI RFGLSNFTDALV+ELG LIDKTLPILR NVDKLL + NGKLETFSKY  ++E Q+KYM  KIKEIE+KTK+LLV GKHEI  Y K+K++LE KRIL+SI EHETFIYLW+TVFSNLFKEFF IY++ F +YSGKYHSDQ+L+DINKKNRTENIPVFIS+TLFKKIVNEA+  FK KVDKCV +C  IISFII E+LIMDIE KLSPLKMDIQKISR+VL EKKLEIE YL FLF+SEHTYFTQA +I++ +  Q QPA   G   N+    E+L T+N +ILKD LK YLINA+RKLGDVIPSFIKQSLF+DFS+SLIEALETEILYSK SLSYFSLT QEK EIERLR+TKL LEEYSSKLNDYHC
Sbjct:    1 MYLAKEEWIKKIDFIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIRKIQTTAFNDEITKEPITISIQSPESVTLTIIDLPGLVKTNVQGQSRHIIQKTHEIARDFMKQENSLIICVLPANQDICTTTTIREAIQCNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIKKGYYGLIVSDEILELTNKDEIARIEKRILKEKKLWTLEDIGRFGLSNFTDALVEELGSLIDKTLPILRGNVDKLLKEINGKLETFSKYQETQEGQQKYMRMKIKEIESKTKHLLVKGKHEIIKYKKVKDHLENKRILNSIQEHETFIYLWETVFSNLFKEFFRIYKDFFGEYSGKYHSDQHLDDINKKNRTENIPVFISTTLFKKIVNEAMDKFKDKVDKCVKLCYDIISFIIHEVLIMDIEAKLSPLKMDIQKISRKVLDEKKLEIENYLKFLFKSEHTYFTQATMIESLLGHQFQPAFSPGTPTNSVPEFEDLPTKNWKILKDSLKTYLINAIRKLGDVIPSFIKQSLFLDFSESLIEALETEILYSKKSLSYFSLTAQEKEEIERLRETKLKLEEYSSKLNDYHC 635          
The following BLAST results are available for this feature:
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MX21.757e-3636.89MX dynamin like GTPase 2 [Source:HGNC Symbol;Acc:H... [more]
DNM12.261e-3636.84dynamin 1 [Source:HGNC Symbol;Acc:HGNC:2972][more]
MX11.531e-3436.32MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:H... [more]
MX11.982e-3436.56MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:H... [more]
MX11.982e-3436.56MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyn-12.004e-3232.39Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
dyn-12.052e-3232.00Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
drp-15.882e-2632.60Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-15.882e-2632.60Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-15.882e-2632.60Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shi3.205e-3430.19gene:FBgn0003392 transcript:FBtr0074122[more]
shi3.205e-3430.19gene:FBgn0003392 transcript:FBtr0074121[more]
shi3.205e-3430.19gene:FBgn0003392 transcript:FBtr0074119[more]
shi3.205e-3430.19gene:FBgn0003392 transcript:FBtr0111037[more]
shi3.205e-3430.19gene:FBgn0003392 transcript:FBtr0074118[more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxa1.425e-3632.94myxovirus (influenza) resistance A [Source:NCBI ge... [more]
si:dkeyp-110c12.31.763e-3630.69si:dkeyp-110c12.3 [Source:ZFIN;Acc:ZDB-GENE-131126... [more]
si:dkeyp-110c12.32.268e-3632.39si:dkeyp-110c12.3 [Source:ZFIN;Acc:ZDB-GENE-131126... [more]
mxg6.194e-3638.05myxovirus (influenza virus) resistance G [Source:Z... [more]
mxb9.026e-3631.75myxovirus (influenza) resistance B [Source:NCBI ge... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnpepl11.437e-3835.55arginyl aminopeptidase (aminopeptidase B)-like 1 [... [more]
krt173.730e-3734.76keratin 17 [Source:Xenbase;Acc:XB-GENE-490369][more]
krt177.260e-3734.76keratin 17 [Source:Xenbase;Acc:XB-GENE-490369][more]
ei245.917e-3332.50etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
ei247.328e-3332.50etoposide induced 2.4 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mx12.209e-3736.05MX dynamin-like GTPase 1 [Source:MGI Symbol;Acc:MG... [more]
Mx11.022e-3436.05MX dynamin-like GTPase 1 [Source:MGI Symbol;Acc:MG... [more]
Mx23.320e-3430.00MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MG... [more]
Mx23.829e-3430.00MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MG... [more]
Mx25.287e-3429.66MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91192|MX1_ONCMY5.153e-4231.34Interferon-induced GTP-binding protein Mx1 OS=Onco... [more]
sp|Q91196|MX2_ONCMY1.423e-4135.22Interferon-induced GTP-binding protein Mx2 OS=Onco... [more]
sp|Q91197|MX3_ONCMY4.213e-4134.71Interferon-induced GTP-binding protein Mx3 OS=Onco... [more]
sp|P20593|MX_PERFL1.196e-4036.48Interferon-induced GTP-binding protein Mx (Fragmen... [more]
sp|Q6PW23|MX_EPICO2.260e-4032.52Interferon-induced GTP-binding protein Mx OS=Epine... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A060YH961.088e-4131.28Dynamin-type G domain-containing protein OS=Oncorh... [more]
Q989914.276e-4132.41Mx2 protein OS=Salmo salar OX=8030 GN=mx2 PE=2 SV=... [more]
Q989908.277e-4132.41Mx1 protein OS=Salmo salar OX=8030 GN=mx1 PE=2 SV=... [more]
A0A556TK773.411e-4031.64Interferon-induced GTP-binding protein Mx1 OS=Baga... [more]
R9XK214.423e-4029.74Mx protein OS=Epinephelus coioides x Epinephelus m... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000057014.11.969e-4139.38pep primary_assembly:Astyanax_mexicanus-2.0:12:195... [more]
ENSAMXT00000030993.12.727e-4139.38pep primary_assembly:Astyanax_mexicanus-2.0:12:196... [more]
ENSAMXT00000016255.25.442e-4139.82pep primary_assembly:Astyanax_mexicanus-2.0:12:196... [more]
mxa1.438e-4031.00interferon-induced GTP-binding protein Mx1-like [S... [more]
mxa1.438e-4031.00interferon-induced GTP-binding protein Mx1-like [S... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxb4.057e-3434.50myxovirus (influenza) resistance B [Source:NCBI ge... [more]
ENSPMAT00000002816.18.283e-2730.47pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
ENSPMAT00000006976.12.812e-2536.81pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
opa11.059e-1827.19OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
opa11.184e-1827.19OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
VPS14.231e-2730.69Dynamin-like GTPase required for vacuolar sorting;... [more]
DNM11.949e-2430.43Dynamin-related GTPase involved in mitochondrial o... [more]
MGM19.594e-2429.86Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO321912.297e-3537.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348958.534e-3031.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403593.151e-1925.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxb2.520e-3829.49interferon-induced GTP-binding protein Mx [Source:... [more]
ENSORLT00000002352.23.464e-3637.56pep primary_assembly:ASM223467v1:4:3837959:3851307... [more]
dnm1a2.071e-3437.72dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a2.275e-3437.72dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a2.289e-3437.72dynamin 1 [Source:NCBI gene;Acc:101157793][more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002004.10.000e+098.89SMESG000002004.1[more]
SMESG000002216.10.000e+098.26SMESG000002216.1[more]
SMESG000002004.10.000e+099.07SMESG000002004.1[more]
SMESG000002216.10.000e+098.50SMESG000002216.1[more]
SMESG000002011.10.000e+081.42SMESG000002011.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000316 ID=SMED30000316|Name=Interferon-induced GTP-binding protein Mx1|organism=Schmidtea mediterranea sexual|type=transcript|length=3430bp
ATTTTTTTAAAAGTTTTAAAATAAATGATTTACCCTAAATGTAAATTAAA
ATTTATTGACTCATATTTTTATTACACTTGATTTTTATTTCTTTCGATGA
TGTCATTAAAAACTTACTTAGAAATATTTAAAATATTTTTTTTTTTCGAT
AACTTTATGTTCAAATCAATCAATCAATCGAACTGACAAGTTTCCAATTT
ACTCTAATTCTTCATTTAACATCCTATTTAAACCAGTAAAAACATATTCA
CCGTTTTCGTTGATAAAATTGCAAATCGTTTGTCAATTCGAAATCGAAGA
AACCGTTTTTATTAATCCTGGAATTGAGAACAATTTGAAAAATAAAATCA
GCAACAAATATATGTCAGTAATCAATTGGCATAAGAACACGTACAGAGCA
ATCGAAATGATAATTCAATTTCATCCTTCAGCAAACAGATTGATTTTTGA
AATTTTATATTATAACGGAACTGGCAATCGATATAATGCTTTCAGGAATC
GTTCAGTTATGAATCGGATTTTCTCCGAACAAATTCAACTGAACATCGAT
GCGATTTTGGATTTTTATATCGCCACGCGAGATGGCCGAACCGATGGAGT
GAACAGCGAGGAAATGGCCGTAATATCGTGCGAATCCAAGAACGGAGTTC
CTCCAGGCCGGCCGATATTGAAATATATCGATCAGTTGGATGTGAAAAAC
CGGAAATTTCACGAGGCCGACAACAGAATCGTTGTCCATGCGTTCCTGAG
GAAATCCGACCACAATAAATACGTGAAATGCATGTCGACCGGCGTCACCG
AATATCGCTACATAAAGATCTTTCACCACCCGACAGCGCTCCAGTTACGG
CCCAATTATGCCGGAACCATGCCGAATGGATCCTCGGTCCTATGCACAGC
TGCTGATGGCTACCCGCCACCGACAATCAACTGGGAGTTCATCAGTGGAC
CTCCCAATGCCTCACAGTTCTACTCGATCACTGCCGGCAACAATCTGACC
ATCCTTCCGCATTGCCCGCTTCATACTCAATGGACGTTCAATTGCACCGC
CTTGAACAGCATTCCTAAATCCTATGACCTCGGCACGACTCGCTCCTTCA
CTTTCACTGTTTCCCAGGATATGAACGTGATTTCTTTTCTTTTCTCCGGA
ATCGTAATCAAATGTTTTGCTAGCTTTTTTGGTTTGCTCATCATTATATG
CATTGCAATGAAAAGGAAATCTGGTATCAAGGGTGAATTGAAGTTTTCGA
GTACATTGAGCCAATCTAAGAAACGAATGACTGTAGCGAAAGAAAAATGG
ATCAAAAAAATAAATTTCATTGACGAAATGAGATCAAAGTTTTCAGCCGA
CGTTAATGAAGCTCTGAAGCTTCCACAAATAATTGTCGTAGGAGACCAAA
GCTCGGGCAAAAGCTCAATTTTGCAAGCGATCTCCGGGATAAAGTTACCG
AGAGGAGTAAATACCGTCACAAGGTGCCCAGTCGTAATGCAAATGCGCAA
ATCAACTGAAACAAGAATCCAAATCAAATACAGATCGGAGCCATTTAAAG
ATATTTCTGACACTGAAAGCGAAATAAAGGAAATACAAACGACTGCTTTC
AATAATGAAATAACAAAGGACCCGATTACAATCAGCATTCAGTCCCCTGA
ATCTGTGACATTGACAATCATTGACTTGCCTGGCTTGGTCAAGGCAGATG
TTCGAGGACAAGCAACAGACATGATAGAGAAAACACATGAAATAGCAAGG
GACTTCATGGAGCAAGAGAACTCATTAATAATTTGCGTGCTGCCAGCAAA
TCAGGACATCTGTACAACGACAACTATTAAGGAGGCAACTGAATGCAATC
CGGACAAATCAAGAATAATCGGAGTGCTTACAAAACTGGACAAACTCGAC
GAGAAGGAAGTGACACTCATCCCAGAGATCATCAGGAATCAAAAGTTGCC
AATAGAGAAAGGATATTACGGTTTAATTGTCAATGATGACATTTTGAAAC
TTACTAATAAAGATGAAATAAAAAAAACGGAAAAGAAAATTTTAAAAGAA
AAAAAGTTATGGAGTCTTGAGGACATCAAACGTTTTGGACTCTCGAATTT
CACTGATGCACTTGTTGACGAGTTGGGCTGGTTGATAGATAAAACTCTGC
CGATTCTAAGAGAAAATGTTGATAAGTTACTAGCGAAAACTAATGGGAAA
TTGGAAACATTTTCAAAATATCACGGAAGTGAGGAAATTCAAAAAAAATA
CATGAGCGAAAAAATTAAAGAGATTGAAAATAAAACAAAATATTTACTTG
TTAATGGAAAGCATGAAATTCAAAATTATACCAAAATCAAAAATTATTTG
GAAAAAAAGAGAATTTTAAGTTCTATTCATGAACATGAAACCTTTATTTA
CTTATGGGACACAGTGTTCAGTAATCTCTTTAAGGAATTCTTCAGTATAT
ATCAAGAATTATTCGCTGATTACAGTGGAAAATATCATAGTGACCAATAT
CTTGAAGACATAAACAAGAAAAACAGAACCGAAAACATTCCAGTCTTTAT
CAGTAGTACGCTATTTAAAAAGATTGTTAACGAAGCTTTGCTAAATTTTA
AAAAAAAAGTTGACAAATGCGTCAATGTTTGTTGTCATATCATTTCTTTT
ATCATCGAGGAAATTCTGATAATGGACATTGAAGATAAACTCTCTCCCCT
CAAAATGGATATTCAAAAAATAAGTCGCAGAGTTCTCAGTGAAAAGAAAT
TGGAAATTGAAAAGTATTTAACTTTTCTTTTTCAGAGTGAGCATACTTAT
TTCACGCAGGCGATCGTCATCGATGCAGGCGTTGTACCTCAGTTGCAACC
GGCACTTGTGACTGGACAAAATGCTCCTCAACCAACTGAAAACCTTCAAA
CAAGAAATGGGAGAATATTAAAGGATTGTTTGAAAAATTATTTAATTAAT
GCCGTCCGGAAATTAGGAGACGTAATTCCAAGTTTTATCAAGCAAAGTTT
ATTTATCGATTTCAGCAAGTCCTTGATAGAAGCTCTGGAAACGGAAATTT
TATACTCGAAAATGTCTCTGTCATACTTTTCTTTAACTGATCAAGAAAAG
GGGGAAATAGAGCGATTGCGACAGACCAAACTGATGCTGGAAGAATATAG
CAGCAAGCTGAATGATTATCACTGTTAATTTTCATAATACTTATTTCCTA
GTCAATTAATATTTTTTGGATTTTTATTACAATTGTTTGTGCAGGTAACG
GTAATTTTTGGTTTAATTAATTTTTGACATAATTTCATTGTTTAATATAA
TTTTTTGTTTTATTCTCCAATCATATCGCAAAGTTTTGTGAAACAAATTC
AAACACACGCAAATAAGTTTTTTGTTTCCAAACAGAGACCATTTTCAATA
AACATGCACCTGATTCAGTTCATTAAAAAC
back to top

protein sequence of SMED30000316-orf-1

>SMED30000316-orf-1 ID=SMED30000316-orf-1|Name=SMED30000316-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=939bp
MSVINWHKNTYRAIEMIIQFHPSANRLIFEILYYNGTGNRYNAFRNRSVM
NRIFSEQIQLNIDAILDFYIATRDGRTDGVNSEEMAVISCESKNGVPPGR
PILKYIDQLDVKNRKFHEADNRIVVHAFLRKSDHNKYVKCMSTGVTEYRY
IKIFHHPTALQLRPNYAGTMPNGSSVLCTAADGYPPPTINWEFISGPPNA
SQFYSITAGNNLTILPHCPLHTQWTFNCTALNSIPKSYDLGTTRSFTFTV
SQDMNVISFLFSGIVIKCFASFFGLLIIICIAMKRKSGIKGELKFSSTLS
QSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGK
SSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISD
TESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQ
ATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKS
RIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNK
DEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILR
ENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGK
HEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQEL
FADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKV
DKCVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIE
KYLTFLFQSEHTYFTQAIVIDAGVVPQLQPALVTGQNAPQPTENLQTRNG
RILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSK
MSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000463cholinergic neuron
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR001401Dynamin_GTPase
IPR000375Dynamin_central
IPR027417P-loop_NTPase
IPR030381G_DYNAMIN_dom
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0005515protein binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0048471perinuclear region of cytoplasm
Vocabulary: biological process
TermDefinition
GO:0034340response to type I interferon