HoxC12-like protein

Overview
NameHoxC12-like protein
Smed IDSMED30000303
Length (bp)806
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HoxC12-like protein (SMED30000303) t-SNE clustered cells

Violin plots show distribution of expression levels for HoxC12-like protein (SMED30000303) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HoxC12-like protein (SMED30000303) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HoxC12-like protein (SMED30000303) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000303

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30000303SMESG000022668.1 dd_Smed_v4_12467_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30000303SMESG000022668.1 dd_Smed_v4_12467_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30000303SMESG000022668.1 dd_Smed_v4_12467_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30000303SMESG000022668.1 SmedASXL_007760SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30000303SMESG000022668.1 SmedASXL_007760SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
posterior region of the whole animalSMED30000303SMESG000022668.1 Smed-Post-2csmed_ncbi_20200123PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30000303SMESG000022668.1 SmedASXL_007760SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Category 2 cellSMED30000303SMESG000022668.1 SMED30000303smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30000303SMESG000022668.1 SMED30000303smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Category 3 cellSMED30000303SMESG000022668.1 SMED30000303smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30000303SMESG000022668.1 SMED30000303smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30000303SMESG000022668.1 SMED30000303smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30000303SMESG000022668.1 SMED30000303smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30000303SMESG000022668.1 dd_Smed_v4_12467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30000303SMESG000022668.1 dd_Smed_v4_12467_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30000303SMESG000022668.1 dd_Smed_v6_12467_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30000303SMESG000022668.1 dd_Smed_v6_12467_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HoxC12-like protein vs. Ensembl Human
Match: HOXC12 (homeobox C12 [Source:HGNC Symbol;Acc:HGNC:5124])

HSP 1 Score: 77.0258 bits (188), Expect = 6.026e-16
Identity = 32/61 (52.46%), Postives = 49/61 (80.33%), Query Frame = 1
Query:  460 DQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + + R KR+PYS+ QL  LE E++  E+I+RQ+R +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  211 NSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 271          
BLAST of HoxC12-like protein vs. Ensembl Human
Match: HOXD12 (homeobox D12 [Source:HGNC Symbol;Acc:HGNC:5135])

HSP 1 Score: 74.7146 bits (182), Expect = 3.492e-15
Identity = 31/59 (52.54%), Postives = 49/59 (83.05%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PY++ Q+  LE+E++  E+I+RQKR +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  201 RARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKR 259          
BLAST of HoxC12-like protein vs. Ensembl Human
Match: HOXB9 (homeobox B9 [Source:HGNC Symbol;Acc:HGNC:5120])

HSP 1 Score: 74.3294 bits (181), Expect = 4.243e-15
Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            R KR PY++YQ + LE E++   Y++R +R ++A  LNLSERQ+KIWFQNRRMK KK NKE+
Sbjct:  186 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQ 247          
BLAST of HoxC12-like protein vs. Ensembl Human
Match: AC004080.3 (HOXA10-HOXA9 readthrough)

HSP 1 Score: 70.0922 bits (170), Expect = 1.053e-14
Identity = 33/62 (53.23%), Postives = 49/62 (79.03%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            R KR PY+++Q + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK NK++
Sbjct:   47 RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDR 108          
BLAST of HoxC12-like protein vs. Ensembl Human
Match: HOXA9 (homeobox A9 [Source:HGNC Symbol;Acc:HGNC:5109])

HSP 1 Score: 72.0182 bits (175), Expect = 1.401e-14
Identity = 33/62 (53.23%), Postives = 49/62 (79.03%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            R KR PY+++Q + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK NK++
Sbjct:  148 RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDR 209          
BLAST of HoxC12-like protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 82.0333 bits (201), Expect = 3.874e-18
Identity = 40/89 (44.94%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  394 FVSENLPSSCPNSNKSVEKE--EKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 654
            F + ++PS   N N   + E        R KR+PY++ Q + LE E++   Y+S+QKRW++A  L+L+ERQ+KIWFQNRRMK KK K++
Sbjct:  172 FANYSMPSLDGNLNDGGQLEWTSSSHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQKQR 260          
BLAST of HoxC12-like protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 82.0333 bits (201), Expect = 3.874e-18
Identity = 40/89 (44.94%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  394 FVSENLPSSCPNSNKSVEKE--EKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 654
            F + ++PS   N N   + E        R KR+PY++ Q + LE E++   Y+S+QKRW++A  L+L+ERQ+KIWFQNRRMK KK K++
Sbjct:  172 FANYSMPSLDGNLNDGGQLEWTSSSHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQKQR 260          
BLAST of HoxC12-like protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 73.1738 bits (178), Expect = 5.031e-15
Identity = 37/81 (45.68%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  463 QKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK*TLPRILCR*LPITAN 702
            + E+ +R  Y+R Q++ LE E+   +Y++R++R ++A  L L+ERQ+KIWFQNRRMKHKK NK+K   P +    +P  AN
Sbjct:  163 RGEKRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKENKDKPMTPPM----MPFGAN 239          
BLAST of HoxC12-like protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 73.1738 bits (178), Expect = 5.031e-15
Identity = 37/81 (45.68%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  463 QKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK*TLPRILCR*LPITAN 702
            + E+ +R  Y+R Q++ LE E+   +Y++R++R ++A  L L+ERQ+KIWFQNRRMKHKK NK+K   P +    +P  AN
Sbjct:  163 RGEKRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKENKDKPMTPPM----MPFGAN 239          
BLAST of HoxC12-like protein vs. Ensembl Celegans
Match: mab-5 (Homeobox protein mab-5 [Source:UniProtKB/Swiss-Prot;Acc:P10038])

HSP 1 Score: 66.2402 bits (160), Expect = 5.684e-13
Identity = 31/62 (50.00%), Postives = 46/62 (74.19%), Query Frame = 1
Query:  457 KDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            K  + +  R+ YSR Q + LE E+   +Y++R++R +I+  L+L+ERQ+KIWFQNRRMKHKK
Sbjct:  113 KGGESKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKK 174          
BLAST of HoxC12-like protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0346764)

HSP 1 Score: 80.4925 bits (197), Expect = 1.800e-17
Identity = 34/57 (59.65%), Postives = 47/57 (82.46%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR+PYS++Q + LE E++   Y+S+QKRW++A  L L+ERQ+KIWFQNRRMK+KK
Sbjct:  165 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of HoxC12-like protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083381)

HSP 1 Score: 80.1073 bits (196), Expect = 1.964e-17
Identity = 34/57 (59.65%), Postives = 47/57 (82.46%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR+PYS++Q + LE E++   Y+S+QKRW++A  L L+ERQ+KIWFQNRRMK+KK
Sbjct:  165 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of HoxC12-like protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083382)

HSP 1 Score: 80.1073 bits (196), Expect = 1.964e-17
Identity = 34/57 (59.65%), Postives = 47/57 (82.46%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR+PYS++Q + LE E++   Y+S+QKRW++A  L L+ERQ+KIWFQNRRMK+KK
Sbjct:  165 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of HoxC12-like protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0415465)

HSP 1 Score: 80.1073 bits (196), Expect = 1.964e-17
Identity = 34/57 (59.65%), Postives = 47/57 (82.46%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR+PYS++Q + LE E++   Y+S+QKRW++A  L L+ERQ+KIWFQNRRMK+KK
Sbjct:  165 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of HoxC12-like protein vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083385)

HSP 1 Score: 80.1073 bits (196), Expect = 1.964e-17
Identity = 34/57 (59.65%), Postives = 47/57 (82.46%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR+PYS++Q + LE E++   Y+S+QKRW++A  L L+ERQ+KIWFQNRRMK+KK
Sbjct:  165 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of HoxC12-like protein vs. Ensembl Zebrafish
Match: hoxd9a (homeobox D9a [Source:NCBI gene;Acc:30350])

HSP 1 Score: 78.1814 bits (191), Expect = 1.401e-16
Identity = 46/108 (42.59%), Postives = 66/108 (61.11%), Query Frame = 1
Query:  382 SADKFVSENLPSSCPNSNKSVEKEEKDQKE----------------RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            SADK   E + S   NS+    K+EK Q++                R KR PY++YQ + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK N+E+
Sbjct:  152 SADKATEERVGSD--NSSHGEPKDEKQQQQLDPSNPAANWIHARSTRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNRER 257          
BLAST of HoxC12-like protein vs. Ensembl Zebrafish
Match: hoxc12a (homeobox C12a [Source:ZFIN;Acc:ZDB-GENE-000822-6])

HSP 1 Score: 75.485 bits (184), Expect = 1.524e-15
Identity = 32/59 (54.24%), Postives = 48/59 (81.36%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PYS+ QL  LE E++  E+I+RQ+R +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  205 RTRKKRKPYSKLQLAELEGEFMLNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 263          
BLAST of HoxC12-like protein vs. Ensembl Zebrafish
Match: hoxc12b (homeobox C12b [Source:NCBI gene;Acc:58062])

HSP 1 Score: 74.7146 bits (182), Expect = 2.588e-15
Identity = 32/60 (53.33%), Postives = 49/60 (81.67%), Query Frame = 1
Query:  463 QKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            ++ R KR+PYS+ QL  LE E+I  E+I+RQ+R +++ +LNL+++Q+KIWFQNRRMK K+
Sbjct:  213 RQTRKKRKPYSKLQLNELEGEFILNEFITRQRRRELSDRLNLTDQQVKIWFQNRRMKKKR 272          
BLAST of HoxC12-like protein vs. Ensembl Zebrafish
Match: hoxa9a (homeobox A9a [Source:NCBI gene;Acc:58047])

HSP 1 Score: 74.3294 bits (181), Expect = 3.042e-15
Identity = 31/57 (54.39%), Postives = 46/57 (80.70%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR PY+++Q++ LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK
Sbjct:  185 RKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKK 241          
BLAST of HoxC12-like protein vs. Ensembl Zebrafish
Match: hoxa9a (homeobox A9a [Source:NCBI gene;Acc:58047])

HSP 1 Score: 74.3294 bits (181), Expect = 3.042e-15
Identity = 31/57 (54.39%), Postives = 46/57 (80.70%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR PY+++Q++ LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK
Sbjct:  185 RKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKK 241          
BLAST of HoxC12-like protein vs. Ensembl Xenopus
Match: irs1 (insulin receptor substrate 1 [Source:Xenbase;Acc:XB-GENE-478672])

HSP 1 Score: 75.0998 bits (183), Expect = 2.865e-15
Identity = 38/88 (43.18%), Postives = 54/88 (61.36%), Query Frame = 1
Query:  379 SSADKFVSENLPSSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            S+ DK V+ +     P+           Q+ R KR PYS+YQ+  LE E+    YI+++KR  ++  LNL++RQ+KIWFQNRRMK KK
Sbjct:  172 STQDKKVTNDSSPGTPSGEAEKSNSSASQRLRKKRCPYSKYQIRELEREFFFNVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKK 259          
BLAST of HoxC12-like protein vs. Ensembl Xenopus
Match: ache (acetylcholinesterase (Cartwright blood group) [Source:Xenbase;Acc:XB-GENE-923160])

HSP 1 Score: 73.1738 bits (178), Expect = 1.025e-14
Identity = 35/62 (56.45%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            R KR PY++YQ + LE E++   Y++R +R ++A  LNLSERQ+KIWFQNRRMK KK NK++
Sbjct:  182 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKLNKDQ 243          
BLAST of HoxC12-like protein vs. Ensembl Xenopus
Match: syt8 (synaptotagmin 8 [Source:Xenbase;Acc:XB-GENE-978920])

HSP 1 Score: 73.1738 bits (178), Expect = 1.031e-14
Identity = 31/59 (52.54%), Postives = 48/59 (81.36%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PYS+ QL  LE E++  E+I+RQ+R +++ +L+LS++Q+KIWFQNRRMK K+
Sbjct:  194 RSRKKRKPYSKIQLAELEGEFMVNEFITRQRRRELSDRLSLSDQQVKIWFQNRRMKKKR 252          
BLAST of HoxC12-like protein vs. Ensembl Xenopus
Match: ENSXETT00000012532.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:32900780:32902234:1 gene:ENSXETG00000005181.1 transcript:ENSXETT00000012532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 1.838e-14
Identity = 33/62 (53.23%), Postives = 49/62 (79.03%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            R KR PY+++Q + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK NK++
Sbjct:  196 RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDR 257          
BLAST of HoxC12-like protein vs. Ensembl Xenopus
Match: hoxc8 (homeobox C8 [Source:NCBI gene;Acc:448482])

HSP 1 Score: 72.0182 bits (175), Expect = 2.213e-14
Identity = 33/65 (50.77%), Postives = 47/65 (72.31%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK*TLP 666
            R+ R+ YSRYQ + LE E++   Y++R++R +++  L L+ERQ+KIWFQNRRMK KK   K  LP
Sbjct:  150 RSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLP 214          
BLAST of HoxC12-like protein vs. Ensembl Mouse
Match: Hoxc12 (homeobox C12 [Source:MGI Symbol;Acc:MGI:96194])

HSP 1 Score: 76.6406 bits (187), Expect = 6.372e-16
Identity = 32/59 (54.24%), Postives = 48/59 (81.36%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PYS+ QL  LE E++  E+I+RQ+R +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  211 RSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 269          
BLAST of HoxC12-like protein vs. Ensembl Mouse
Match: Hoxb9 (homeobox B9 [Source:MGI Symbol;Acc:MGI:96190])

HSP 1 Score: 74.3294 bits (181), Expect = 2.637e-15
Identity = 36/62 (58.06%), Postives = 48/62 (77.42%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            R KR PY++YQ + LE E++   Y++R +R ++A  LNLSERQ+KIWFQNRRMK KK NKE+
Sbjct:  186 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQ 247          
BLAST of HoxC12-like protein vs. Ensembl Mouse
Match: Hoxd12 (homeobox D12 [Source:MGI Symbol;Acc:MGI:96204])

HSP 1 Score: 74.7146 bits (182), Expect = 2.740e-15
Identity = 31/59 (52.54%), Postives = 49/59 (83.05%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PY++ Q+  LE+E++  E+I+RQKR +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  199 RARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKR 257          
BLAST of HoxC12-like protein vs. Ensembl Mouse
Match: Hoxa9 (homeobox A9 [Source:MGI Symbol;Acc:MGI:96180])

HSP 1 Score: 72.7886 bits (177), Expect = 1.421e-14
Identity = 33/62 (53.23%), Postives = 49/62 (79.03%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            R KR PY+++Q + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK NK++
Sbjct:  206 RKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKINKDR 267          
BLAST of HoxC12-like protein vs. Ensembl Mouse
Match: Hoxc8 (homeobox C8 [Source:MGI Symbol;Acc:MGI:96198])

HSP 1 Score: 72.4034 bits (176), Expect = 1.444e-14
Identity = 33/65 (50.77%), Postives = 47/65 (72.31%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK*TLP 666
            R+ R+ YSRYQ + LE E++   Y++R++R +++  L L+ERQ+KIWFQNRRMK KK   K  LP
Sbjct:  150 RSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLP 214          
BLAST of HoxC12-like protein vs. UniProt/SwissProt
Match: sp|P09087|ABDB_DROME (Homeobox protein abdominal-B OS=Drosophila melanogaster OX=7227 GN=Abd-B PE=1 SV=3)

HSP 1 Score: 81.6481 bits (200), Expect = 3.104e-16
Identity = 34/57 (59.65%), Postives = 47/57 (82.46%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR+PYS++Q + LE E++   Y+S+QKRW++A  L L+ERQ+KIWFQNRRMK+KK
Sbjct:  388 RKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444          
BLAST of HoxC12-like protein vs. UniProt/SwissProt
Match: sp|Q9PWM6|HXD9A_DANRE (Homeobox protein Hox-D9a OS=Danio rerio OX=7955 GN=hoxd9a PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 1.058e-15
Identity = 46/108 (42.59%), Postives = 66/108 (61.11%), Query Frame = 1
Query:  382 SADKFVSENLPSSCPNSNKSVEKEEKDQKE----------------RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            SADK   E + S   NS+    K+EK Q++                R KR PY++YQ + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK N+E+
Sbjct:  152 SADKATEERVGSD--NSSHGEPKDEKQQQQLDPSNPAANWIHARSTRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNRER 257          
BLAST of HoxC12-like protein vs. UniProt/SwissProt
Match: sp|P31275|HXC12_HUMAN (Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 2.894e-15
Identity = 32/61 (52.46%), Postives = 49/61 (80.33%), Query Frame = 1
Query:  460 DQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + + R KR+PYS+ QL  LE E++  E+I+RQ+R +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  211 NSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 271          
BLAST of HoxC12-like protein vs. UniProt/SwissProt
Match: sp|Q8K5B8|HXC12_MOUSE (Homeobox protein Hox-C12 OS=Mus musculus OX=10090 GN=Hoxc12 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.457e-15
Identity = 32/59 (54.24%), Postives = 48/59 (81.36%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PYS+ QL  LE E++  E+I+RQ+R +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  211 RSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 269          
BLAST of HoxC12-like protein vs. UniProt/SwissProt
Match: sp|P48590|FTZ_DROHY (Segmentation protein fushi tarazu OS=Drosophila hydei OX=7224 GN=ftz PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.848e-15
Identity = 41/71 (57.75%), Postives = 53/71 (74.65%), Query Frame = 1
Query:  436 KSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNK 648
            +++  + KD K RT R+ YSRYQ + LE E+    YI+R++R DIA  LNLSERQIKIWFQNRRMK KK++
Sbjct:  274 ETIASDCKDSK-RT-RQTYSRYQTLELEKEFHFNRYITRRRRMDIAHALNLSERQIKIWFQNRRMKSKKDR 342          
BLAST of HoxC12-like protein vs. TrEMBL
Match: A0A165FWV6 (HoxC12-like protein OS=Schmidtea mediterranea OX=79327 GN=hoxC12 PE=2 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 2.620e-115
Identity = 163/163 (100.00%), Postives = 163/163 (100.00%), Query Frame = 1
Query:  166 MIHDNDNYIYHHNWAPESPIYTPQYEWHPLGPIKESISGFPDYIPHVKESFHSSFNHLSFRYPQAIQPVSLSSADKFVSENLPSSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 654
            MIHDNDNYIYHHNWAPESPIYTPQYEWHPLGPIKESISGFPDYIPHVKESFHSSFNHLSFRYPQAIQPVSLSSADKFVSENLPSSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK
Sbjct:    1 MIHDNDNYIYHHNWAPESPIYTPQYEWHPLGPIKESISGFPDYIPHVKESFHSSFNHLSFRYPQAIQPVSLSSADKFVSENLPSSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 163          
BLAST of HoxC12-like protein vs. TrEMBL
Match: Q9BLF9 (Hox class homeodomain protein DjAbd-Ba OS=Dugesia japonica OX=6161 GN=DjAbd-Ba PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 7.549e-26
Identity = 55/104 (52.88%), Postives = 71/104 (68.27%), Query Frame = 1
Query:  343 FRYPQAIQPVSLSSADKFVSENLPSSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 654
            +R PQ     + +S     + N+ S+  +  KS  K  +  K R KR+PYSRYQ M+LESEY+   YI+RQKRW+IACKL+LSERQIK+WFQNRRMK KK K +
Sbjct:  152 YRLPQTATSTAANSQSDSGNSNICSTTKSITKSENKSSETVKTRKKRKPYSRYQTMILESEYVGNTYITRQKRWEIACKLHLSERQIKVWFQNRRMKTKKIKNR 255          
BLAST of HoxC12-like protein vs. TrEMBL
Match: B6RFY1 (Post2 hox protein OS=Capitella teleta OX=283909 PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.352e-25
Identity = 65/146 (44.52%), Postives = 92/146 (63.01%), Query Frame = 1
Query:  238 YEWHPLG--PIKESISGFPDYIPHVKESFH--SSFNHLSFRYPQAIQPV-SLSSADKFVSENLP--SSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 654
            ++ +PL   P   +I+ FP Y P V   +H  +S NH +         + S+ S  +F S+ +P  +  PNS     +     K+R KR+PY+RYQ MVLE+E+IN  YI+RQKRW+I+CKL+LSERQ+K+WFQNRRMK KK  E+
Sbjct:  122 HQLNPLNSLPPPRNIANFPFYSPEV---YHQAASANHGAMSGAGLFSDIPSIPSMTRFDSDGVPPYAVDPNS-----QNPDAPKQRKKRKPYTRYQTMVLENEFINNSYITRQKRWEISCKLHLSERQVKVWFQNRRMKRKKLNER 259          
BLAST of HoxC12-like protein vs. TrEMBL
Match: R7UM68 (Post2 hox protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_126009 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 9.468e-23
Identity = 44/63 (69.84%), Postives = 56/63 (88.89%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 654
            K+R KR+PY+RYQ MVLE+E+IN  YI+RQKRW+I+CKL+LSERQ+K+WFQNRRMK KK  E+
Sbjct:    5 KQRKKRKPYTRYQTMVLENEFINNSYITRQKRWEISCKLHLSERQVKVWFQNRRMKRKKLNER 67          
BLAST of HoxC12-like protein vs. TrEMBL
Match: A0A4D6QJT8 (Post2 OS=Acanthochitona rubrolineata OX=761904 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.712e-23
Identity = 44/74 (59.46%), Postives = 59/74 (79.73%), Query Frame = 1
Query:  433 NKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 654
            N  V+   ++ K R KR+PY+RYQ MVLE+E++N  YI+RQKRW+I+CKL L+ERQ+K+WFQNRRMK KK  E+
Sbjct:  163 NGQVDGGTQEPKGRKKRKPYTRYQTMVLENEFLNNSYITRQKRWEISCKLQLTERQVKVWFQNRRMKRKKLNER 236          
BLAST of HoxC12-like protein vs. Ensembl Cavefish
Match: hoxc12a (homeobox protein Hox-C12a-like [Source:NCBI gene;Acc:103031159])

HSP 1 Score: 76.2554 bits (186), Expect = 7.246e-16
Identity = 32/59 (54.24%), Postives = 48/59 (81.36%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PYS+ QL  LE E++  E+I+RQ+R +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  208 RTRKKRKPYSKLQLAELEGEFMMNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 266          
BLAST of HoxC12-like protein vs. Ensembl Cavefish
Match: hoxd9a (homeobox protein Hox-D9a [Source:NCBI gene;Acc:103033248])

HSP 1 Score: 74.7146 bits (182), Expect = 2.102e-15
Identity = 34/62 (54.84%), Postives = 49/62 (79.03%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            R KR PY++YQ + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK N+E+
Sbjct:  196 RKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNRER 257          
BLAST of HoxC12-like protein vs. Ensembl Cavefish
Match: hoxd9a (homeobox protein Hox-D9a [Source:NCBI gene;Acc:103033248])

HSP 1 Score: 74.7146 bits (182), Expect = 2.102e-15
Identity = 34/62 (54.84%), Postives = 49/62 (79.03%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK-NKEK 654
            R KR PY++YQ + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK N+E+
Sbjct:  196 RKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMNRER 257          
BLAST of HoxC12-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000005320.2 (homeobox protein Hox-A9a-like [Source:NCBI gene;Acc:103022020])

HSP 1 Score: 73.9442 bits (180), Expect = 3.562e-15
Identity = 31/57 (54.39%), Postives = 46/57 (80.70%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR PY+++Q++ LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK
Sbjct:  192 RKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKK 248          
BLAST of HoxC12-like protein vs. Ensembl Cavefish
Match: hoxd12a (homeobox protein Hox-D12a-like [Source:NCBI gene;Acc:103047027])

HSP 1 Score: 73.559 bits (179), Expect = 4.620e-15
Identity = 32/59 (54.24%), Postives = 49/59 (83.05%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PY++ QL  LE+E++  E+I+RQKR +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  192 RARKKRKPYTKPQLAELENEFMINEFINRQKRKELSDRLNLSDQQVKIWFQNRRMKKKR 250          
BLAST of HoxC12-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011221.1 (pep scaffold:Pmarinus_7.0:GL477881:55654:55833:1 gene:ENSPMAG00000010194.1 transcript:ENSPMAT00000011221.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 3.648e-15
Identity = 30/57 (52.63%), Postives = 45/57 (78.95%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR PY++YQ + LE E++   Y++R++R +I+  +NL++RQ+KIWFQNRRMK KK
Sbjct:    2 RKKRCPYTKYQTLELEKEFLFNMYLTRERRLEISRGVNLTDRQVKIWFQNRRMKLKK 58          
BLAST of HoxC12-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011242.1 (pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-1 gene:ENSPMAG00000010215.1 transcript:ENSPMAT00000011242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 9.998e-15
Identity = 33/59 (55.93%), Postives = 45/59 (76.27%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNK 648
            R KR PYS+ Q + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK K
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRMKLKKMK 60          
BLAST of HoxC12-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011060.1 (pep scaffold:Pmarinus_7.0:GL482503:5543:5722:1 gene:ENSPMAG00000010033.1 transcript:ENSPMAT00000011060.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 9.998e-15
Identity = 33/59 (55.93%), Postives = 45/59 (76.27%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNK 648
            R KR PYS+ Q + LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK K
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRMKLKKMK 60          
BLAST of HoxC12-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005057.1 (pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 gene:ENSPMAG00000004598.1 transcript:ENSPMAT00000005057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 3.111e-14
Identity = 32/65 (49.23%), Postives = 45/65 (69.23%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK*TLP 666
            R  R+ YSRYQ + LE E++   Y++R++R +++  L LSERQ+KIWFQNRRMK KK   +   P
Sbjct:   28 RRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHVLGLSERQVKIWFQNRRMKWKKENNRDKFP 92          
BLAST of HoxC12-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011449.1 (pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gene:ENSPMAG00000010422.1 transcript:ENSPMAT00000011449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 4.250e-14
Identity = 29/57 (50.88%), Postives = 46/57 (80.70%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR PY+++Q + LE E++ + Y++R++R +I+  L+L++RQ+KIWFQNRRMK KK
Sbjct:    2 RKKRCPYTKHQTLELEKEFLFSMYLTRERRLEISHLLSLTDRQVKIWFQNRRMKLKK 58          
BLAST of HoxC12-like protein vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 44.669 bits (104), Expect = 7.029e-6
Identity = 20/59 (33.90%), Postives = 38/59 (64.41%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNK 648
            R KRR  S  +L +L++E+      S++KR ++A   +++E+ ++IWFQN+R   K+ +
Sbjct:  177 RRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQR 235          
BLAST of HoxC12-like protein vs. Ensembl Nematostella
Match: MOXC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR27])

HSP 1 Score: 67.3958 bits (163), Expect = 1.148e-14
Identity = 31/72 (43.06%), Postives = 49/72 (68.06%), Query Frame = 1
Query:  433 NKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNK 648
            N+    E+   ++R +R  +S+YQL  LE E+    Y++R +R++IA  L+L ERQ+K+WFQNRRMK K+ +
Sbjct:    2 NEMERNEDAKSRKRKERTVFSKYQLTELEREFCRNNYLTRLRRYEIAVSLDLGERQVKVWFQNRRMKWKRGR 73          
BLAST of HoxC12-like protein vs. Ensembl Nematostella
Match: MOXB (MoxB; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR28])

HSP 1 Score: 65.0846 bits (157), Expect = 1.190e-13
Identity = 29/63 (46.03%), Postives = 48/63 (76.19%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 654
            K+R +R  ++++Q+  LE+E+    Y++R +R++IA  L+L+ERQ+K+WFQNRRMK K+ K K
Sbjct:   15 KKRKERTAFTKHQIQELENEFQRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKRVKGK 77          
BLAST of HoxC12-like protein vs. Ensembl Nematostella
Match: ANTHOX1A.NV (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM8])

HSP 1 Score: 65.0846 bits (157), Expect = 3.218e-13
Identity = 30/56 (53.57%), Postives = 44/56 (78.57%), Query Frame = 1
Query:  478 KRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKN 645
            KR  Y+R QL+ LE E+  T Y+++++R ++A  L+L+ERQ+KIWFQNRRMK KK+
Sbjct:   82 KRMAYTRIQLLELEKEFHFTRYLTKERRTEMARMLDLTERQVKIWFQNRRMKWKKD 137          
BLAST of HoxC12-like protein vs. Ensembl Nematostella
Match: EDO33847 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR26])

HSP 1 Score: 61.2326 bits (147), Expect = 1.015e-12
Identity = 27/50 (54.00%), Postives = 40/50 (80.00%), Query Frame = 1
Query:  499 YQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNK 648
            +QL  LE+E+I   Y++R +R++IA  L+L+ERQ+K+WFQNRRMK K+ K
Sbjct:    1 HQLQELENEFIRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKRVK 50          
BLAST of HoxC12-like protein vs. Ensembl Nematostella
Match: HOX2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS10])

HSP 1 Score: 63.929 bits (154), Expect = 2.284e-12
Identity = 30/57 (52.63%), Postives = 41/57 (71.93%), Query Frame = 1
Query:  481 RRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKE 651
            R  Y+  QL+ LE E+    Y+SR +R  IA  L+LSE+Q+KIWFQNRR+K KK+K+
Sbjct:  127 RTAYTSMQLLELEKEFSQNRYLSRLRRIQIAALLDLSEKQVKIWFQNRRVKWKKDKK 183          
BLAST of HoxC12-like protein vs. Ensembl Medaka
Match: hoxc12a (homeobox protein Hox-C12a [Source:NCBI gene;Acc:101173058])

HSP 1 Score: 75.485 bits (184), Expect = 1.192e-15
Identity = 32/59 (54.24%), Postives = 48/59 (81.36%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PYS+ QL  LE E++  E+I+RQ+R +++ +LNLS++Q+KIWFQNRRMK K+
Sbjct:  203 RTRKKRKPYSKLQLAELEGEFMLNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 261          
BLAST of HoxC12-like protein vs. Ensembl Medaka
Match: hoxa9 (homeobox A9 [Source:NCBI gene;Acc:100049208])

HSP 1 Score: 74.3294 bits (181), Expect = 2.353e-15
Identity = 31/57 (54.39%), Postives = 46/57 (80.70%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR PY+++Q++ LE E++   Y++R +R+++A  LNL+ERQ+KIWFQNRRMK KK
Sbjct:  197 RKKRCPYTKHQILELEKEFLFNTYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKK 253          
BLAST of HoxC12-like protein vs. Ensembl Medaka
Match: hoxd12a (homeobox D12 [Source:NCBI gene;Acc:101162794])

HSP 1 Score: 74.3294 bits (181), Expect = 2.542e-15
Identity = 33/59 (55.93%), Postives = 49/59 (83.05%), Query Frame = 1
Query:  466 KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            + R KR+PYS+ QL  LE+E++  E+I+RQKR +++ KL+LS++Q+KIWFQNRRMK K+
Sbjct:  186 RSRKKRKPYSKPQLAELENEFLMNEFINRQKRKELSDKLDLSDQQVKIWFQNRRMKKKR 244          
BLAST of HoxC12-like protein vs. Ensembl Medaka
Match: hoxa11b (homeobox protein Hox-A11b [Source:NCBI gene;Acc:101158794])

HSP 1 Score: 74.3294 bits (181), Expect = 3.194e-15
Identity = 43/115 (37.39%), Postives = 62/115 (53.91%), Query Frame = 1
Query:  316 FHSSFNHLSFRYPQAIQPVSLSSADKFVSENLPSSCPNSNKSVEKEEKDQ------KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            F  ++       P+A +    S A      +   SC   + S   EEK        + R KR PYS+YQ+  LE E+  + YI+++KR  ++  LNL++RQ+KIWFQNRRMK KK
Sbjct:  138 FDPAYGSAEGSVPEADRHSRTSPAPAHAGSDSAESCSPKSSSGNSEEKQTSSGSVPRTRKKRCPYSKYQIRELEREFFFSVYINKEKRMQLSRMLNLTDRQVKIWFQNRRMKEKK 252          
BLAST of HoxC12-like protein vs. Ensembl Medaka
Match: hoxb9a (homeobox B9 [Source:NCBI gene;Acc:100049206])

HSP 1 Score: 73.9442 bits (180), Expect = 5.280e-15
Identity = 32/57 (56.14%), Postives = 44/57 (77.19%), Query Frame = 1
Query:  472 RTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            R KR PY++YQ + LE E++   Y++R +R ++A  LNL+ERQ+KIWFQNRRMK KK
Sbjct:  218 RKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARALNLTERQVKIWFQNRRMKMKK 274          
BLAST of HoxC12-like protein vs. Planmine SMEST
Match: SMESG000022668.1 (SMESG000022668.1)

HSP 1 Score: 330.872 bits (847), Expect = 1.989e-116
Identity = 160/163 (98.16%), Postives = 161/163 (98.77%), Query Frame = 1
Query:  166 MIHDNDNYIYHHNWAPESPIYTPQYEWHPLGPIKESISGFPDYIPHVKESFHSSFNHLSFRYPQAIQPVSLSSADKFVSENLPSSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 654
            MIHDNDNYIYHHNWAPESPIYTPQYEWHPLGPIKESISGFPDYIPHVKESFH SFN+LSFRYPQAIQPVSLSSADKF SENLPSSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK
Sbjct:    1 MIHDNDNYIYHHNWAPESPIYTPQYEWHPLGPIKESISGFPDYIPHVKESFHPSFNNLSFRYPQAIQPVSLSSADKFASENLPSSCPNSNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK 163          
BLAST of HoxC12-like protein vs. Planmine SMEST
Match: SMESG000033048.1 (SMESG000033048.1)

HSP 1 Score: 99.7525 bits (247), Expect = 7.300e-24
Identity = 42/63 (66.67%), Postives = 53/63 (84.13%), Query Frame = 1
Query:  454 EKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 642
            E + + R KR+PY+RYQ MVLESE+    YI+RQKRW+I+CKL+LSERQ+K+WFQNRRMK KK
Sbjct:  321 EAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 383          
BLAST of HoxC12-like protein vs. Planmine SMEST
Match: SMESG000054107.1 (SMESG000054107.1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.110e-22
Identity = 44/70 (62.86%), Postives = 57/70 (81.43%), Query Frame = 1
Query:  430 SNKSVEKE---EKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRM 630
            +N  +E+E   E D + R KR+PY+RYQ +VLESE+ +  YI+RQKRW+I+CKLNLSERQIK+WFQNRRM
Sbjct:  225 NNPMMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRM 294          
BLAST of HoxC12-like protein vs. Planmine SMEST
Match: SMESG000025656.1 (SMESG000025656.1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.330e-14
Identity = 35/77 (45.45%), Postives = 52/77 (67.53%), Query Frame = 1
Query:  481 RRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKNKEK*TLPRILCR*LPITANPII 711
            R  +S+ QL+ LE E+I+T Y+ R  R  +A KLNL E+QIK+WFQNRRMK K+++ +    + L   LP ++N I+
Sbjct:   97 RTTFSQSQLLELEKEFIHTAYLDRANRISLAGKLNLKEKQIKVWFQNRRMKRKRDESEQKRRKSLNENLPDSSNTIV 173          
BLAST of HoxC12-like protein vs. Planmine SMEST
Match: SMESG000044469.1 (SMESG000044469.1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.982e-14
Identity = 34/72 (47.22%), Postives = 50/72 (69.44%), Query Frame = 1
Query:  430 SNKSVEKEEKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKKN 645
            SN    K ++  + +  R+ YSR Q + LE E+   +Y++R++R +IA  + LSERQIKIWFQNRRMK+KK+
Sbjct:   92 SNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKYKKD 163          
The following BLAST results are available for this feature:
BLAST of HoxC12-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXC126.026e-1652.46homeobox C12 [Source:HGNC Symbol;Acc:HGNC:5124][more]
HOXD123.492e-1552.54homeobox D12 [Source:HGNC Symbol;Acc:HGNC:5135][more]
HOXB94.243e-1558.06homeobox B9 [Source:HGNC Symbol;Acc:HGNC:5120][more]
AC004080.31.053e-1453.23HOXA10-HOXA9 readthrough[more]
HOXA91.401e-1453.23homeobox A9 [Source:HGNC Symbol;Acc:HGNC:5109][more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
php-33.874e-1844.94Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
php-33.874e-1844.94Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
lin-395.031e-1545.68Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
lin-395.031e-1545.68Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
mab-55.684e-1350.00Homeobox protein mab-5 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abd-B1.800e-1759.65gene:FBgn0000015 transcript:FBtr0346764[more]
Abd-B1.964e-1759.65gene:FBgn0000015 transcript:FBtr0083381[more]
Abd-B1.964e-1759.65gene:FBgn0000015 transcript:FBtr0083382[more]
Abd-B1.964e-1759.65gene:FBgn0000015 transcript:FBtr0415465[more]
Abd-B1.964e-1759.65gene:FBgn0000015 transcript:FBtr0083385[more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd9a1.401e-1642.59homeobox D9a [Source:NCBI gene;Acc:30350][more]
hoxc12a1.524e-1554.24homeobox C12a [Source:ZFIN;Acc:ZDB-GENE-000822-6][more]
hoxc12b2.588e-1553.33homeobox C12b [Source:NCBI gene;Acc:58062][more]
hoxa9a3.042e-1554.39homeobox A9a [Source:NCBI gene;Acc:58047][more]
hoxa9a3.042e-1554.39homeobox A9a [Source:NCBI gene;Acc:58047][more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
irs12.865e-1543.18insulin receptor substrate 1 [Source:Xenbase;Acc:X... [more]
ache1.025e-1456.45acetylcholinesterase (Cartwright blood group) [Sou... [more]
syt81.031e-1452.54synaptotagmin 8 [Source:Xenbase;Acc:XB-GENE-978920... [more]
ENSXETT00000012532.11.838e-1453.23pep primary_assembly:Xenopus_tropicalis_v9.1:6:329... [more]
hoxc82.213e-1450.77homeobox C8 [Source:NCBI gene;Acc:448482][more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxc126.372e-1654.24homeobox C12 [Source:MGI Symbol;Acc:MGI:96194][more]
Hoxb92.637e-1558.06homeobox B9 [Source:MGI Symbol;Acc:MGI:96190][more]
Hoxd122.740e-1552.54homeobox D12 [Source:MGI Symbol;Acc:MGI:96204][more]
Hoxa91.421e-1453.23homeobox A9 [Source:MGI Symbol;Acc:MGI:96180][more]
Hoxc81.444e-1450.77homeobox C8 [Source:MGI Symbol;Acc:MGI:96198][more]
back to top
BLAST of HoxC12-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09087|ABDB_DROME3.104e-1659.65Homeobox protein abdominal-B OS=Drosophila melanog... [more]
sp|Q9PWM6|HXD9A_DANRE1.058e-1542.59Homeobox protein Hox-D9a OS=Danio rerio OX=7955 GN... [more]
sp|P31275|HXC12_HUMAN2.894e-1552.46Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 G... [more]
sp|Q8K5B8|HXC12_MOUSE4.457e-1554.24Homeobox protein Hox-C12 OS=Mus musculus OX=10090 ... [more]
sp|P48590|FTZ_DROHY4.848e-1557.75Segmentation protein fushi tarazu OS=Drosophila hy... [more]
back to top
BLAST of HoxC12-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A165FWV62.620e-115100.00HoxC12-like protein OS=Schmidtea mediterranea OX=7... [more]
Q9BLF97.549e-2652.88Hox class homeodomain protein DjAbd-Ba OS=Dugesia ... [more]
B6RFY13.352e-2544.52Post2 hox protein OS=Capitella teleta OX=283909 PE... [more]
R7UM689.468e-2369.84Post2 hox protein (Fragment) OS=Capitella teleta O... [more]
A0A4D6QJT89.712e-2359.46Post2 OS=Acanthochitona rubrolineata OX=761904 PE=... [more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxc12a7.246e-1654.24homeobox protein Hox-C12a-like [Source:NCBI gene;A... [more]
hoxd9a2.102e-1554.84homeobox protein Hox-D9a [Source:NCBI gene;Acc:103... [more]
hoxd9a2.102e-1554.84homeobox protein Hox-D9a [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000005320.23.562e-1554.39homeobox protein Hox-A9a-like [Source:NCBI gene;Ac... [more]
hoxd12a4.620e-1554.24homeobox protein Hox-D12a-like [Source:NCBI gene;A... [more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011221.13.648e-1552.63pep scaffold:Pmarinus_7.0:GL477881:55654:55833:1 g... [more]
ENSPMAT00000011242.19.998e-1555.93pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-... [more]
ENSPMAT00000011060.19.998e-1555.93pep scaffold:Pmarinus_7.0:GL482503:5543:5722:1 gen... [more]
ENSPMAT00000005057.13.111e-1449.23pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 g... [more]
ENSPMAT00000011449.14.250e-1450.88pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gen... [more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOX17.029e-633.90Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
MOXC1.148e-1443.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
MOXB1.190e-1346.03MoxB; Predicted protein [Source:UniProtKB/TrEMBL;... [more]
ANTHOX1A.NV3.218e-1353.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338471.015e-1254.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HOX22.284e-1252.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HoxC12-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxc12a1.192e-1554.24homeobox protein Hox-C12a [Source:NCBI gene;Acc:10... [more]
hoxa92.353e-1554.39homeobox A9 [Source:NCBI gene;Acc:100049208][more]
hoxd12a2.542e-1555.93homeobox D12 [Source:NCBI gene;Acc:101162794][more]
hoxa11b3.194e-1537.39homeobox protein Hox-A11b [Source:NCBI gene;Acc:10... [more]
hoxb9a5.280e-1556.14homeobox B9 [Source:NCBI gene;Acc:100049206][more]
back to top
BLAST of HoxC12-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022668.11.989e-11698.16SMESG000022668.1[more]
SMESG000033048.17.300e-2466.67SMESG000033048.1[more]
SMESG000054107.14.110e-2262.86SMESG000054107.1[more]
SMESG000025656.11.330e-1445.45SMESG000025656.1[more]
SMESG000044469.14.982e-1447.22SMESG000044469.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000303 ID=SMED30000303|Name=HoxC12-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=806bp
TATATTCCACAACTGTGCAGTTTGCGATCTGTATTGCAATAGATATTGGA
ATCGACTGACGGAAGTACTCCATTCTTTCTCGCTGCAACTGGATTTTGAA
GCTGTGGAGCATTTCAGTTTTGAGCATCGATTGGAAGCTGGAAAACTAAA
AAAAGGTTCACTATTATGATTCATGATAACGACAACTACATTTACCATCA
TAATTGGGCCCCCGAATCACCGATTTACACTCCCCAGTACGAATGGCATC
CTCTGGGTCCAATCAAAGAATCTATCAGCGGGTTCCCAGACTACATCCCA
CATGTCAAGGAATCCTTCCATTCGTCATTCAATCATCTGTCATTCAGATA
TCCCCAAGCAATCCAACCGGTTAGTTTAAGTTCTGCTGACAAATTCGTAA
GTGAAAATTTACCGAGTTCTTGTCCGAATTCAAATAAATCAGTTGAAAAA
GAAGAGAAAGACCAAAAGGAAAGGACAAAACGACGTCCATACTCTCGATA
TCAGCTGATGGTGCTGGAAAGCGAATATATCAACACTGAATATATATCCA
GACAGAAACGGTGGGACATCGCCTGCAAGTTGAATTTATCAGAGCGCCAA
ATCAAAATATGGTTCCAGAATCGCCGGATGAAACATAAAAAGAATAAAGA
GAAATAAACCCTTCCTAGGATTTTGTGTCGATGATTGCCAATTACAGCAA
ACCCAATAATAAAATTCCTTTACTCCAAAAATATCAGTATATTATCAAGT
GCTGTGTGAATGTAATAAATAAATAAAAATAAATATTAACTAATTTTTTC
AGTGAC
back to top

protein sequence of SMED30000303-orf-1

>SMED30000303-orf-1 ID=SMED30000303-orf-1|Name=SMED30000303-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MIHDNDNYIYHHNWAPESPIYTPQYEWHPLGPIKESISGFPDYIPHVKES
FHSSFNHLSFRYPQAIQPVSLSSADKFVSENLPSSCPNSNKSVEKEEKDQ
KERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWF
QNRRMKHKKNKEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 149..158
score: 80.31
coord: 139..149
score: 63.83
coord: 124..135
score: 27.77
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 102..163
e-value: 8.0E-18
score: 75.2
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 103..159
e-value: 4.8E-20
score: 71.2
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 100..160
score: 19.24
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 103..161
e-value: 3.50895E-19
score: 74.202
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 90..163
e-value: 8.0E-24
score: 85.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 91..107
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 79..107
NoneNo IPR availablePANTHERPTHR45874FAMILY NOT NAMEDcoord: 62..162
NoneNo IPR availablePANTHERPTHR45874:SF4HOMEOBOX PROTEIN ABDOMINAL-Bcoord: 62..162
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 135..158
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 84..161