Transitional endoplasmic reticulum ATPase

Overview
NameTransitional endoplasmic reticulum ATPase
Smed IDSMED30000299
Length (bp)3135
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transitional endoplasmic reticulum ATPase (SMED30000299) t-SNE clustered cells

Violin plots show distribution of expression levels for Transitional endoplasmic reticulum ATPase (SMED30000299) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transitional endoplasmic reticulum ATPase (SMED30000299) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transitional endoplasmic reticulum ATPase (SMED30000299) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000299

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30000299SMESG000009924.1 dd_Smed_v4_482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000299SMESG000009924.1 dd_Smed_v4_482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: VCP (valosin containing protein [Source:HGNC Symbol;Acc:HGNC:12666])

HSP 1 Score: 1304.27 bits (3374), Expect = 0.000e+0
Identity = 648/758 (85.49%), Postives = 710/758 (93.67%), Query Frame = 3
Query:   78 ASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            A +K DDL TAIL+ K +PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSR+ ILKANLRKSP+AKDVD+ ++AK+T+GFSGADLTEICQRACK AIRE IE++IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    5 ADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: SPATA5 (spermatogenesis associated 5 [Source:HGNC Symbol;Acc:HGNC:18119])

HSP 1 Score: 516.538 bits (1329), Expect = 1.940e-167
Identity = 263/554 (47.47%), Postives = 380/554 (68.59%), Query Frame = 3
Query:  639 ADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLK---QRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM-RLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEI-DAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARD--QQLKGGEPMEDDIDPVPEITRKHFEE 2279
            + E +   +V YD IGG   QL  I+E++ELPL+ P+LFK+ G+  PRG+LLYGPPGTGKT+IARAVANE G++  +INGPEI+SK  GE+E+ LR+ F EA    P+IIFIDELDA+ PKRE    EVE+R+V+ LLTLMDG+        V+V+ ATNRP+++D ALRR GRFD+E++IG+P+   RL+IL+   + +  L  + +L Q+A+  HG+VGADL  LC EA L  +R  +     ++P + D ++   + +T++DF  A++   PSA+RE  ++VPNV+W DIGGL+ +K +L++ V++P++HP+ F++ G+ P KGVL YGPPGC KT++AKA+ANE   NF++IKGPEL+  + GESE  VR+ F KAR  AP ++FFDELD++A    GS    G  ADRV+ QLLTEMDG+   K+V I+ ATNRPD ID A++RPGR+D++IY+PLPD  +R +I K      P++ +VD++ +   T  +SGA++  +C+ A   A+ E I+A++   R   Q L    P       +PE  R+ +E+
Sbjct:  341 SKEQDNQFKVTYDMIGGLSSQLKAIREIIELPLKQPELFKSYGIPAPRGVLLYGPPGTGKTMIARAVANEVGAYVSVINGPEIISKFYGETEAKLRQIFAEATLRHPSIIFIDELDALCPKREGAQNEVEKRVVASLLTLMDGIGSEVSEGQVLVLGATNRPHALDAALRRPGRFDKEIEIGVPNAQDRLDILQKLLRRVPHLLTEAELLQLANSAHGYVGADLKVLCNEAGLCALRRILK----KQPNLPDVKVAGLVKITLKDFLQAMNDIRPSAMREIAIDVPNVSWSDIGGLESIKLKLEQAVEWPLKHPESFIRMGIQPPKGVLLYGPPGCSKTMIAKALANESGLNFLAIKGPELMNKYVGESERAVRETFRKARAVAPSIIFFDELDALA-VERGSSLGAGNVADRVLAQLLTEMDGIEQLKDVTILAATNRPDRIDKALMRPGRIDRIIYVPLPDAATRREIFKLQFHSMPVSNEVDLDELILQTDAYSGAEIVAVCREAALLALEEDIQANLIMKRHFTQALSTVTPR------IPESLRRFYED 883          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: NVL (nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070])

HSP 1 Score: 464.537 bits (1194), Expect = 1.391e-150
Identity = 267/616 (43.34%), Postives = 366/616 (59.42%), Query Frame = 3
Query:  654 KLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQ---RSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAAL------------QQIRNK------------------------------MDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKA---NLRKSPIAKDVDVNYMAK--VTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +++ V ++D+GG    L ++ +M+ + +RHP+++  +GV PPRG+LL+GPPG GKTL+A A+A E       +  PEI+S ++GESE  LR+ FE+A  N+P IIFIDE+DAI PKRE    ++ERRIV+QLLT MD L      + V+V+ ATNRP+S+DPALRR GRFDRE+ +GIPD   R  IL+   + +RL    D   +A  T G VGADL ALC EAA+            QQ +N                               + L+  ++P +  E +  L + + DF  ALS   PSA RE  V VPNVTW DIG L+ ++ EL   +  PV +PD+F   G+    GVL  GPPGCGKTLLAKA+ANE   NFIS+KGPELL M+ GESE  VR +F +A+ +APCV+FFDE+D++            GA+ RV+NQLLTEMDG+ A++ VFI+ ATNRPDIID AILRPGRLD+ +++ LP    R+ ILK    N  K P+  DV++  +A       ++GADL+ +        +RE     +R    +Q  G E  E       +++ KHFEEA K  R S++  D   YE   ++L
Sbjct:   61 QISNVKFEDVGGNDMTLKEVCKML-IHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCREAAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDP-LSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCP---RRSDRETGASVRVVNQLLTEMDGLEARQQVFIMAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIAGDLRCDCYTGADLSAL--------VREASICALRQEMARQKSGNEKGE------LKVSHKHFEEAFKKVRSSISKKDQIMYERLQESL 657          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: NVL (nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070])

HSP 1 Score: 465.307 bits (1196), Expect = 1.337e-149
Identity = 267/616 (43.34%), Postives = 366/616 (59.42%), Query Frame = 3
Query:  654 KLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQ---RSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAAL------------QQIRNK------------------------------MDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKA---NLRKSPIAKDVDVNYMAK--VTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +++ V ++D+GG    L ++ +M+ + +RHP+++  +GV PPRG+LL+GPPG GKTL+A A+A E       +  PEI+S ++GESE  LR+ FE+A  N+P IIFIDE+DAI PKRE    ++ERRIV+QLLT MD L      + V+V+ ATNRP+S+DPALRR GRFDRE+ +GIPD   R  IL+   + +RL    D   +A  T G VGADL ALC EAA+            QQ +N                               + L+  ++P +  E +  L + + DF  ALS   PSA RE  V VPNVTW DIG L+ ++ EL   +  PV +PD+F   G+    GVL  GPPGCGKTLLAKA+ANE   NFIS+KGPELL M+ GESE  VR +F +A+ +APCV+FFDE+D++            GA+ RV+NQLLTEMDG+ A++ VFI+ ATNRPDIID AILRPGRLD+ +++ LP    R+ ILK    N  K P+  DV++  +A       ++GADL+ +        +RE     +R    +Q  G E  E       +++ KHFEEA K  R S++  D   YE   ++L
Sbjct:  152 QISNVKFEDVGGNDMTLKEVCKML-IHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCREAAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDP-LSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCP---RRSDRETGASVRVVNQLLTEMDGLEARQQVFIMAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIAGDLRCDCYTGADLSAL--------VREASICALRQEMARQKSGNEKGE------LKVSHKHFEEAFKKVRSSISKKDQIMYERLQESL 748          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Match: NVL (nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070])

HSP 1 Score: 464.537 bits (1194), Expect = 3.296e-149
Identity = 267/616 (43.34%), Postives = 366/616 (59.42%), Query Frame = 3
Query:  654 KLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQ---RSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAAL------------QQIRNK------------------------------MDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKA---NLRKSPIAKDVDVNYMAK--VTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +++ V ++D+GG    L ++ +M+ + +RHP+++  +GV PPRG+LL+GPPG GKTL+A A+A E       +  PEI+S ++GESE  LR+ FE+A  N+P IIFIDE+DAI PKRE    ++ERRIV+QLLT MD L      + V+V+ ATNRP+S+DPALRR GRFDRE+ +GIPD   R  IL+   + +RL    D   +A  T G VGADL ALC EAA+            QQ +N                               + L+  ++P +  E +  L + + DF  ALS   PSA RE  V VPNVTW DIG L+ ++ EL   +  PV +PD+F   G+    GVL  GPPGCGKTLLAKA+ANE   NFIS+KGPELL M+ GESE  VR +F +A+ +APCV+FFDE+D++            GA+ RV+NQLLTEMDG+ A++ VFI+ ATNRPDIID AILRPGRLD+ +++ LP    R+ ILK    N  K P+  DV++  +A       ++GADL+ +        +RE     +R    +Q  G E  E       +++ KHFEEA K  R S++  D   YE   ++L
Sbjct:  167 QISNVKFEDVGGNDMTLKEVCKML-IHMRHPEVYHHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFEQAVSNAPCIIFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLTPGFVGADLMALCREAAMCAVNRVLMKLQEQQKKNPEMEDLPSKGVQEERLGTEPTSETQDELQRLLGLLRDQDP-LSEEQMQGLCIELNDFIVALSSVQPSAKREGFVTVPNVTWADIGALEDIREELTMAILAPVRNPDQFKALGLVTPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCP---RRSDRETGASVRVVNQLLTEMDGLEARQQVFIMAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRLAILKTITKNGTKPPLDADVNLEAIAGDLRCDCYTGADLSAL--------VREASICALRQEMARQKSGNEKGE------LKVSHKHFEEAFKKVRSSISKKDQIMYERLQESL 763          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: cdc-48.1 (Transitional endoplasmic reticulum ATPase homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P54811])

HSP 1 Score: 1225.69 bits (3170), Expect = 0.000e+0
Identity = 607/784 (77.42%), Postives = 702/784 (89.54%), Query Frame = 3
Query:   87 KNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXX-XXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAAR---DQQLKGGEPMEDD-IDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPG---ANETPSS 2414
            KND+L TAIL+ K KPNRLIV+    DDNSV+++SQ KMDEL LFRGD V+LKGKKR+E+V I + DE+CP+EK+RMNR VR NLR+RLGDV+S+ P PN++YG R+HVLPIDDTIEG+TGN+++VFLKPYF+EAYRP+ K D+F V+  MR VEFKV+ET+P+P CIV+P+T+IH+EGDP+ R +E+E +N++GYDD+GG RKQLAQIKEMVELPLRHPQLFKAIG+KPPRGILL+GPPGTGKTLIARAVANETGSFFFLINGPE+MSK++GESESNLRKAFEE EKN PAI+FIDE+DAIAPKREKT+GEVERRIVSQLLTLMDG+K RS+++V+AATNRPNSID ALRRFGRFDRE+DIGIPD  GRLEILRIHTKNM+L DDVDLEQ+A+E HG VGADLA+LC+EAALQQIR KM+LIDLE+ +IDAE+LNSLAVTME+FR+A  KS+PSALRE  VE PN TW DIGGLQ VKRELQELVQYPVEHP+K+LKFGM PS+GVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRD+FDKAR AAPCVLFFDELDSIAK+RGG  G  GG A  RVINQ+LTEMDGM+AKKNVFIIGATNRPDIID A+LRPGRLDQLIYIPLPDE SR QILKA+LRK+P++KD+D+ ++AK T GFSGADLTEICQRACK AIRE IE +IR  +   D+Q +G E MEDD +DPVPEITR HFEEAMK+ARRSVTDND+RKYEMFAQTLQQSRGFG +F+FPG    ++ PS+
Sbjct:   14 KNDELSTAILKDKVKPNRLIVDQSEQDDNSVIAVSQAKMDELGLFRGDAVILKGKKRKESVAIIVSDESCPNEKVRMNRVVRNNLRIRLGDVVSITPAPNLSYGTRIHVLPIDDTIEGLTGNLFDVFLKPYFLEAYRPLHKGDIFTVQAAMRTVEFKVVETEPAPACIVSPDTMIHYEGDPIKREEEEESMNDIGYDDLGGVRKQLAQIKEMVELPLRHPQLFKAIGIKPPRGILLFGPPGTGKTLIARAVANETGSFFFLINGPEVMSKMSGESESNLRKAFEECEKNQPAILFIDEIDAIAPKREKTNGEVERRIVSQLLTLMDGVKGRSNLVVIAATNRPNSIDGALRRFGRFDREIDIGIPDAVGRLEILRIHTKNMKLADDVDLEQIANECHGFVGADLASLCSEAALQQIREKMELIDLEDDQIDAEVLNSLAVTMENFRFAQGKSSPSALREAVVETPNTTWSDIGGLQNVKRELQELVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGGAGGDGGGASDRVINQVLTEMDGMNAKKNVFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDEASRHQILKASLRKTPLSKDLDLTFLAKNTVGFSGADLTEICQRACKLAIRESIEKEIRIEKERQDRQARGEELMEDDAVDPVPEITRAHFEEAMKFARRSVTDNDIRKYEMFAQTLQQSRGFGNNFKFPGEQRGSDAPSA 797          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: cdc-48.2 (Transitional endoplasmic reticulum ATPase homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:P54812])

HSP 1 Score: 1220.68 bits (3157), Expect = 0.000e+0
Identity = 615/781 (78.75%), Postives = 701/781 (89.76%), Query Frame = 3
Query:   87 KNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQ---LKGGEPMEDDI-DPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSG 2417
            KND+L TAIL+ K +PNRLI++   NDDNS+V +SQ KMDEL LFRGD+V+LKGKKRRETV I L  + CP++KI+MN+ VR NLR RLGDV+S+     + YGKRVHVLPIDDTIEG+TGN+++VFL+PYF +AYRPV K D+F V+  MR VEFKV+ETDP+P CIVAP+TVIH+EGDP+ R +E+E LNEVGYDD+GG RKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILL+GPPGTGKTLIARAVANETG+FFFLINGPEIMSK++GESESNLRKAF E EKNSPAI+FIDE+DAIAPKREK HGEVE+RIVSQLLTLMDGLK R+HV+V+AATNRPNSID ALRRFGRFDRE+DIGIPD  GRLEILRIHTKNM+LG+DVDLEQVA+E HG VGADLA+LC+EAA+QQIR KM+LIDLE+  IDAE+LNSLAVTME+FR+A+ KS+PSALRE  VE PN TW DIGGLQ VKRELQELVQYPVEHP+K+LKFGM PS+GVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRD+FDKAR AAPCVLFFDELDSIAK+RGGSVGD GGAADRVINQ+LTEMDGM+AKKNVFIIGATNRPDIID A+LRPGRLDQLIYIPLPDE SR+QI KA+LRK+P++ D+D+N++AK T GFSGADLTEICQRACK AIRE IE +IR  +++Q    +G E MED++ DPVPEITR HFEEAMK+ARRSVTDND+RKYEMFAQTLQQSRGFG +F+FPG  E PS+G
Sbjct:   14 KNDELATAILKDKKRPNRLIIDQSDNDDNSMVMLSQAKMDELGLFRGDSVILKGKKRRETVSIVLNADNCPNDKIKMNKVVRNNLRSRLGDVVSISSA-QLEYGKRVHVLPIDDTIEGLTGNLFDVFLRPYFTDAYRPVHKGDIFTVQAAMRTVEFKVVETDPAPACIVAPDTVIHYEGDPIKREEEEEALNEVGYDDLGGVRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLFGPPGTGKTLIARAVANETGAFFFLINGPEIMSKMSGESESNLRKAFAECEKNSPAILFIDEIDAIAPKREKAHGEVEKRIVSQLLTLMDGLKTRAHVVVIAATNRPNSIDGALRRFGRFDREIDIGIPDAVGRLEILRIHTKNMKLGEDVDLEQVANECHGFVGADLASLCSEAAIQQIREKMELIDLEDDTIDAEVLNSLAVTMENFRFAMGKSSPSALREAVVETPNTTWSDIGGLQNVKRELQELVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQVLTEMDGMNAKKNVFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDEASRLQIFKASLRKTPLSADLDLNFLAKNTVGFSGADLTEICQRACKLAIRESIEREIRQEKERQDRSARGEELMEDELADPVPEITRAHFEEAMKFARRSVTDNDIRKYEMFAQTLQQSRGFGNNFKFPG--EAPSAG 791          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: cdc-48.2 (Transitional endoplasmic reticulum ATPase homolog 2 [Source:UniProtKB/Swiss-Prot;Acc:P54812])

HSP 1 Score: 1220.68 bits (3157), Expect = 0.000e+0
Identity = 615/781 (78.75%), Postives = 701/781 (89.76%), Query Frame = 3
Query:   87 KNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQ---LKGGEPMEDDI-DPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSG 2417
            KND+L TAIL+ K +PNRLI++   NDDNS+V +SQ KMDEL LFRGD+V+LKGKKRRETV I L  + CP++KI+MN+ VR NLR RLGDV+S+     + YGKRVHVLPIDDTIEG+TGN+++VFL+PYF +AYRPV K D+F V+  MR VEFKV+ETDP+P CIVAP+TVIH+EGDP+ R +E+E LNEVGYDD+GG RKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILL+GPPGTGKTLIARAVANETG+FFFLINGPEIMSK++GESESNLRKAF E EKNSPAI+FIDE+DAIAPKREK HGEVE+RIVSQLLTLMDGLK R+HV+V+AATNRPNSID ALRRFGRFDRE+DIGIPD  GRLEILRIHTKNM+LG+DVDLEQVA+E HG VGADLA+LC+EAA+QQIR KM+LIDLE+  IDAE+LNSLAVTME+FR+A+ KS+PSALRE  VE PN TW DIGGLQ VKRELQELVQYPVEHP+K+LKFGM PS+GVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRD+FDKAR AAPCVLFFDELDSIAK+RGGSVGD GGAADRVINQ+LTEMDGM+AKKNVFIIGATNRPDIID A+LRPGRLDQLIYIPLPDE SR+QI KA+LRK+P++ D+D+N++AK T GFSGADLTEICQRACK AIRE IE +IR  +++Q    +G E MED++ DPVPEITR HFEEAMK+ARRSVTDND+RKYEMFAQTLQQSRGFG +F+FPG  E PS+G
Sbjct:   14 KNDELATAILKDKKRPNRLIIDQSDNDDNSMVMLSQAKMDELGLFRGDSVILKGKKRRETVSIVLNADNCPNDKIKMNKVVRNNLRSRLGDVVSISSA-QLEYGKRVHVLPIDDTIEGLTGNLFDVFLRPYFTDAYRPVHKGDIFTVQAAMRTVEFKVVETDPAPACIVAPDTVIHYEGDPIKREEEEEALNEVGYDDLGGVRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLFGPPGTGKTLIARAVANETGAFFFLINGPEIMSKMSGESESNLRKAFAECEKNSPAILFIDEIDAIAPKREKAHGEVEKRIVSQLLTLMDGLKTRAHVVVIAATNRPNSIDGALRRFGRFDREIDIGIPDAVGRLEILRIHTKNMKLGEDVDLEQVANECHGFVGADLASLCSEAAIQQIREKMELIDLEDDTIDAEVLNSLAVTMENFRFAMGKSSPSALREAVVETPNTTWSDIGGLQNVKRELQELVQYPVEHPEKYLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARAAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQVLTEMDGMNAKKNVFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDEASRLQIFKASLRKTPLSADLDLNFLAKNTVGFSGADLTEICQRACKLAIRESIEREIRQEKERQDRSARGEELMEDELADPVPEITRAHFEEAMKFARRSVTDNDIRKYEMFAQTLQQSRGFGNNFKFPG--EAPSAG 791          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: mac-1 (pep chromosome:WBcel235:II:13311459:13320911:-1 gene:WBGene00003119.1 transcript:Y48C3A.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mac-1)

HSP 1 Score: 415.231 bits (1066), Expect = 2.635e-130
Identity = 235/620 (37.90%), Postives = 358/620 (57.74%), Query Frame = 3
Query:  660 NEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL-----------------------------KQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAA----------------------LQQIRNKMD-----LIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGM-TPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSP---IAKDVDVNYMAKVTH--GFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYE 2333
            + V ++ IGG  +Q  ++  +  + L+ P+ F  +GV PPRG +++GPPG GKT+ A+AVA E       +   E++S ++GE+E  +R+ F+ A++NSP I+ +D++DAIAP+RE    E+ERR+VSQL + +D L                                + V+V+  T+RP+++D  LRR GRF+ E+ +GIPD T R +IL    K + L  DV L+Q+A  T G+VGADL AL  EAA                      ++QI+ ++D     L   ++P   +E+   L ++ EDF  ALS   P+A RE    VP+V+W+DIG L  V+++L+  + YP++  D F   G+    +G+L  GPPGCGKTLLAKA+ANE   NFIS+KGPELL M+ GESE  VR +F +AR + PCV+FFDE+D++                R++NQLLTEMDG+  ++ VF+IGATNRPDI+DAAILRPGRLD+++++  P  + R+ IL+ + +      + +D+D + +A++    GF+GADL  +   +   A++  +  +     D+ +KG             +  +HF EA    R SVT+ D +KYE
Sbjct:  201 SHVKFEHIGGADRQFLEVCRLA-MHLKRPKTFATLGVDPPRGFIVHGPPGCGKTMFAQAVAGELAIPMLQLAATELVSGVSGETEEKIRRLFDTAKQNSPCILILDDIDAIAPRRETAQREMERRVVSQLCSSLDELVLPPREKPLKDQLTFGDDGSVAIIGDSPTAAGAGVLVIGTTSRPDAVDGGLRRAGRFENEISLGIPDETAREKILEKICK-VNLAGDVTLKQIAKLTPGYVGADLQALIREAAKVAIDRVFDTIVVKNEGHKNLTVEQIKEELDRVLAWLQGDDDPSALSELNGGLQISFEDFERALSTIQPAAKREGFATVPDVSWDDIGALVEVRKQLEWSILYPIKRADDFAALGIDCRPQGILLCGPPGCGKTLLAKAVANETGMNFISVKGPELLNMYVGESERAVRTVFQRARDSQPCVIFFDEIDALVP---KRSHGESSGGARLVNQLLTEMDGVEGRQKVFLIGATNRPDIVDAAILRPGRLDKILFVDFPSVEDRVDILRKSTKNGTRPMLGEDIDFHEIAQLPELAGFTGADLAALIHESSLLALQARVLEN-----DESVKG-------------VGMRHFREAASRIRPSVTEADRKKYE 797          

HSP 2 Score: 187.193 bits (474), Expect = 1.062e-48
Identity = 116/296 (39.19%), Postives = 171/296 (57.77%), Query Frame = 3
Query:  663 EVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVK-PPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVE--RRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMR---LGDDVDLEQVAS--ETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKR 1526
            +V +DDIG   +   Q++  +  P++    F A+G+   P+GILL GPPG GKTL+A+AVANETG  F  + GPE+++   GESE  +R  F+ A  + P +IF DE+DA+ PKR  +HGE     R+V+QLLT MDG++ R  V ++ ATNRP+ +D A+ R GR D+ + +  P    R++ILR  TKN     LG+D+D  ++A   E  G  GADLAAL  E++L  ++ ++    LE  E      +   V M  FR A S+  PS       E     +E +  + G+K+
Sbjct:  529 DVSWDDIGALVEVRKQLEWSILYPIKRADDFAALGIDCRPQGILLCGPPGCGKTLLAKAVANETGMNFISVKGPELLNMYVGESERAVRTVFQRARDSQPCVIFFDEIDALVPKR--SHGESSGGARLVNQLLTEMDGVEGRQKVFLIGATNRPDIVDAAILRPGRLDKILFVDFPSVEDRVDILRKSTKNGTRPMLGEDIDFHEIAQLPELAGFTGADLAALIHESSLLALQARV----LENDE------SVKGVGMRHFREAASRIRPS-----VTEADRKKYEHMKKIYGLKQ 807          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Match: cdc-48.3 (ATPase family protein 2 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q21222])

HSP 1 Score: 269.626 bits (688), Expect = 1.868e-77
Identity = 172/510 (33.73%), Postives = 280/510 (54.90%), Query Frame = 3
Query:  675 DDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVA-NETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEIL----RIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDV-DVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADI 2186
             +IGGC      +++ V  P+R  +         P  +L++G PG+GKTL+ + VA   +GS  ++ +  E+M +L G +  N+             I+ ++EL+     +E T         ++ L+ + G +++  ++ + ++    ++D   R   RF  E +I +P    RL+IL     I+   + L  DV     A  THG  G DL +L   A   + R  ++ ++      DA                  +  P+ +R+  +EVPNV+W DIGG + +K E+Q+ V +P +HP+ F +FG+ P  G+L YGPPGC KTL+A+A+A+E + NF+++KGPEL + W G+SE  +RD+F +ARQ AP ++FFDE+D++            G +DRV+ QLLTE+DG+     V ++ ATNRPD +D+A+LRPGRLD+ IY+ LP E +R  IL+   +K      V  ++ + + T G+SGA+L  +C+ A   A+RE I+A I
Sbjct:  246 SNIGGCFTAKQVLEDYVISPVRQKE--------SPCSVLIWGLPGSGKTLLLKEVALVLSGSTTYIGSCEELM-ELNGVTTGNI------------VIVDVNELE-----KENTKA-------NRALSFLLGDEKKCVILCVRSSE---TLDIGFRV--RFPIEAEITVPTQDERLDILSKIGNIYNFPLELHLDV-----ARHTHGFTGGDLCSLLKAAKFARGRTHLERVN------DAR----------------KRIRPTGIRQFILEVPNVSWNDIGGNEELKLEIQQAVIWPQKHPEAFERFGIDPPAGILLYGPPGCSKTLIARALASEAKMNFLAVKGPELFSKWVGDSEKAIRDLFSRARQVAPTIVFFDEIDAVGS--SRGSEKSSGVSDRVLAQLLTELDGLEKSSRVILLAATNRPDQLDSALLRPGRLDRAIYVGLPCEVTRRAILEMRTKKMKFDDTVRTIDKLVEKTSGYSGAELVAVCRTAAMFAMRESIDATI 688          

HSP 2 Score: 202.601 bits (514), Expect = 3.358e-54
Identity = 102/231 (44.16%), Postives = 150/231 (64.94%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKR--EKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDV-DLEQVASETHGHVGADLAALCTEAALQQIRNKMD 1349
            V ++DIGG  +   +I++ V  P +HP+ F+  G+ PP GILLYGPPG  KTLIARA+A+E    F  + GPE+ SK  G+SE  +R  F  A + +P I+F DE+DA+   R  EK+ G V  R+++QLLT +DGL++ S VI++AATNRP+ +D AL R GR DR + +G+P    R  IL + TK M+  D V  ++++  +T G+ GA+L A+C  AA+  +R  +D
Sbjct:  456 VSWNDIGGNEELKLEIQQAVIWPQKHPEAFERFGIDPPAGILLYGPPGCSKTLIARALASEAKMNFLAVKGPELFSKWVGDSEKAIRDLFSRARQVAPTIVFFDEIDAVGSSRGSEKSSG-VSDRVLAQLLTELDGLEKSSRVILLAATNRPDQLDSALLRPGRLDRAIYVGLPCEVTRRAILEMRTKKMKFDDTVRTIDKLVEKTSGYSGAELVAVCRTAAMFAMRESID 685          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: TER94 (gene:FBgn0286784 transcript:FBtr0088391)

HSP 1 Score: 1268.83 bits (3282), Expect = 0.000e+0
Identity = 641/817 (78.46%), Postives = 720/817 (88.13%), Query Frame = 3
Query:   75 MASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPME-DDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLY 2522
            MA +K +DL TAIL+ K +PNRLIVE+  NDDNSVVS+SQ KMDELQLFRGDTV+LKGK+R+ETVCI L D+TCPDEKIRMNR VR NL V L DV+SVQ CP++ YGKRV +LPID++ EGVTGN++E++LKPYF+EAYRP+   D FIVR  MR +EFKV+ TDP PYCIVAPETVI  +GDP+ R +E+E LN VGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGIL+YGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDE+DAIAPKR+KTHGEVERRIVSQLLTLMDG+K+ SH+IVMAATNRPNSIDPALRRFGRFDRE+DIGIPD TGRLE+LRIHTKNM+L DDVDLEQ+A+E+HGHVGADLA+LC+EAALQQIR KMDLIDLE+ +IDAE+L SLAVTME+FR+A++KS+PSALRET VEVPN TW DIGGL+ VK+ELQELVQYPVEHPDKFLKFGM PS+GVLFYGPPGCGKTLLAKAIANECQANFIS+KGPELLTMWFGESEANVRDIFDKAR AAPCVLFFDELDSIAK+RGG+VGD GGAADRVINQ+LTEMDGM AKKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPD+KSR  ILKANLRKSP+AK+VD+ Y+AKVT GFSGADLTEICQRACK AIR+ IEA+IR  +++       M+ D+ DPVPEIT  HFEEAMK+ARRSV+DND+RKYEMFAQTLQQSRGFG +FRFPG     S  GN            N+PV+  G     ++ +DDLY
Sbjct:    1 MADSKGEDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQNFRFPGQTGNTSGSGN------------NLPVNSPG-----DNGDDDLY 800          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: TER94 (gene:FBgn0286784 transcript:FBtr0343852)

HSP 1 Score: 1268.83 bits (3282), Expect = 0.000e+0
Identity = 639/813 (78.60%), Postives = 718/813 (88.31%), Query Frame = 3
Query:   84 NKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLY 2522
            +K +DL TAIL+ K +PNRLIVE+  NDDNSVVS+SQ KMDELQLFRGDTV+LKGK+R+ETVCI L D+TCPDEKIRMNR VR NL V L DV+SVQ CP++ YGKRV +LPID++ EGVTGN++E++LKPYF+EAYRP+   D FIVR  MR +EFKV+ TDP PYCIVAPETVI  +GDP+ R +E+E LN VGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGIL+YGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDE+DAIAPKR+KTHGEVERRIVSQLLTLMDG+K+ SH+IVMAATNRPNSIDPALRRFGRFDRE+DIGIPD TGRLE+LRIHTKNM+L DDVDLEQ+A+E+HGHVGADLA+LC+EAALQQIR KMDLIDLE+ +IDAE+L SLAVTME+FR+A++KS+PSALRET VEVPN TW DIGGL+ VK+ELQELVQYPVEHPDKFLKFGM PS+GVLFYGPPGCGKTLLAKAIANECQANFIS+KGPELLTMWFGESEANVRDIFDKAR AAPCVLFFDELDSIAK+RGG+VGD GGAADRVINQ+LTEMDGM AKKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPD+KSR  ILKANLRKSP+AK+VD+ Y+AKVT GFSGADLTEICQRACK AIR+ IEA+IR  +++       M+D+ DPVPEIT  HFEEAMK+ARRSV+DND+RKYEMFAQTLQQSRGFG +FRFPG     S  GN            N+PV+  G     ++ +DDLY
Sbjct:   29 DKREDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDDEDDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQNFRFPGQTGNTSGSGN------------NLPVNSPG-----DNGDDDLY 824          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: TER94 (gene:FBgn0286784 transcript:FBtr0112905)

HSP 1 Score: 1263.83 bits (3269), Expect = 0.000e+0
Identity = 639/814 (78.50%), Postives = 718/814 (88.21%), Query Frame = 3
Query:   84 NKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPME-DDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLY 2522
            +K +DL TAIL+ K +PNRLIVE+  NDDNSVVS+SQ KMDELQLFRGDTV+LKGK+R+ETVCI L D+TCPDEKIRMNR VR NL V L DV+SVQ CP++ YGKRV +LPID++ EGVTGN++E++LKPYF+EAYRP+   D FIVR  MR +EFKV+ TDP PYCIVAPETVI  +GDP+ R +E+E LN VGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGIL+YGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDE+DAIAPKR+KTHGEVERRIVSQLLTLMDG+K+ SH+IVMAATNRPNSIDPALRRFGRFDRE+DIGIPD TGRLE+LRIHTKNM+L DDVDLEQ+A+E+HGHVGADLA+LC+EAALQQIR KMDLIDLE+ +IDAE+L SLAVTME+FR+A++KS+PSALRET VEVPN TW DIGGL+ VK+ELQELVQYPVEHPDKFLKFGM PS+GVLFYGPPGCGKTLLAKAIANECQANFIS+KGPELLTMWFGESEANVRDIFDKAR AAPCVLFFDELDSIAK+RGG+VGD GGAADRVINQ+LTEMDGM AKKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPD+KSR  ILKANLRKSP+AK+VD+ Y+AKVT GFSGADLTEICQRACK AIR+ IEA+IR  +++       M+ D+ DPVPEIT  HFEEAMK+ARRSV+DND+RKYEMFAQTLQQSRGFG +FRFPG     S  GN            N+PV+  G     ++ +DDLY
Sbjct:   29 DKREDLATAILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQNFRFPGQTGNTSGSGN------------NLPVNSPG-----DNGDDDLY 825          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: TER94 (gene:FBgn0286784 transcript:FBtr0112906)

HSP 1 Score: 1214.13 bits (3140), Expect = 0.000e+0
Identity = 613/775 (79.10%), Postives = 686/775 (88.52%), Query Frame = 3
Query:  201 MDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPME-DDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLY 2522
            MDELQLFRGDTV+LKGK+R+ETVCI L D+TCPDEKIRMNR VR NL V L DV+SVQ CP++ YGKRV +LPID++ EGVTGN++E++LKPYF+EAYRP+   D FIVR  MR +EFKV+ TDP PYCIVAPETVI  +GDP+ R +E+E LN VGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGIL+YGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDE+DAIAPKR+KTHGEVERRIVSQLLTLMDG+K+ SH+IVMAATNRPNSIDPALRRFGRFDRE+DIGIPD TGRLE+LRIHTKNM+L DDVDLEQ+A+E+HGHVGADLA+LC+EAALQQIR KMDLIDLE+ +IDAE+L SLAVTME+FR+A++KS+PSALRET VEVPN TW DIGGL+ VK+ELQELVQYPVEHPDKFLKFGM PS+GVLFYGPPGCGKTLLAKAIANECQANFIS+KGPELLTMWFGESEANVRDIFDKAR AAPCVLFFDELDSIAK+RGG+VGD GGAADRVINQ+LTEMDGM AKKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPD+KSR  ILKANLRKSP+AK+VD+ Y+AKVT GFSGADLTEICQRACK AIR+ IEA+IR  +++       M+ D+ DPVPEIT  HFEEAMK+ARRSV+DND+RKYEMFAQTLQQSRGFG +FRFPG     S  GN            N+PV+  G     ++ +DDLY
Sbjct:    1 MDELQLFRGDTVILKGKRRKETVCIVLSDDTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNLFEIYLKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIFCDGDPIKREEEEESLNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILMYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGMKKSSHLIVMAATNRPNSIDPALRRFGRFDREIDIGIPDATGRLEVLRIHTKNMKLHDDVDLEQIAAESHGHVGADLASLCSEAALQQIREKMDLIDLEDDKIDAEVLASLAVTMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLESVKKELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVRDIFDKARSAAPCVLFFDELDSIAKARGGNVGDAGGAADRVINQILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDKSREAILKANLRKSPLAKEVDLTYIAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRREKERAENQNSAMDMDEDDPVPEITSAHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGQNFRFPGQTGNTSGSGN------------NLPVNSPG-----DNGDDDLY 758          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Match: CG5776 (gene:FBgn0032450 transcript:FBtr0329925)

HSP 1 Score: 383.645 bits (984), Expect = 1.975e-118
Identity = 216/559 (38.64%), Postives = 338/559 (60.47%), Query Frame = 3
Query:  561 IETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNE-VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARA---VANETGSF---FFLINGPEIMSKLAGESESNLRKAFEEAEKN--SPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHV-----IVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM--RLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIA--KXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEAD 2183
            +++ P  +  V   T +H   D   + +E++K++  +    IGG  +QL  ++E +E  L    L    G++  RG+LLYG  G GK+++  A   VA E          IN  E+ SK  GE+E  L   FE A  +   P ++ I+++  + PK+E +  ++ +R+    L+L+D L   S +      V+A +++ +++ P++RR GR D EV++G P +  RLEI+R   K++  +L D+ ++E VAS THG+VGADLA L   A LQ   N + +     P + A               AL++  PSA+RE  +E PNV W DIGG   ++  +Q+ +++P+ H DKF + G+ P +G+L +GPPGC KT++AKA+A E + NF+SIKGPEL +MW GESE  VR++F KARQ AP ++FFDE+D+I   +S G     G    +RV+ QLLTE+DG+ A +NV I+ ATNRPD+ID A+LRPGR+D+++Y+ LP  ++R +ILK  LR  PI+ DVD+  + ++T G+SGA++  +C  A  +A+ +  EA+
Sbjct:  233 LDSKPLQFIQVTNVTKLHLITDDANQQEEEQKISHRITKCQIGGLDRQLQLVEESMEYALGFRTL--PAGLRVSRGLLLYGATGCGKSMVLEAMCAVAEERSQGHVQLIRINSGEVYSKFLGETEQKLGAIFERAYNHYPHPTLLLIEDVHNLCPKQENS--DLVKRVSLAFLSLLDQLSSPSQLKGSKTFVLATSSQIDTLHPSIRRAGRLDNEVELGAPSSQARLEIVRCLIKSVEHQLSDE-EVEHVASITHGYVGADLANLVYAAMLQAQPNPLQM-----PHLQA---------------ALTRIKPSAMREVLIECPNVQWSDIGGQSELRLAMQQAIEWPLLHADKFQRLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFLSIKGPELFSMWVGESERAVREVFRKARQVAPAIVFFDEIDAIGGERSEGDGSSSGSSVKERVLTQLLTELDGVEALQNVTIVAATNRPDMIDKALLRPGRIDRILYVGLPQCEARREILKIKLRAMPISNDVDMEKLVQLTEGYSGAEIQAVCHEAALRALEQSFEAE 766          

HSP 2 Score: 199.134 bits (505), Expect = 1.606e-52
Identity = 100/238 (42.02%), Postives = 155/238 (65.13%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGE-----VERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLE 1364
            V + DIGG  +    +++ +E PL H   F+ +G+KPPRGIL++GPPG  KT+IA+A+A E+   F  I GPE+ S   GESE  +R+ F +A + +PAI+F DE+DAI  +R +  G      V+ R+++QLLT +DG++   +V ++AATNRP+ ID AL R GR DR + +G+P    R EIL+I  + M + +DVD+E++   T G+ GA++ A+C EAAL+ +    +  D++
Sbjct:  532 VQWSDIGGQSELRLAMQQAIEWPLLHADKFQRLGIKPPRGILMFGPPGCSKTMIAKALATESKLNFLSIKGPELFSMWVGESERAVREVFRKARQVAPAIVFFDEIDAIGGERSEGDGSSSGSSVKERVLTQLLTELDGVEALQNVTIVAATNRPDMIDKALLRPGRIDRILYVGLPQCEARREILKIKLRAMPISNDVDMEKLVQLTEGYSGAEIQAVCHEAALRALEQSFEAEDVK 769          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 1313.52 bits (3398), Expect = 0.000e+0
Identity = 648/762 (85.04%), Postives = 714/762 (93.70%), Query Frame = 3
Query:   66 LINMASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
             +++  +KNDDL TAIL+ K +PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRETVCI L D+TC DEK+RMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGG RKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVPN+TWEDIGGL  VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG+VGDGGGAADRVINQ+LTEMDGMS+KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSPI+KDVD++++AK+T+GFSGADLTEICQRACK AIRE IE +IR  R++Q        ++ DPVPEI + HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    1 FVSLHRSKNDDLSTAILKQKNRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRRETVCIVLSDDTCSDEKVRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGVRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPNITWEDIGGLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKSPISKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 1311.59 bits (3393), Expect = 0.000e+0
Identity = 651/762 (85.43%), Postives = 714/762 (93.70%), Query Frame = 3
Query:   75 MAS---NKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            MAS   +KNDDL TAIL+ K +PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRETVCI L D+TC DEK+RMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGG RKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVPN+TWEDIGGL  VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG+VGDGGGAADRVINQ+LTEMDGMS+KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSPI+KDVD++++AK+T+GFSGADLTEICQRACK AIRE IE +IR  R++Q        ++ DPVPEI + HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    1 MASGGESKNDDLSTAILKQKNRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRRETVCIVLSDDTCSDEKVRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGVRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPNITWEDIGGLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKSPISKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: zgc:136908 (zgc:136908 [Source:ZFIN;Acc:ZDB-GENE-060312-22])

HSP 1 Score: 1276.15 bits (3301), Expect = 0.000e+0
Identity = 614/755 (81.32%), Postives = 697/755 (92.32%), Query Frame = 3
Query:   87 KNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            K +D  TAIL+ K +PNRLIV++  N+DNS+V +SQ KM+ELQLFRGDTV+L+G+KRR+TVCI L D+TC +E++RMNR  R NLRVRLGDVIS+ PCP++ YGKR+HVLPIDDTIEG+TGN+++VFLKPYF+EAYRPV K D+F+VRGGMRAVEFKV+ETDP+P+CIVAP+T+IH EG+P+ R DE+E LN++GYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTL+ARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HV+VMAATNRPNS+D ALRRFGRFDRE+DIGIPD+TGRLEIL+IHTKNM+L +DVDLEQ+++ETHGHVGADLAALC+EAALQ IR KM LIDLE+  IDA++LNSLAVTM+DF+WALS+SNPSALRET VEVP+V WEDIGGL  VKRELQELVQYPVE+PDKFLKFGMTPS+GVLFYGPPGCGKTLLAKAIANECQANF+SIKGPELLTMWFGESEANVRD+FDKARQAAPC+LFFDELDSIAK+RGG  GD GGAADRVINQ+LTEMDGM+ KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPD  SR  IL+ANLRKSP+AKDVD+ Y++K+T GFSGADLTEICQRACK AIRE IEA+IRA R +Q +    M+DD DPVPEI + HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:   10 KTEDFSTAILKQKIRPNRLIVDEATNEDNSIVCLSQVKMEELQLFRGDTVVLRGRKRRQTVCIVLTDDTCGNERVRMNRVTRNNLRVRLGDVISIHPCPDVKYGKRIHVLPIDDTIEGLTGNLFDVFLKPYFLEAYRPVHKGDIFLVRGGMRAVEFKVVETDPTPHCIVAPDTIIHCEGEPIKREDEEESLNDIGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLVARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVVVMAATNRPNSVDAALRRFGRFDREIDIGIPDSTGRLEILQIHTKNMKLSEDVDLEQISAETHGHVGADLAALCSEAALQAIRKKMTLIDLEDDSIDADLLNSLAVTMDDFKWALSQSNPSALRETVVEVPHVNWEDIGGLDEVKRELQELVQYPVEYPDKFLKFGMTPSRGVLFYGPPGCGKTLLAKAIANECQANFVSIKGPELLTMWFGESEANVRDVFDKARQAAPCILFFDELDSIAKARGGGAGDAGGAADRVINQILTEMDGMTNKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDMPSRTAILRANLRKSPVAKDVDLMYLSKITEGFSGADLTEICQRACKLAIREAIEAEIRAERQRQARKETAMDDDYDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTL 764          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: nvl (nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-2871])

HSP 1 Score: 475.322 bits (1222), Expect = 4.717e-153
Identity = 262/593 (44.18%), Postives = 368/593 (62.06%), Query Frame = 3
Query:  654 KLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLK---QRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPE-------------------IDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLR---KSPIAKDVDVNYMAK--VTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            + + V ++D GG  + L ++ +++ + +RHP++++ +GV PPRG LL+GPPG GKTL+A+AVA ET      I+ PE++S ++GESE  LR+ FE+A  ++P I+FIDE+DAI PKRE    ++ERRIV+QLLT MD L    + + V+V+ ATNRP+S+DPALRR GRFDRE+ +GIPD   R++IL+   + +RL DD D   +A  T G+VGADL ALC EAA+  + N++ L    E +                   +  + L +L V M DF  +L +  PSA RE    VP+VTW D+G LQ V+ EL   +  P+++P++F   G++   G+L  GPPGCGKTLLAKA+ANE   NFIS+KGPELL M+ GESE  VR +F + R +APCV+FFDE+D++            GA+ RV+NQLLTEMDGM  ++ VFI+ ATNRPDIID A+LRPGRLD+ +Y+ LP    R  IL    +   K  +  DV +  +A       F+GADL+ + + AC  A+R  +  D      +  K       DI     ++R HFE+A K  R SV+  D   YE   +TL
Sbjct:  220 QFSSVKFEDFGGSDETLEEVCKLL-IHMRHPEVYQRLGVVPPRGFLLHGPPGCGKTLLAQAVAGETALPLLKISAPELVSGVSGESEQKLRELFEQAISSAPCILFIDEIDAITPKRETASKDMERRIVAQLLTCMDDLNSMLEPAQVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEGARMKILKTLCRKIRLPDDFDFRHLARLTPGYVGADLMALCREAAMNAV-NRILLEPTTEDQTTPTLALARLLDLLKSSVSLSEDQLAALCVLMSDFSSSLVRVQPSAKREGFATVPDVTWADVGALQDVREELHMAIMAPIQNPEQFKALGLSAPAGLLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCP---RRSEHESGASVRVVNQLLTEMDGMENRRQVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLPPAADRHVILNTITKGGTKPQLDSDVSLEEIAHDARCETFTGADLSALVREACVNALR--VHLDPARTHTESAK-------DI----RVSRVHFEDAFKKVRPSVSKKDQLMYERLRETL 794          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Match: CABZ01085878.1 (spermatogenesis associated 5 [Source:NCBI gene;Acc:100332622])

HSP 1 Score: 424.476 bits (1090), Expect = 9.821e-135
Identity = 203/398 (51.01%), Postives = 289/398 (72.61%), Query Frame = 3
Query:  642 DEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKN-SPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSH---VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRL-GDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWED--IGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIA 1814
            DE ++ ++V Y  IGG R QL  I+E +ELPL+HP+LFK+ G+ PPRG+LLYGPPGTGKTLI RAVANE G+   +INGPEIMSK  GE+E+ LR+ F EA ++  P+IIFIDELDA+ PKRE    EVE+R+V+ LLTLMDG+    H   ++V+ ATNRP+++DPALRR GRFD+E++IG+P+  GR +IL+   +++       +L+++A   HG+VGADLAA+C EA L  +R    ++       D ++++ + V   D R A+++  PSA+RE  ++VP V  ++  + GL+ VK+ L++ V++P+ HP+ F + G+TP KGVL YGPPGC KT++AKA+ANE Q NF+SIKGPELL+ + GESE  VR++F KAR  AP ++FFDE+D++A
Sbjct:  313 DEQDQGSKVTYSMIGGLRGQLEVIRETIELPLKHPELFKSYGIPPPRGVLLYGPPGTGKTLIGRAVANEVGAHMSVINGPEIMSKFYGETEARLRQIFTEAAQSRQPSIIFIDELDALCPKREGAQNEVEKRVVATLLTLMDGIGSEGHSGQLLVLGATNRPHALDPALRRPGRFDKELEIGVPNVDGRRDILQTLLRSVPCDATHEELQELADAAHGYVGADLAAVCKEAGLHALRR---VLGSRSALSDVQVMDKVKVMTSDLRLAMTEVKPSAMREVAIDVPKVQQQNNSLNGLEQVKQALKQAVEWPLRHPEVFTRLGITPPKGVLLYGPPGCSKTMIAKALANESQLNFLSIKGPELLSKYVGESERAVREVFRKARTVAPSIVFFDEIDALA 707          

HSP 2 Score: 173.711 bits (439), Expect = 1.781e-44
Identity = 94/245 (38.37%), Postives = 148/245 (60.41%), Query Frame = 3
Query: 1455 LRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQA-APCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKN---VFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPI-AKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECI 2174
            LR+   +   VT+  IGGL+G    ++E ++ P++HP+ F  +G+ P +GVL YGPPG GKTL+ +A+ANE  A+   I GPE+++ ++GE+EA +R IF +A Q+  P ++F DELD++        G       RV+  LLT MDG+ ++ +   + ++GATNRP  +D A+ RPGR D+ + I +P+   R  IL+  LR  P  A   ++  +A   HG+ GADL  +C+ A   A+R  +
Sbjct:  311 LRDEQDQGSKVTYSMIGGLRGQLEVIRETIELPLKHPELFKSYGIPPPRGVLLYGPPGTGKTLIGRAVANEVGAHMSVINGPEIMSKFYGETEARLRQIFTEAAQSRQPSIIFIDELDALCP---KREGAQNEVEKRVVATLLTLMDGIGSEGHSGQLLVLGATNRPHALDPALRRPGRFDKELEIGVPNVDGRRDILQTLLRSVPCDATHEELQELADAAHGYVGADLAAVCKEAGLHALRRVL 552          

HSP 3 Score: 119.013 bits (297), Expect = 6.111e-27
Identity = 52/110 (47.27%), Postives = 77/110 (70.00%), Query Frame = 3
Query:  675 DDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKR 1004
            + + G  +    +K+ VE PLRHP++F  +G+ PP+G+LLYGPPG  KT+IA+A+ANE+   F  I GPE++SK  GESE  +R+ F +A   +P+I+F DE+DA+A  R
Sbjct:  601 NSLNGLEQVKQALKQAVEWPLRHPEVFTRLGITPPKGVLLYGPPGCSKTMIAKALANESQLNFLSIKGPELLSKYVGESERAVREVFRKARTVAPSIVFFDEIDALAVAR 710          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: dtymk (deoxythymidylate kinase [Source:Xenbase;Acc:XB-GENE-1004306])

HSP 1 Score: 1316.6 bits (3406), Expect = 0.000e+0
Identity = 661/814 (81.20%), Postives = 730/814 (89.68%), Query Frame = 3
Query:   81 SNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLY 2522
            S+K+DDL TAIL+ K++PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD+TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSP+AKDVD++++AK+T+GFSGADLTEICQRACK AIRE IE +IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL                ++   G   F  G       +     G  G+ FN+ EDDLY
Sbjct:   13 SSKSDDLSTAILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSDDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKSPVAKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL---------------QQSRGFGSFRFPAGGQGGAGPSQGAGGGSGGSHFNEEEDDLY 811          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: dtymk (deoxythymidylate kinase [Source:Xenbase;Acc:XB-GENE-1004306])

HSP 1 Score: 1315.83 bits (3404), Expect = 0.000e+0
Identity = 649/759 (85.51%), Postives = 714/759 (94.07%), Query Frame = 3
Query:   75 MASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +A +K+DDL TAIL+ K++PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD+TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSP+AKDVD++++AK+T+GFSGADLTEICQRACK AIRE IE +IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    9 VAHSKSDDLSTAILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSDDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKSPVAKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 767          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: dtymk (deoxythymidylate kinase [Source:Xenbase;Acc:XB-GENE-1004306])

HSP 1 Score: 1315.44 bits (3403), Expect = 0.000e+0
Identity = 648/758 (85.49%), Postives = 713/758 (94.06%), Query Frame = 3
Query:   78 ASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            + +K+DDL TAIL+ K++PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD+TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSP+AKDVD++++AK+T+GFSGADLTEICQRACK AIRE IE +IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    5 SDSKSDDLSTAILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSDDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKSPVAKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: dtymk (deoxythymidylate kinase [Source:Xenbase;Acc:XB-GENE-1004306])

HSP 1 Score: 1315.06 bits (3402), Expect = 0.000e+0
Identity = 660/813 (81.18%), Postives = 729/813 (89.67%), Query Frame = 3
Query:   84 NKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLY 2522
            +K+DDL TAIL+ K++PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD+TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSP+AKDVD++++AK+T+GFSGADLTEICQRACK AIRE IE +IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL                ++   G   F  G       +     G  G+ FN+ EDDLY
Sbjct:    6 SKSDDLSTAILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSDDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKSPVAKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL---------------QQSRGFGSFRFPAGGQGGAGPSQGAGGGSGGSHFNEEEDDLY 803          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Match: dtymk (deoxythymidylate kinase [Source:Xenbase;Acc:XB-GENE-1004306])

HSP 1 Score: 1309.66 bits (3388), Expect = 0.000e+0
Identity = 647/753 (85.92%), Postives = 709/753 (94.16%), Query Frame = 3
Query:   93 DDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            DDL TAIL+ K++PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD+TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSP+AKDVD++++AK+T+GFSGADLTEICQRACK AIRE IE +IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    4 DDLSTAILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSDDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKSPVAKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 756          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Vcp (valosin containing protein [Source:MGI Symbol;Acc:MGI:99919])

HSP 1 Score: 1304.27 bits (3374), Expect = 0.000e+0
Identity = 648/758 (85.49%), Postives = 710/758 (93.67%), Query Frame = 3
Query:   78 ASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            A +K DDL TAIL+ K +PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSR+ ILKANLRKSP+AKDVD+ ++AK+T+GFSGADLTEICQRACK AIRE IE++IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    5 ADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Spata5 (spermatogenesis associated 5 [Source:MGI Symbol;Acc:MGI:1927170])

HSP 1 Score: 515.768 bits (1327), Expect = 2.125e-167
Identity = 265/574 (46.17%), Postives = 380/574 (66.20%), Query Frame = 3
Query:  639 ADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL---KQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM-RLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEI-DAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQ 2345
            + E +   +V YD IGG   QL  I+E++ELPL+ P+LFK+ G+  PRG+LLYGPPGTGKT+IARAVANE G++  +INGPEI+SK  GE+E+ LR+ F EA    P+IIFIDELDA+ PKRE    EVE+R+V+ LLTLMDG+        V+V+ ATNRP ++D ALRR GRFD+E++IGIP+   RL+IL+   + +  L    +L ++A+  HG+VGADL ALC EA L  +R  +     ++P + D+++   + +T+ DF   ++   PSA+RE  ++VPNV+W DIGGL+ +K +L++ V++P++HP  F + G+ P KGVL YGPPGC KT++AKA+ANE   NF++IKGPEL+  + GESE  VR+IF KAR  AP ++FFDELD++A    GS    G  ADRV+ QLLTEMDG+   KNV ++ ATNRPD ID A++RPGR+D++IY+PLPD  +R +IL       PI+ +VD++ +   T  +SGA++  +C+ A   A+ E I+AD                        I ++HF +A+      + ++  R YE + +
Sbjct:  341 SKEQDSQFKVTYDMIGGLNSQLKAIREIIELPLKQPELFKSYGIPAPRGLLLYGPPGTGKTMIARAVANEVGAYVSVINGPEIISKFYGETEARLRQIFAEATLRHPSIIFIDELDALCPKREGAQSEVEKRVVASLLTLMDGIGSEGSEGRVLVLGATNRPQALDAALRRPGRFDKEIEIGIPNAQDRLDILQKLLRRVPHLLTKAELLRLANNAHGYVGADLKALCNEAGLHALRRVLR----KQPNLPDSKVAGMVKITLNDFLQGMNDIRPSAMREVAIDVPNVSWSDIGGLENIKLKLKQAVEWPLKHPKSFNRMGIQPPKGVLLYGPPGCSKTMIAKALANESGLNFLAIKGPELMNKYVGESERAVREIFRKARAVAPSIIFFDELDALA-VERGSSSGAGNVADRVLAQLLTEMDGIEQLKNVTVLAATNRPDRIDKALMRPGRIDRIIYVPLPDAATRREILNLQFHSMPISNEVDLDELVLQTDTYSGAEIIAVCKEAALLALEENIKADC-----------------------IMKRHFTQALSIVTPRIPESLRRFYEDYQE 886          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Spata5 (spermatogenesis associated 5 [Source:MGI Symbol;Acc:MGI:1927170])

HSP 1 Score: 515.768 bits (1327), Expect = 2.502e-167
Identity = 265/574 (46.17%), Postives = 380/574 (66.20%), Query Frame = 3
Query:  639 ADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL---KQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM-RLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEI-DAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQ 2345
            + E +   +V YD IGG   QL  I+E++ELPL+ P+LFK+ G+  PRG+LLYGPPGTGKT+IARAVANE G++  +INGPEI+SK  GE+E+ LR+ F EA    P+IIFIDELDA+ PKRE    EVE+R+V+ LLTLMDG+        V+V+ ATNRP ++D ALRR GRFD+E++IGIP+   RL+IL+   + +  L    +L ++A+  HG+VGADL ALC EA L  +R  +     ++P + D+++   + +T+ DF   ++   PSA+RE  ++VPNV+W DIGGL+ +K +L++ V++P++HP  F + G+ P KGVL YGPPGC KT++AKA+ANE   NF++IKGPEL+  + GESE  VR+IF KAR  AP ++FFDELD++A    GS    G  ADRV+ QLLTEMDG+   KNV ++ ATNRPD ID A++RPGR+D++IY+PLPD  +R +IL       PI+ +VD++ +   T  +SGA++  +C+ A   A+ E I+AD                        I ++HF +A+      + ++  R YE + +
Sbjct:  340 SKEQDSQFKVTYDMIGGLNSQLKAIREIIELPLKQPELFKSYGIPAPRGLLLYGPPGTGKTMIARAVANEVGAYVSVINGPEIISKFYGETEARLRQIFAEATLRHPSIIFIDELDALCPKREGAQSEVEKRVVASLLTLMDGIGSEGSEGRVLVLGATNRPQALDAALRRPGRFDKEIEIGIPNAQDRLDILQKLLRRVPHLLTKAELLRLANNAHGYVGADLKALCNEAGLHALRRVLR----KQPNLPDSKVAGMVKITLNDFLQGMNDIRPSAMREVAIDVPNVSWSDIGGLENIKLKLKQAVEWPLKHPKSFNRMGIQPPKGVLLYGPPGCSKTMIAKALANESGLNFLAIKGPELMNKYVGESERAVREIFRKARAVAPSIIFFDELDALA-VERGSSSGAGNVADRVLAQLLTEMDGIEQLKNVTVLAATNRPDRIDKALMRPGRIDRIIYVPLPDAATRREILNLQFHSMPISNEVDLDELVLQTDTYSGAEIIAVCKEAALLALEENIKADC-----------------------IMKRHFTQALSIVTPRIPESLRRFYEDYQE 885          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Spata5 (spermatogenesis associated 5 [Source:MGI Symbol;Acc:MGI:1927170])

HSP 1 Score: 500.745 bits (1288), Expect = 3.639e-162
Identity = 251/500 (50.20%), Postives = 352/500 (70.40%), Query Frame = 3
Query:  639 ADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGL---KQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM-RLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEI-DAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGAD 2123
            + E +   +V YD IGG   QL  I+E++ELPL+ P+LFK+ G+  PRG+LLYGPPGTGKT+IARAVANE G++  +INGPEI+SK  GE+E+ LR+ F EA    P+IIFIDELDA+ PKRE    EVE+R+V+ LLTLMDG+        V+V+ ATNRP ++D ALRR GRFD+E++IGIP+   RL+IL+   + +  L    +L ++A+  HG+VGADL ALC EA L  +R  +     ++P + D+++   + +T+ DF   ++   PSA+RE  ++VPNV+W DIGGL+ +K +L++ V++P++HP  F + G+ P KGVL YGPPGC KT++AKA+ANE   NF++IKGPEL+  + GESE  VR+IF KAR  AP ++FFDELD++A    GS    G  ADRV+ QLLTEMDG+   KNV ++ ATNRPD ID A++RPGR+D++IY+PLPD  +R +IL       PI+ +VD++ +   T  +SGA+
Sbjct:  341 SKEQDSQFKVTYDMIGGLNSQLKAIREIIELPLKQPELFKSYGIPAPRGLLLYGPPGTGKTMIARAVANEVGAYVSVINGPEIISKFYGETEARLRQIFAEATLRHPSIIFIDELDALCPKREGAQSEVEKRVVASLLTLMDGIGSEGSEGRVLVLGATNRPQALDAALRRPGRFDKEIEIGIPNAQDRLDILQKLLRRVPHLLTKAELLRLANNAHGYVGADLKALCNEAGLHALRRVLR----KQPNLPDSKVAGMVKITLNDFLQGMNDIRPSAMREVAIDVPNVSWSDIGGLENIKLKLKQAVEWPLKHPKSFNRMGIQPPKGVLLYGPPGCSKTMIAKALANESGLNFLAIKGPELMNKYVGESERAVREIFRKARAVAPSIIFFDELDALA-VERGSSSGAGNVADRVLAQLLTEMDGIEQLKNVTVLAATNRPDRIDKALMRPGRIDRIIYVPLPDAATRREILNLQFHSMPISNEVDLDELVLQTDTYSGAE 835          

HSP 2 Score: 171.785 bits (434), Expect = 2.341e-43
Identity = 88/234 (37.61%), Postives = 145/234 (61.97%), Query Frame = 3
Query: 1485 VTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKN---VFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSP-IAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECI 2174
            VT++ IGGL    + ++E+++ P++ P+ F  +G+   +G+L YGPPG GKT++A+A+ANE  A    I GPE+++ ++GE+EA +R IF +A    P ++F DELD++   R G+  +        +  LLT MDG+ ++ +   V ++GATNRP  +DAA+ RPGR D+ I I +P+ + R+ IL+  LR+ P +    ++  +A   HG+ GADL  +C  A   A+R  +
Sbjct:  350 VTYDMIGGLNSQLKAIREIIELPLKQPELFKSYGIPAPRGLLLYGPPGTGKTMIARAVANEVGAYVSVINGPEIISKFYGETEARLRQIFAEATLRHPSIIFIDELDALCPKREGAQSEVEKRV---VASLLTLMDGIGSEGSEGRVLVLGATNRPQALDAALRRPGRFDKEIEIGIPNAQDRLDILQKLLRRVPHLLTKAELLRLANNAHGYVGADLKALCNEAGLHALRRVL 580          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Match: Nvl (nuclear VCP-like [Source:MGI Symbol;Acc:MGI:1914709])

HSP 1 Score: 459.529 bits (1181), Expect = 2.340e-146
Identity = 258/616 (41.88%), Postives = 369/616 (59.90%), Query Frame = 3
Query:  654 KLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQ---RSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAAL------------------------------------------QQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKA---NLRKSPIAKDVDVNYMAK--VTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +++ V ++D+GG    L ++ +M+ + +RHP++++ +GV PPRG+LL+GPPG GKTL+A A+A E       +  PEI+S ++GESE  LR+ F++A  N+P I+FIDE+DAI PKRE    ++ERRIV+QLLT MD L      + V+V+ ATNRP+S+DPALRR GRFDREV +GIPD   R  IL+   + +RL +  +   +A  T G VGADL ALC EAA+                                           +++  + L+  ++P +  E +  L + + DF  AL++  PSA RE  V VPNVTW DIG L+ ++ EL   +  PV +PD+F   G+    G+L  GPPGCGKTLLAKA+ANE   NFIS+KGPELL M+ GESE  VR +F +A+ +APCV+FFDE+D++            GA+ RV+NQLLTEMDG+  ++ VFI+ ATNRPDIID AILRPGRLD+ +++ LP    R+ ILK    N  K P+ +DV++  +A     + ++GADLT + + A   A+R+ I A        +LK              ++ KHFE+A K  + S++  D   YE   ++L
Sbjct:  257 QISNVKFEDVGGNDATLKEVCKML-IHMRHPEVYQHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFDQAVSNAPCIVFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREVCLGIPDEAARERILQTLCRKLRLPETFNFCHLAHLTPGFVGADLMALCREAAMCAVNRVLMKQQAQQKKKPEIEGLPSEGDQEERLGAEPTSETQDELQRLLGLLRDQDP-LSEEQMQGLCIELNDFIVALAEVQPSAKREGFVTVPNVTWADIGALEDIRDELIMAILAPVRNPDQFRTLGLGTPAGILLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRAKNSAPCVIFFDEVDALCP---RRSDRETGASVRVVNQLLTEMDGLETRQQVFILAATNRPDIIDPAILRPGRLDKTLFVGLPPPADRVAILKTITKNGTKPPLDEDVNLETIANDLRCNCYTGADLTALVREASLCALRQEITAQKNGVGAGELK--------------VSHKHFEDAFKKVKPSISIKDQVMYEALQRSL 853          

HSP 2 Score: 174.866 bits (442), Expect = 2.865e-44
Identity = 91/238 (38.24%), Postives = 144/238 (60.50%), Query Frame = 3
Query: 1458 RETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGM---SAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAI 2162
            R T +++ NV +ED+GG     +E+ +++ + + HP+ +   G+ P +GVL +GPPGCGKTLLA AIA E     + +  PE+++   GESE  +R++FD+A   APC++F DE+D+I                R++ QLLT MD +   +A   V +IGATNRPD +D A+ R GR D+ + + +PDE +R +IL+   RK  + +  +  ++A +T GF GADL  +C+ A   A+
Sbjct:  252 RSTELQISNVKFEDVGGNDATLKEVCKMLIH-MRHPEVYQHLGVVPPRGVLLHGPPGCGKTLLAHAIAGELDLPILKVAAPEIVSGVSGESEQKLRELFDQAVSNAPCIVFIDEIDAITP---KREVASKDMERRIVAQLLTCMDDLNNVAATARVLVIGATNRPDSLDPALRRAGRFDREVCLGIPDEAARERILQTLCRKLRLPETFNFCHLAHLTPGFVGADLMALCREAAMCAV 485          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|P23787|TERA_XENLA (Transitional endoplasmic reticulum ATPase OS=Xenopus laevis OX=8355 GN=vcp PE=1 SV=3)

HSP 1 Score: 1328.15 bits (3436), Expect = 0.000e+0
Identity = 649/758 (85.62%), Postives = 712/758 (93.93%), Query Frame = 3
Query:   78 ASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +  K+DDL TAIL+ K++PNRLIV++ +N+DNS+VS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKRVHVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD+TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSR+ ILKANLRKSP+AKDVDV+++AK+T+GFSGADLTEICQRACK AIRE IE +IR  RD+Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    5 SDTKSDDLSTAILKQKSRPNRLIVDESINEDNSMVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRVHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSDDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSIKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRMAILKANLRKSPVAKDVDVDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERDRQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|Q6GL04|TERA_XENTR (Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis OX=8364 GN=vcp PE=2 SV=1)

HSP 1 Score: 1315.44 bits (3403), Expect = 0.000e+0
Identity = 648/758 (85.49%), Postives = 713/758 (94.06%), Query Frame = 3
Query:   78 ASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            + +K+DDL TAIL+ K++PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD+TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSP+AKDVD++++AK+T+GFSGADLTEICQRACK AIRE IE +IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    5 SDSKSDDLSTAILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSDDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKSPVAKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|Q7ZU99|TERA_DANRE (Transitional endoplasmic reticulum ATPase OS=Danio rerio OX=7955 GN=vcp PE=1 SV=1)

HSP 1 Score: 1311.59 bits (3393), Expect = 0.000e+0
Identity = 651/762 (85.43%), Postives = 714/762 (93.70%), Query Frame = 3
Query:   75 MAS---NKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            MAS   +KNDDL TAIL+ K +PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRETVCI L D+TC DEK+RMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGG RKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVPN+TWEDIGGL  VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG+VGDGGGAADRVINQ+LTEMDGMS+KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSPI+KDVD++++AK+T+GFSGADLTEICQRACK AIRE IE +IR  R++Q        ++ DPVPEI + HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    1 MASGGESKNDDLSTAILKQKNRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRRETVCIVLSDDTCSDEKVRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGVRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPNITWEDIGGLDDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRIAILKANLRKSPISKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERERQTNPSAMEVEEDDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|Q01853|TERA_MOUSE (Transitional endoplasmic reticulum ATPase OS=Mus musculus OX=10090 GN=Vcp PE=1 SV=4)

HSP 1 Score: 1304.27 bits (3374), Expect = 0.000e+0
Identity = 648/758 (85.49%), Postives = 710/758 (93.67%), Query Frame = 3
Query:   78 ASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            A +K DDL TAIL+ K +PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSR+ ILKANLRKSP+AKDVD+ ++AK+T+GFSGADLTEICQRACK AIRE IE++IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    5 ADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Match: sp|P55072|TERA_HUMAN (Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4)

HSP 1 Score: 1304.27 bits (3374), Expect = 0.000e+0
Identity = 648/758 (85.49%), Postives = 710/758 (93.67%), Query Frame = 3
Query:   78 ASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            A +K DDL TAIL+ K +PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSR+ ILKANLRKSP+AKDVD+ ++AK+T+GFSGADLTEICQRACK AIRE IE++IR  R++Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    5 ADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: A0A4E0R3E5 (Transitional endoplasmic reticulum ATPase OS=Fasciola hepatica OX=6192 GN=D915_008113 PE=3 SV=1)

HSP 1 Score: 1356.66 bits (3510), Expect = 0.000e+0
Identity = 680/820 (82.93%), Postives = 741/820 (90.37%), Query Frame = 3
Query:   75 MASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGN-DFSRGSATNQQSNIPVSVGGAGAGFNDVED--DLYD 2525
            M++ K    + A+L  K KPNRLIV+D V+DDNSVVSMSQ KMDELQLFRGDTVL+KGKKRR+TVCIAL+D+TCPDE+IR NRCVR NLRVRLGD+++VQ CP I YG+R+HVLPIDDTI G+TGN+YEV+LKPYFVEAYRPVRKDD+F+VRGGMRAVEFKVIETDPSPYCIVAPET+IH EGDPV R DE++KLNE+GYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTL+ARAVANE+GSFFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDRE++IGIPD+ GRLEILRIHTKN+RL DDVDLEQ+A+E HGHVGADLA+LC+EAALQQIRNKMDLIDLE+  IDAE+LNSLAVTM+DFRWAL+KSNPSALRETTVEVPNVTW+DIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAK+RGGSVGD GGAADRVINQLLTEMDGMS+KKNVFIIGATNRPDI+D AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSP+AKDVD+NY+AKVT GFSGADLTEICQRACKQAIRE IEA+IRA R++Q +    MED+ DPVPEITR+HFEEAM+YARRSVT+NDVRKYEMFAQTL                ++   GGN  F    AT      P S G  GA ++   D  DLY+
Sbjct:    1 MSNPKKSPADEALLGKKRKPNRLIVDDAVSDDNSVVSMSQAKMDELQLFRGDTVLIKGKKRRDTVCIALVDDTCPDERIRFNRCVRNNLRVRLGDIVTVQGCPEIGYGRRIHVLPIDDTIVGITGNLYEVYLKPYFVEAYRPVRKDDIFVVRGGMRAVEFKVIETDPSPYCIVAPETIIHTEGDPVKREDEEDKLNEIGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLVARAVANESGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREIEIGIPDSIGRLEILRIHTKNVRLADDVDLEQIANEAHGHVGADLASLCSEAALQQIRNKMDLIDLEDDTIDAEVLNSLAVTMDDFRWALTKSNPSALRETTVEVPNVTWDDIGGLENVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQLLTEMDGMSSKKNVFIIGATNRPDILDGAILRPGRLDQLIYIPLPDEKSRINILKANLRKSPVAKDVDLNYLAKVTQGFSGADLTEICQRACKQAIRESIEAEIRAERERQAR-PNAMEDESDPVPEITRRHFEEAMRYARRSVTENDVRKYEMFAQTL---------------QQSRGIGGNFRFPSEGATGPGGGRP-SAGAGGAPYDAHTDAEDLYN 803          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: A0A4S2LCV9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009748 PE=3 SV=1)

HSP 1 Score: 1352.42 bits (3499), Expect = 0.000e+0
Identity = 663/759 (87.35%), Postives = 716/759 (94.33%), Query Frame = 3
Query:   75 MASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            MA  K +  E  +   K KPNRLIV+DPVNDDNSVVS+SQ KMDELQLFRGDTVL+KGKKRR+TVCIAL+D+TCPD++IR NRCVR NLRVRLGD++++Q CP + YGKR+HVLPIDDTI G+TGN+YEV+LKPYFVEAYRPVRKDD+FIVRGGMRAVEFKVIETDPSPYCIVAPET+IH EGDPV R DEDEKLNE+GYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANE+GSFFFLINGPEIMSK+AGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNS+DPALRRFGRFDRE++IGIPD+ GRLEILRIHTKN++L DDVDLEQ+A+E HGHVGADLA+LC+EAALQQIRNKMDLIDLE+  IDAE+LNSLAVTM+DFRWAL KSNPSALRETTVEVPNVTW DIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAK+RGGSVGD GGAADRVINQLLTEMDGMS+KKNVFIIGATNRPDI+D AILRPGRLDQLIYIPLPDEKSRI I KANLRKSP+AKDVD+ Y+AKVT GFSGADLTEICQRACKQAIRE IEA+IRA R++Q +    MEDD DPVPEITR+HFEEAM++ARRSVT+NDVRKYEMFAQTL
Sbjct:    1 MAPAKREKAEDTMNIKKRKPNRLIVDDPVNDDNSVVSLSQAKMDELQLFRGDTVLIKGKKRRDTVCIALVDDTCPDDRIRFNRCVRNNLRVRLGDIVTIQGCPEVGYGKRIHVLPIDDTIVGITGNLYEVYLKPYFVEAYRPVRKDDIFIVRGGMRAVEFKVIETDPSPYCIVAPETIIHTEGDPVKREDEDEKLNEIGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANESGSFFFLINGPEIMSKMAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSVDPALRRFGRFDREIEIGIPDSIGRLEILRIHTKNVKLADDVDLEQIANEAHGHVGADLASLCSEAALQQIRNKMDLIDLEDDTIDAEVLNSLAVTMDDFRWALGKSNPSALRETTVEVPNVTWSDIGGLENVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQLLTEMDGMSSKKNVFIIGATNRPDILDGAILRPGRLDQLIYIPLPDEKSRISIFKANLRKSPVAKDVDIAYLAKVTQGFSGADLTEICQRACKQAIRESIEAEIRAERERQARPN-AMEDDSDPVPEITRRHFEEAMRFARRSVTENDVRKYEMFAQTL 758          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: A0A1S8WPB3 (Cell division control protein 48 OS=Opisthorchis viverrini OX=6198 GN=X801_07945 PE=3 SV=1)

HSP 1 Score: 1350.88 bits (3495), Expect = 0.000e+0
Identity = 659/743 (88.69%), Postives = 710/743 (95.56%), Query Frame = 3
Query:  123 KAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            K KPNRLIV+DPVNDDNSVVS+SQ KMDELQLFRGDTVL+KGKKRR+TVCIAL+D+TCPD++IR NRCVR NLRVRLGD++++Q CP + YGKR+HVLPIDDTI G+TGN+YEV+LKPYFVEAYRPVRKDD+FIVRGGMRAVEFKVIETDPSPYCIVAPET+IH EGDPV R DEDEKLNE+GYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANE+GSFFFLINGPEIMSK+AGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNS+DPALRRFGRFDRE++IGIPD+ GRLEILRIHTKN++L DDVDLEQ+A+E HGHVGADLA+LC+EAALQQIRNKMDLIDLE+  IDAE+LNSLAVTM+DFRWAL KSNPSALRETTVEVPNVTW DIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAK+RGGSVGD GGAADRVINQLLTEMDGMS+KKNVFIIGATNRPDI+D AILRPGRLDQLIYIPLPDEKSRI I KANLRKSP+AKDVD+ Y+AKVT GFSGADLTEICQRACKQAIRE IEA+IRA R++Q +    MEDD DPVPEITR+HFEEAM++ARRSVT+NDVRKYEMFAQTL
Sbjct:    5 KRKPNRLIVDDPVNDDNSVVSLSQAKMDELQLFRGDTVLIKGKKRRDTVCIALVDDTCPDDRIRFNRCVRNNLRVRLGDIVTIQGCPEVGYGKRIHVLPIDDTIVGITGNLYEVYLKPYFVEAYRPVRKDDIFIVRGGMRAVEFKVIETDPSPYCIVAPETIIHTEGDPVKREDEDEKLNEIGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANESGSFFFLINGPEIMSKMAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSVDPALRRFGRFDREIEIGIPDSIGRLEILRIHTKNVKLADDVDLEQIANEAHGHVGADLASLCSEAALQQIRNKMDLIDLEDDTIDAEVLNSLAVTMDDFRWALGKSNPSALRETTVEVPNVTWSDIGGLENVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQLLTEMDGMSSKKNVFIIGATNRPDILDGAILRPGRLDQLIYIPLPDEKSRISIFKANLRKSPVAKDVDIAYLAKVTQGFSGADLTEICQRACKQAIRESIEAEIRAERERQARPNA-MEDDSDPVPEITRRHFEEAMRFARRSVTENDVRKYEMFAQTL 746          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: A0A5J4NGB2 (Transitional endoplasmic reticulum ATPase OS=Paragonimus westermani OX=34504 GN=DEA37_0009159 PE=3 SV=1)

HSP 1 Score: 1340.1 bits (3467), Expect = 0.000e+0
Identity = 655/756 (86.64%), Postives = 716/756 (94.71%), Query Frame = 3
Query:   84 NKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
             + DD+   ++  K KPNRLIV+D +NDDNSVVS+SQ KMDELQLFRGDTVL+KGKKRR+TVCIAL+D+TC D++IR NRCVR NLRVRLGD++++Q CP + YG+R+HVLPIDDTI G+TGN+YEV+LKPYFVEAYRPVRKDD+F+VRGGMRAVEFKVIETDPSPYCIVAPET+IH EGDPV R +ED+KLNE+GYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANE+GSFFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDRE++I IPD+TGRLEILRIHTKN++L DDVDLEQ+A+E HGHVGADLA+LC+EAALQQIRNKMDLIDLE+  IDAE+LNSLAVTM+DFRWAL KSNPSALRETTVEVPNVTW+DIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRD+FDKARQAAPCVLFFDELDSIAK+RGGSVGD GGAADRVINQLLTEMDGMS+KKNVFIIGATNRPDI+D AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSPIAKDVD+ Y+AKVT GFSGADLTEICQRACKQAIRE IEA+IRA R++Q +    MED+ DPVPEITR+HFEEAM++ARRSVT+NDVRKYEMF+QTL
Sbjct:    6 TQQDDI---LVSKKRKPNRLIVDDAINDDNSVVSLSQAKMDELQLFRGDTVLIKGKKRRDTVCIALVDDTCLDDRIRFNRCVRSNLRVRLGDIVTIQGCPEVGYGRRIHVLPIDDTIVGITGNLYEVYLKPYFVEAYRPVRKDDIFVVRGGMRAVEFKVIETDPSPYCIVAPETIIHTEGDPVKREEEDDKLNEIGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANESGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREIEISIPDSTGRLEILRIHTKNIKLADDVDLEQIANEAHGHVGADLASLCSEAALQQIRNKMDLIDLEDDTIDAEVLNSLAVTMDDFRWALGKSNPSALRETTVEVPNVTWDDIGGLENVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDLFDKARQAAPCVLFFDELDSIAKARGGSVGDAGGAADRVINQLLTEMDGMSSKKNVFIIGATNRPDILDGAILRPGRLDQLIYIPLPDEKSRINILKANLRKSPIAKDVDLGYLAKVTQGFSGADLTEICQRACKQAIRESIEAEIRAERERQARPN-AMEDESDPVPEITRRHFEEAMRFARRSVTENDVRKYEMFSQTL 757          
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Match: A0A1L8HSA2 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18011173mg PE=1 SV=1)

HSP 1 Score: 1329.31 bits (3439), Expect = 0.000e+0
Identity = 650/758 (85.75%), Postives = 712/758 (93.93%), Query Frame = 3
Query:   78 ASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +  K+DDL TAIL+ K++PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVLLKGKKRRE VCI L D+TC DEKIRMNR VR NLRVRLGDVIS+QPCP++ YGKRVHVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD+TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DFRWALS+SNPSALRET VEVP VTWEDIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG++GDGGGAADRVINQ+LTEMDGMS KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSR+ ILKANLRKSP+AKDVDV+++AK+T+GFSGADLTEICQRACK AIRE IE +IR  RD+Q        ++ DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    5 SDTKSDDLSTAILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRVHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSDDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSIKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRMAILKANLRKSPVAKDVDVDFLAKMTNGFSGADLTEICQRACKLAIRESIENEIRRERDRQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 762          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: zgc:136908 (zgc:136908 [Source:ZFIN;Acc:ZDB-GENE-060312-22])

HSP 1 Score: 1145.57 bits (2962), Expect = 0.000e+0
Identity = 566/717 (78.94%), Postives = 641/717 (89.40%), Query Frame = 3
Query:  201 MDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            M+ELQLFRGDTV+++G+KRR+TVCI L D+TC DE+IRMNR  R NLRVRLGDVIS+  CP++ YGKR+HVLPIDDTIEG+TGN++EVFLKPYF+EAYRPV K D+F+VRGGMRAVEFKV+ETDP+P+CIVAP+T+IH EG+P+ R        EV Y   G  R     +   + + L+H +LF +  V PPRGILLYGPPGTGKTL+ARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR HV+VMAATNRPNS+DPALRRFGRFDRE+DIGIPD+TGRLEIL+IHTKNM+L DDVDLE++A++THGHVGADLAALC+EAALQ IR KM LIDLE+  IDA++LNSLAVTM+DFRWALS+SNPSALRET VEVP V WEDIGGL  VKRELQELVQYPVE+PDKFLKFGMTPS+GVLFYGPPGCGKTLLAKAIANECQANF+SIKGPELLTMWFGESEANVRD+FDKARQAAPC+LFFDELDSIAKSRGG  GD GGAADRVINQ+LTEMDGM+ KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPD  SR  IL+ANLRKSP+AK+VD+ Y++++T GFSGADLTEICQRACK AIRE IEA+IRA R++Q + G   +DD DPVPEI + HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    1 MEELQLFRGDTVVMRGRKRRQTVCIVLTDDTCGDERIRMNRVTRNNLRVRLGDVISINACPDVKYGKRIHVLPIDDTIEGLTGNLFEVFLKPYFLEAYRPVHKGDIFLVRGGMRAVEFKVVETDPTPHCIVAPDTIIHCEGEPIKR--------EVVY---GFGRYSFVMLFYTLCVTLQHARLFSSKRV-PPRGILLYGPPGTGKTLVARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRVHVVVMAATNRPNSVDPALRRFGRFDREIDIGIPDSTGRLEILQIHTKNMKLADDVDLERIATDTHGHVGADLAALCSEAALQAIRKKMTLIDLEDETIDADLLNSLAVTMDDFRWALSQSNPSALRETVVEVPQVNWEDIGGLDEVKRELQELVQYPVEYPDKFLKFGMTPSRGVLFYGPPGCGKTLLAKAIANECQANFVSIKGPELLTMWFGESEANVRDVFDKARQAAPCILFFDELDSIAKSRGGGAGDAGGAADRVINQILTEMDGMTNKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDMPSRTAILRANLRKSPVAKEVDLPYLSRITEGFSGADLTEICQRACKLAIREAIEAEIRAERERQSRKG--TDDDYDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTL 703          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: SPATA5 (spermatogenesis associated 5 [Source:HGNC Symbol;Acc:HGNC:18119])

HSP 1 Score: 494.967 bits (1273), Expect = 5.389e-160
Identity = 249/593 (41.99%), Postives = 371/593 (62.56%), Query Frame = 3
Query:  582 YCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSH---VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDV-DLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEI-DAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQ 2345
            Y I     +      P    D+ ++ ++V Y  IGG   QLA I+E +ELPL+HP++F+  G+ PPRG+LLYGPPGTGKT+I RAVANE G+   +INGPEIMSK  GE+E+ LR+ F EA +  PAIIFIDELDA+ PKRE    EVE+R+V+ LLTLMDG+    H   ++V+ ATNRP+++DPALRR GRFD+E+++G+P   GR++IL+   +++       +L+++A   HG+VGADLAA+C EA L  +R  +       P + D E+++ + VT  D R A+    PSA+RE  ++VP V W D+GG++ VK +L++ V++P++HP+ F + G+ P KGVL YGPPGC KT++AKA+ANE Q NF++IKGPELL+ + GESE  VR++F KAR  AP ++FFDE+D++A             +   I+ LL +   +S    +     TNRP     A++RPGRLD+++Y+PLPD  +R +I     R  P+   V ++ +   T  +SGA++T +C+ A   A++E I+A+                        IT +HF+ A+   +  V ++ ++ Y  + Q
Sbjct:  296 YSICCSTRLSFTHSQPQTTEDQGQERSKVTYSMIGGLSAQLAAIRETIELPLKHPEIFRKYGIPPPRGVLLYGPPGTGKTMIGRAVANEVGAHMTVINGPEIMSKFYGETEARLRQIFAEASQKQPAIIFIDELDALCPKREGAQNEVEKRVVASLLTLMDGIGSEGHSGQLLVLGATNRPHALDPALRRPGRFDKELEVGVPAAEGRMDILQKQLRSVPCEISTEELQELADAAHGYVGADLAAVCKEAGLHALRRVLG----SAPGLCDPEVMDRVKVTASDLRLAMKHVKPSAMREVAIDVPKVRWSDVGGMEDVKLKLKQAVEWPLKHPEAFARLGIAPPKGVLLYGPPGCSKTMIAKALANESQLNFLAIKGPELLSKYVGESERAVREVFRKARTVAPSIVFFDEIDALA-----VERGRYDISHSFIHSLLFQNKPVSNVNTLH----TNRP-----ALMRPGRLDRIVYVPLPDSATRREIFSLQFRSMPVHSSVHLDDLVTRTERYSGAEITAVCREAALFALQEDIKAE-----------------------HITDRHFDSALSAIKPRVPESLIQTYISYQQ 847          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: pex6 (peroxisomal biogenesis factor 6 [Source:NCBI gene;Acc:103034831])

HSP 1 Score: 274.248 bits (700), Expect = 2.031e-76
Identity = 183/526 (34.79%), Postives = 296/526 (56.27%), Query Frame = 3
Query:  786 ILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEI-LNSLAVTM--EDFRWALSKSNPSALRETTV-EVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLP-DEKSRIQILKANLRKSPIAKDVDV-NYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQ 2345
            +LL GP G+GK    +A           ++   +    A   ES ++ AF  AE + P ++ +  L  ++ +R+ T  E++ R+VS L  L+      S VIV+ + N    +   +     F  ++ +  P    R  +L   ++++ LG DV L ++A +T G V  D  AL T A     R  +++   +     +E+ L    VT+   DF  AL     +  +     ++P+V W+D+GGLQ VK+E+ + +Q P+EHP+  L        G+L YGPPG GKTLLAKA+A+EC   F+S+KGPEL+ M+ G+SE N+R++F KAR AAPCV+FFDELDS+A    G  GD GG  DRV++QLL E+DG+ +  +VF+IGATNRPD++D ++LRPGR D+L+Y+ +  D ++++Q+LKA +RK  +   V + + + +     +GADL  +C  A   AI+  I   +R +   +L+  E M         +  + F +A+   + SV++ +++KY++  Q
Sbjct:  623 VLLIGPHGSGKVTAVKAACRRLHLHLLKVDCVTLCGDTAAACESKMKAAFHRAEVHHPCVLLLRNLQLLSQRRDGT--EMDSRVVSALCQLLT--DAHSSVIVVGSVNDQQEVSSDV--IPAFVHQMTLESPSEEQRKAMLSSLSEDLTLGKDVSLAKLAKQTAGFVLGDFCALLTRAGKAAHRRLLEIYYPQGGSAQSEMDLCDCGVTIMSADFTAALDSLQEAHSQAIGAPKIPSVRWQDVGGLQQVKKEILDTIQLPLEHPE--LLPLGLRRSGLLLYGPPGTGKTLLAKAVASECSLTFLSVKGPELINMYVGQSEENIREVFSKARAAAPCVIFFDELDSLAP-NRGRSGDSGGVMDRVVSQLLAELDGLHSSNDVFVIGATNRPDLLDQSLLRPGRFDKLVYVGISEDREAQLQVLKAIVRKFKVDPKVSLSDIVGRCPPQLTGADLYALCSDAMMSAIKRKI---LRISEGLELEKDELM---------LCAEDFSQALDVLQPSVSEQELQKYKLIQQ 1127          

HSP 2 Score: 173.711 bits (439), Expect = 1.147e-43
Identity = 105/274 (38.32%), Postives = 162/274 (59.12%), Query Frame = 3
Query:  654 KLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKT--HGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIP-DTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHV-GADLAALCTEAALQQIRNKM----DLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPS 1451
            K+  V + D+GG ++   +I + ++LPL HP+L      +   G+LLYGPPGTGKTL+A+AVA+E    F  + GPE+++   G+SE N+R+ F +A   +P +IF DELD++AP R ++   G V  R+VSQLL  +DGL   + V V+ ATNRP+ +D +L R GRFD+ V +GI  D   +L++L+   +  ++   V L  +       + GADL ALC++A +  I+ K+    + ++LE+ E        L +  EDF  AL    PS
Sbjct:  850 KIPSVRWQDVGGLQQVKKEILDTIQLPLEHPELLPLGLRR--SGLLLYGPPGTGKTLLAKAVASECSLTFLSVKGPELINMYVGQSEENIREVFSKARAAAPCVIFFDELDSLAPNRGRSGDSGGVMDRVVSQLLAELDGLHSSNDVFVIGATNRPDLLDQSLLRPGRFDKLVYVGISEDREAQLQVLKAIVRKFKVDPKVSLSDIVGRCPPQLTGADLYALCSDAMMSAIKRKILRISEGLELEKDE--------LMLCAEDFSQALDVLQPS 1113          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: nvl (nuclear VCP like [Source:NCBI gene;Acc:103033742])

HSP 1 Score: 255.373 bits (651), Expect = 7.824e-71
Identity = 141/331 (42.60%), Postives = 199/331 (60.12%), Query Frame = 3
Query: 1374 IDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLR---KSPIAKDVDVNYMA--KVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +  E L  L + M+DF+ +L+   PSA RE    VP+VTW+DIG LQ ++ EL   +  PV  P++F   G++   GVL  GPPGCGKTLLAKA+ANE   NFIS+KGPELL M+ GESE  VR +F + R +APCV+FFDE+D++        G   GA+ RV+NQLLTEMDG+  ++ VFI+ ATNRPDIID A+LRPGRLD+ +Y+ LP    R  IL    +   K  +  DV +  +A  +    F+GADL+ + + A   A++  + +       +       ++D       ++R++FEEA K  R SV+  D   YE   ++L
Sbjct:  600 LSEEQLAGLCILMDDFKASLASVQPSAKREGFATVPDVTWDDIGALQDIREELTMAILAPVRSPEQFKALGLSAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCP---RRSGHESGASVRVVNQLLTEMDGLETRRQVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLPPPADRHAILLTITKGGMKPRLESDVSLEAIASDERCDCFTGADLSALVREASVNALKSHLSSKTPLTHTEHTFSSGSVKDI-----RVSRQNFEEAFKKVRPSVSKKDQLMYEKLRESL 922          

HSP 2 Score: 233.802 bits (595), Expect = 1.668e-63
Identity = 119/239 (49.79%), Postives = 169/239 (70.71%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRS---HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPE 1373
            V ++D+GG  + L ++ +++ + +RHP++++ +GV PPRG LL+GPPG GKTL+A+AVA E       ++ PE++S ++GESE  LR+ F++A  N+P I+FIDE+DAI PKRE    ++ERRIV+QLLT MD L   S    V+V+ ATNRP+S+DPALRR GRFDRE+ +GIPD   RL IL+   + +RL  D D  Q+A  T G+VGADL ALC EAA+  + N++ L  LE P+
Sbjct:  273 VKFEDVGGNEETLTELCKLL-IHMRHPEVYQQLGVVPPRGFLLHGPPGCGKTLLAQAVAGEMELPMLKVSAPELVSGVSGESEQKLRELFDQAVSNAPCILFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNSLSVPAQVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEGTRLRILQTLCRKLRLPVDFDFRQLARLTPGYVGADLMALCREAAMSAV-NRVLLQRLETPD 509          

HSP 3 Score: 196.052 bits (497), Expect = 4.197e-51
Identity = 107/271 (39.48%), Postives = 160/271 (59.04%), Query Frame = 3
Query:  663 EVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM---RLGDDVDLEQVASETH--GHVGADLAALCTEAALQQIRNKMDL---IDLEEPEIDAEILNSLAVTMEDFRWALSKSNPS 1451
            +V +DDIG  +    ++   +  P+R P+ FKA+G+  P G+LL GPPG GKTL+A+AVANE+G  F  + GPE+++   GESE  +R+ F+    ++P +IF DE+DA+ P+R         R+V+QLLT MDGL+ R  V +MAATNRP+ IDPA+ R GR D+ + +G+P    R  IL   TK     RL  DV LE +AS+       GADL+AL  EA++  +++ +     +   E    +  +  + V+ ++F  A  K  PS
Sbjct:  636 DVTWDDIGALQDIREELTMAILAPVRSPEQFKALGLSAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCPRRSGHESGASVRVVNQLLTEMDGLETRRQVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLPPPADRHAILLTITKGGMKPRLESDVSLEAIASDERCDCFTGADLSALVREASVNALKSHLSSKTPLTHTEHTFSSGSVKDIRVSRQNFEEAFKKVRPS 906          

HSP 4 Score: 177.563 bits (449), Expect = 4.348e-45
Identity = 92/230 (40.00%), Postives = 140/230 (60.87%), Query Frame = 3
Query: 1482 NVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMD---GMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAI 2162
             V +ED+GG +    EL +L+ + + HP+ + + G+ P +G L +GPPGCGKTLLA+A+A E +   + +  PEL++   GESE  +R++FD+A   APC+LF DE+D+I                R++ QLLT MD    +S    V +IGATNRPD +D A+ R GR D+ I + +PDE +R++IL+   RK  +  D D   +A++T G+ GADL  +C+ A   A+
Sbjct:  272 TVKFEDVGGNEETLTELCKLLIH-MRHPEVYQQLGVVPPRGFLLHGPPGCGKTLLAQAVAGEMELPMLKVSAPELVSGVSGESEQKLRELFDQAVSNAPCILFIDEIDAITP---KREVASKDMERRIVAQLLTCMDDLNSLSVPAQVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEGTRLRILQTLCRKLRLPVDFDFRQLARLTPGYVGADLMALCREAAMSAV 497          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Match: nvl (nuclear VCP like [Source:NCBI gene;Acc:103033742])

HSP 1 Score: 255.373 bits (651), Expect = 7.824e-71
Identity = 141/331 (42.60%), Postives = 199/331 (60.12%), Query Frame = 3
Query: 1374 IDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLR---KSPIAKDVDVNYMA--KVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +  E L  L + M+DF+ +L+   PSA RE    VP+VTW+DIG LQ ++ EL   +  PV  P++F   G++   GVL  GPPGCGKTLLAKA+ANE   NFIS+KGPELL M+ GESE  VR +F + R +APCV+FFDE+D++        G   GA+ RV+NQLLTEMDG+  ++ VFI+ ATNRPDIID A+LRPGRLD+ +Y+ LP    R  IL    +   K  +  DV +  +A  +    F+GADL+ + + A   A++  + +       +       ++D       ++R++FEEA K  R SV+  D   YE   ++L
Sbjct:  600 LSEEQLAGLCILMDDFKASLASVQPSAKREGFATVPDVTWDDIGALQDIREELTMAILAPVRSPEQFKALGLSAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCP---RRSGHESGASVRVVNQLLTEMDGLETRRQVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLPPPADRHAILLTITKGGMKPRLESDVSLEAIASDERCDCFTGADLSALVREASVNALKSHLSSKTPLTHTEHTFSSGSVKDI-----RVSRQNFEEAFKKVRPSVSKKDQLMYEKLRESL 922          

HSP 2 Score: 233.802 bits (595), Expect = 1.668e-63
Identity = 119/239 (49.79%), Postives = 169/239 (70.71%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRS---HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPE 1373
            V ++D+GG  + L ++ +++ + +RHP++++ +GV PPRG LL+GPPG GKTL+A+AVA E       ++ PE++S ++GESE  LR+ F++A  N+P I+FIDE+DAI PKRE    ++ERRIV+QLLT MD L   S    V+V+ ATNRP+S+DPALRR GRFDRE+ +GIPD   RL IL+   + +RL  D D  Q+A  T G+VGADL ALC EAA+  + N++ L  LE P+
Sbjct:  273 VKFEDVGGNEETLTELCKLL-IHMRHPEVYQQLGVVPPRGFLLHGPPGCGKTLLAQAVAGEMELPMLKVSAPELVSGVSGESEQKLRELFDQAVSNAPCILFIDEIDAITPKREVASKDMERRIVAQLLTCMDDLNSLSVPAQVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEGTRLRILQTLCRKLRLPVDFDFRQLARLTPGYVGADLMALCREAAMSAV-NRVLLQRLETPD 509          

HSP 3 Score: 196.052 bits (497), Expect = 4.197e-51
Identity = 107/271 (39.48%), Postives = 160/271 (59.04%), Query Frame = 3
Query:  663 EVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM---RLGDDVDLEQVASETH--GHVGADLAALCTEAALQQIRNKMDL---IDLEEPEIDAEILNSLAVTMEDFRWALSKSNPS 1451
            +V +DDIG  +    ++   +  P+R P+ FKA+G+  P G+LL GPPG GKTL+A+AVANE+G  F  + GPE+++   GESE  +R+ F+    ++P +IF DE+DA+ P+R         R+V+QLLT MDGL+ R  V +MAATNRP+ IDPA+ R GR D+ + +G+P    R  IL   TK     RL  DV LE +AS+       GADL+AL  EA++  +++ +     +   E    +  +  + V+ ++F  A  K  PS
Sbjct:  636 DVTWDDIGALQDIREELTMAILAPVRSPEQFKALGLSAPAGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCPRRSGHESGASVRVVNQLLTEMDGLETRRQVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLPPPADRHAILLTITKGGMKPRLESDVSLEAIASDERCDCFTGADLSALVREASVNALKSHLSSKTPLTHTEHTFSSGSVKDIRVSRQNFEEAFKKVRPS 906          

HSP 4 Score: 177.563 bits (449), Expect = 4.348e-45
Identity = 92/230 (40.00%), Postives = 140/230 (60.87%), Query Frame = 3
Query: 1482 NVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMD---GMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAI 2162
             V +ED+GG +    EL +L+ + + HP+ + + G+ P +G L +GPPGCGKTLLA+A+A E +   + +  PEL++   GESE  +R++FD+A   APC+LF DE+D+I                R++ QLLT MD    +S    V +IGATNRPD +D A+ R GR D+ I + +PDE +R++IL+   RK  +  D D   +A++T G+ GADL  +C+ A   A+
Sbjct:  272 TVKFEDVGGNEETLTELCKLLIH-MRHPEVYQQLGVVPPRGFLLHGPPGCGKTLLAQAVAGEMELPMLKVSAPELVSGVSGESEQKLRELFDQAVSNAPCILFIDEIDAITP---KREVASKDMERRIVAQLLTCMDDLNSLSVPAQVLVIGATNRPDSLDPALRRAGRFDREICLGIPDEGTRLRILQTLCRKLRLPVDFDFRQLARLTPGYVGADLMALCREAAMSAV 497          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 334/406 (82.27%), Postives = 367/406 (90.39%), Query Frame = 3
Query: 1146 GRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPME----DDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            GRFDREVDIGIPD+TGRLEIL+IHTKNM+L  DVDLEQ+A++THGHVGADLAALC+EAALQ IR KMD+IDL++  IDAEI+NSLAVTM+DFRWAL++SNPSALRE  VEVPNVTWEDIGGL+ VKRELQELVQYPVEHP+KFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRD+FDKARQA+P VLF DELDSIAK+RGG VGDGGGAADRVINQ+LTEMDGM   KNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSR  ILKANLRKSPIAKDVD+ Y++K T+GFSGADL EICQRACK AIRE IEA++R  R++Q      M     +D DPVPEI R HFEEAM++ARRSV+DND+RKYEMFAQTL
Sbjct:    1 GRFDREVDIGIPDSTGRLEILQIHTKNMKLSVDVDLEQIANQTHGHVGADLAALCSEAALQAIRKKMDVIDLDDETIDAEIMNSLAVTMDDFRWALAQSNPSALREMVVEVPNVTWEDIGGLESVKRELQELVQYPVEHPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQASPTVLFLDELDSIAKARGGGVGDGGGAADRVINQILTEMDGMGVNKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRTAILKANLRKSPIAKDVDIGYLSKTTNGFSGADLMEICQRACKLAIRESIEAEMRRERERQGNPDAAMNRQDVEDEDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTL 406          

HSP 2 Score: 190.66 bits (483), Expect = 7.691e-53
Identity = 93/230 (40.43%), Postives = 144/230 (62.61%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKR---EKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKM 1346
            V ++DIGG      +++E+V+ P+ HP+ F   G+ P +G+L YGPPG GKTL+A+A+ANE  + F  I GPE+++   GESE+N+R  F++A + SP ++F+DELD+IA  R       G    R+++Q+LT MDG+    +V ++ ATNRP+ IDPA+ R GR D+ + I +PD   R  IL+ + +   +  DVD+  ++  T+G  GADL  +C  A    IR  +
Sbjct:  114 VTWEDIGGLESVKRELQELVQYPVEHPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQASPTVLFLDELDSIAKARGGGVGDGGGAADRVINQILTEMDGMGVNKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRTAILKANLRKSPIAKDVDIGYLSKTTNGFSGADLMEICQRACKLAIRESI 343          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 293/325 (90.15%), Postives = 310/325 (95.38%), Query Frame = 3
Query: 1095 MAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAK 2069
            MAATNRPNSIDPALRRFGRFDREVDIGIPD+TGRLEIL+IHTKNM+L  DVDLEQV +ETHGHVGADLAALC+EAALQ IR KMD+IDLE+  IDAEI+NSLAVTM+DFRWAL +SNPSALRET VEVPNVTWEDIGGL+ VKRELQELVQYPVEHP+KFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRD+FDKARQAAPCVLFFDELDSIAK+RGG+VGDGGGAADRVINQ+LTEMDGM  KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSR  ILKAN+RKSPIAK
Sbjct:    1 MAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSSDVDLEQVGNETHGHVGADLAALCSEAALQAIRKKMDVIDLEDETIDAEIMNSLAVTMDDFRWALGQSNPSALRETVVEVPNVTWEDIGGLESVKRELQELVQYPVEHPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMGTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRSAILKANVRKSPIAK 325          

HSP 2 Score: 168.318 bits (425), Expect = 2.871e-46
Identity = 79/189 (41.80%), Postives = 125/189 (66.14%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVER---RIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTK 1223
            V ++DIGG      +++E+V+ P+ HP+ F   G+ P +G+L YGPPG GKTL+A+A+ANE  + F  I GPE+++   GESE+N+R  F++A + +P ++F DELD+IA  R    G+      R+++Q+LT MDG+  + +V ++ ATNRP+ IDPA+ R GR D+ + I +PD   R  IL+ + +
Sbjct:  131 VTWEDIGGLESVKRELQELVQYPVEHPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMGTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRSAILKANVR 319          

HSP 3 Score: 71.633 bits (174), Expect = 1.757e-13
Identity = 34/82 (41.46%), Postives = 51/82 (62.20%), Query Frame = 3
Query: 1923 IGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRE 2168
            + ATNRP+ ID A+ R GR D+ + I +PD   R++IL+ + +   ++ DVD+  +   THG  GADL  +C  A  QAIR+
Sbjct:    1 MAATNRPNSIDPALRRFGRFDREVDIGIPDSTGRLEILQIHTKNMKLSSDVDLEQVGNETHGHVGADLAALCSEAALQAIRK 82          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: nvl (nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-2871])

HSP 1 Score: 412.92 bits (1060), Expect = 2.103e-133
Identity = 232/540 (42.96%), Postives = 325/540 (60.19%), Query Frame = 3
Query:  870 INGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAA------------------------------LQQIRNKMDLIDLEEPE-----------IDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLR---KSPIAKDVDVNYMA--KVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            + GPE++S ++GESE  LR+ F+ A +++P ++F+DE+DAI PKRE    ++ERR+V+QLLT MDGL     V+ + ATNRP+++DPALRR GRFDRE+ +GIPD   R  IL +  + +RL ++ + +++A  T G+VGADL +LC EAA                              L+ +RN++      E E           +  E+L+SL +   DF  ALS   PSA RE    VP+VTW+DIG L+ ++ EL   +  P+ HP+ F   G+T   G+L  GPPGCGKT+LAKAIANE   NFIS+KGPELL M+ GESE  VR +F +AR +APCV+FFDE+D+I            GA+ RV+NQLLTEMDG+ A+K VFI+ ATNRPDI+D A+LRPGRLD+ +Y+ LP    R  IL+   R   K P+ KDVD+N +A    + GFSGADL  + + A   A+R  + AD              ++ D D +  ++RK F+ A +  + SV+  D   YE   ++L
Sbjct:    9 VAGPEVVSGVSGESEQKLRELFQVASESAPCVLFLDEIDAITPKREMASKDMERRLVAQLLTCMDGLHGGGAVLCIGATNRPDALDPALRRAGRFDREICLGIPDENARERILLVLCRGLRLKEEFNFKRLARLTPGYVGADLMSLCREAAASAVNRALHAIDVAPTQNPAVEPDPAKAQGLETLRNQLPFAKASELERALRWLRDPSPLPPEVLHSLFLETCDFEVALSCVQPSAKREGFATVPDVTWDDIGALEAIREELSLAILAPIRHPEMFQVLGLTSPAGILLAGPPGCGKTMLAKAIANESGLNFISVKGPELLNMYVGESERAVRQVFQRARNSAPCVIFFDEIDAICP---RRSDHESGASVRVVNQLLTEMDGLEARKQVFIMAATNRPDILDRAVLRPGRLDKTLYVGLPVMAERAAILRTLTRGGTKPPLEKDVDLNVIAGDGRSDGFSGADLQALTREAAIGALRRHLMAD------------RWVKADTDII--VSRKDFDYAFEKVKPSVSKQDREVYEQLKKSL 531          

HSP 2 Score: 198.749 bits (504), Expect = 1.004e-54
Identity = 107/272 (39.34%), Postives = 163/272 (59.93%), Query Frame = 3
Query:  663 EVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMR---LGDDVDLEQVASE--THGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRE 1463
            +V +DDIG       ++   +  P+RHP++F+ +G+  P GILL GPPG GKT++A+A+ANE+G  F  + GPE+++   GESE  +R+ F+ A  ++P +IF DE+DAI P+R         R+V+QLLT MDGL+ R  V +MAATNRP+ +D A+ R GR D+ + +G+P    R  ILR  T+      L  DVDL  +A +  + G  GADL AL  EAA+  +R  +    + +  + A+    + V+ +DF +A  K  PS  ++
Sbjct:  254 DVTWDDIGALEAIREELSLAILAPIRHPEMFQVLGLTSPAGILLAGPPGCGKTMLAKAIANESGLNFISVKGPELLNMYVGESERAVRQVFQRARNSAPCVIFFDEIDAICPRRSDHESGASVRVVNQLLTEMDGLEARKQVFIMAATNRPDILDRAVLRPGRLDKTLYVGLPVMAERAAILRTLTRGGTKPPLEKDVDLNVIAGDGRSDGFSGADLQALTREAAIGALRRHL----MADRWVKAD--TDIIVSRKDFDYAFEKVKPSVSKQ 519          

HSP 3 Score: 118.627 bits (296), Expect = 5.118e-28
Identity = 65/172 (37.79%), Postives = 98/172 (56.98%), Query Frame = 3
Query: 1665 ECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEA 2180
            E     I + GPE+++   GESE  +R++F  A ++APCVLF DE+D+I   R  +  D        + QLLT MDG+     V  IGATNRPD +D A+ R GR D+ I + +PDE +R +IL    R   + ++ +   +A++T G+ GADL  +C+ A   A+   + A
Sbjct:    1 ELDVPLIQVAGPEVVSGVSGESEQKLRELFQVASESAPCVLFLDEIDAITPKREMASKDMERRL---VAQLLTCMDGLHGGGAVLCIGATNRPDALDPALRRAGRFDREICLGIPDENARERILLVLCRGLRLKEEFNFKRLARLTPGYVGADLMSLCREAAASAVNRALHA 169          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001672.1 (pep scaffold:Pmarinus_7.0:GL489293:318:4695:-1 gene:ENSPMAG00000001510.1 transcript:ENSPMAT00000001672.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 303.908 bits (777), Expect = 4.566e-97
Identity = 140/187 (74.87%), Postives = 168/187 (89.84%), Query Frame = 3
Query:   78 ASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVR 638
            AS    D+ TAIL+ K +PNRL+V++ +N+DNSVVS+SQ KMDELQLFRGDTV+LKGKKRRETVCI L D+TC DEKIRMNR VR NLRVRLGDV+S+Q CP++ YGKRVHVLPIDDT+EG+TGN++EV+LKPYF+EAYRPVRK D+F+VRGGMRAVEFKV+ETDPSP+CIVAP+TVIH EG+P+ R
Sbjct:    2 ASLPPSDVSTAILKQKQRPNRLVVDEAINEDNSVVSLSQPKMDELQLFRGDTVMLKGKKRRETVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVVSIQACPDVKYGKRVHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPVRKGDIFLVRGGMRAVEFKVVETDPSPFCIVAPDTVIHCEGEPINR 188          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Match: atad2b (ATPase family AAA domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-110411-210])

HSP 1 Score: 217.624 bits (553), Expect = 1.568e-59
Identity = 117/275 (42.55%), Postives = 166/275 (60.36%), Query Frame = 3
Query:  660 NEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGS-----FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHT-KNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLI--DLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALR 1460
            + +G+  IGG  + +  +KEM+  PL +P++F+   ++PPRG L +GPPGTGKTL+ARA+ANE         FF+  G + +SK  GESE  LR  F++A    P+IIF DE+D +AP R     ++   IVS LL LMDGL  R  ++V+ ATNR +SIDPALRR GRFDRE    +PD   R +IL IHT K      +  ++++A +  G+ GAD+ ALCTEA L  +R +   I    E   ID    +S++V   DF+ A+    P++ R
Sbjct:   79 SSIGFHSIGGLSRHIQALKEMIVFPLLYPEIFQKYSIQPPRGCLFHGPPGTGKTLVARALANECSRGDRRMAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFMFNLPDVQARRQILEIHTCKWTPHLSNSFMDELAEKCVGYCGADVKALCTEAVLSALRRRYPQIYATSERLLIDP---SSVSVATSDFQRAMDTVVPASQR 350          

HSP 2 Score: 164.851 bits (416), Expect = 3.821e-42
Identity = 86/234 (36.75%), Postives = 138/234 (58.97%), Query Frame = 3
Query: 1482 NVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANEC-----QANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRK-SPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIR 2165
            ++ +  IGGL    + L+E++ +P+ +P+ F K+ + P +G LF+GPPG GKTL+A+A+ANEC     +  F   KG + L+ W GESE  +R +FD+A    P ++FFDE+D +A                +++ LL  MDG+ ++  + +IGATNR D ID A+ RPGR D+     LPD ++R QIL+ +  K +P   +  ++ +A+   G+ GAD+  +C  A   A+R
Sbjct:   80 SIGFHSIGGLSRHIQALKEMIVFPLLYPEIFQKYSIQPPRGCLFHGPPGTGKTLVARALANECSRGDRRMAFFMRKGADCLSKWVGESERQLRLLFDQAYLMRPSIIFFDEIDGLAP---VRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFMFNLPDVQARRQILEIHTCKWTPHLSNSFMDELAEKCVGYCGADVKALCTEAVLSALR 310          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: CDC48 (AAA ATPase; subunit of polyUb-selective segregase complex involved in ERAD, INM-associated degradation (INMAD), mitotic spindle disassembly, macroautophagy, PMN, ribosome-associated degradation, ribophagy, homotypic ER membrane fusion, SCF complex disassembly, cell wall integrity during heat stress, and telomerase regulation; mobilizes membrane-anchored transcription factors by regulated Ub/proteasome-dependent processing (RUP); human ortholog VCP complements a cdc48 mutant [Source:SGD;Acc:S000002284])

HSP 1 Score: 1111.29 bits (2873), Expect = 0.000e+0
Identity = 548/826 (66.34%), Postives = 678/826 (82.08%), Query Frame = 3
Query:   93 DDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLK-GGEPM-----------EDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSV-GGAGAGFN---DVEDDLY 2522
            D   TAILR K K N L+V+D +NDDNSV++++   MD+L+LFRGDTVL+KGKKR++TV I L+D+   D   R+NR VR NLR+RLGD++++ PCP+I Y  R+ VLPI DTIEG+TGN+++VFLKPYFVEAYRPVRK D F+VRGGMR VEFKV++ +P  Y +VA +T+IH+EG+P+ R DE+  +NEVGYDDIGGCRKQ+AQI+EMVELPLRHPQLFKAIG+KPPRG+L+YGPPGTGKTL+ARAVANETG+FFFLINGPE+MSK+AGESESNLRKAFEEAEKN+PAIIFIDE+D+IAPKR+KT+GEVERR+VSQLLTLMDG+K RS+V+V+AATNRPNSIDPALRRFGRFDREVDIGIPD TGRLE+LRIHTKNM+L DDVDLE +A+ETHG+VGAD+A+LC+EAA+QQIR KMDLIDL+E EIDAE+L+SL VTM++FR+AL  SNPSALRET VE  NVTW+D+GGL  +K EL+E V+YPV HPD++ KFG++PSKGVLFYGPPG GKTLLAKA+A E  ANFIS+KGPELL+MW+GESE+N+RDIFDKAR AAP V+F DELDSIAK+RGGS+GD GGA+DRV+NQLLTEMDGM+AKKNVF+IGATNRPD ID AILRPGRLDQLIY+PLPDE +R+ IL A LRK+P+   +++  +AK T GFSGADL  I QRA K AI++ IEA  +   ++++K  GE +           E ++DPVP IT++HF EAMK A+RSV+D ++R+YE ++Q ++ SR            +  +   ND   G+     +N   S   GAGA F    + +DDLY
Sbjct:   20 DKTATAILRRKKKDNMLLVDDAINDDNSVIAINSNTMDKLELFRGDTVLVKGKKRKDTVLIVLIDDELEDGACRINRVVRNNLRIRLGDLVTIHPCPDIKYATRISVLPIADTIEGITGNLFDVFLKPYFVEAYRPVRKGDHFVVRGGMRQVEFKVVDVEPEEYAVVAQDTIIHWEGEPINREDEENNMNEVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREKMDLIDLDEDEIDAEVLDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAIKDSIEAHRQHEAEKEVKVEGEDVEMTDEGAKAEQEPEVDPVPYITKEHFAEAMKTAKRSVSDAELRRYEAYSQQMKASR-----------GQFSNFNFNDAPLGTTATDNANSNNSAPSGAGAAFGSNAEEDDDLY 834          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: AFG2 (ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a hexameric complex; is essential for pre-60S maturation and release of several preribosome maturation factors; releases Rlp24p from purified pre-60S particles in vitro; target of the ribosomal biosynthesis inhibitor diazaborine; may be involved in degradation of aberrant mRNAs [Source:SGD;Acc:S000004389])

HSP 1 Score: 474.167 bits (1219), Expect = 8.484e-154
Identity = 257/566 (45.41%), Postives = 355/566 (62.72%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKT-HGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM----RLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILN-SLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKD-VDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFA 2342
            + Y  +GG  K++  +K  +E+PL  P LF + GV PPRGILL+GPPGTGKT++ R VAN + +    INGP I+SK  GE+E+ LR  F EA K  P+IIFIDE+D+IAP R     GEVE R+V+ LLTLMDG+     V+V+AATNRPNS+DPALRR GRFD+EV+IGIPD   R +IL      M     + D   ++ +AS+THG+VGADL ALC E+ ++ I+  +          DA I   SL VT++D   A+    PSA+RE  +E+P V W DIGG + +K +++E++Q P+E  + F + G++  KGVL YGPPGC KTL AKA+A E   NF+++KGPE+   + GESE  +R+IF KAR AAP ++FFDE+D+++       G    AA+ V+  LL E+DG+   K V I+ ATNRPD IDAA+LRPGRLD+ IY+  PD  +R++ILK   +K    +  VD++ +A  T G+SGA++  +CQ A   AI E                      D+D V ++  +HFE+A K   R +T   +  YE FA
Sbjct:  242 LSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVANTSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEIDSIAPNRANDDSGEVESRVVATLLTLMDGMGAAGKVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDARFDILTKQFSRMSSDRHVLDSEAIKYIASKTHGYVGADLTALCRESVMKTIQRGLG--------TDANIDKFSLKVTLKDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQEELKTKMKEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDEIDALSP---DRDGSSTSAANHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGRLDRHIYVGPPDVNARLEILKKCTKKFNTEESGVDLHELADRTEGYSGAEVVLLCQEAGLAAIME----------------------DLD-VAKVELRHFEKAFKGIARGITPEMLSYYEEFA 773          

HSP 2 Score: 202.601 bits (514), Expect = 1.210e-54
Identity = 99/238 (41.60%), Postives = 151/238 (63.45%), Query Frame = 3
Query:  654 KLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDD-VDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLE 1364
            ++ +V + DIGG  +   ++KEM++LPL   + F  +G+  P+G+LLYGPPG  KTL A+A+A E+G  F  + GPEI +K  GESE  +R+ F +A   +P+IIF DE+DA++P R+ +       +++ LL  +DG+++   V+++AATNRP+ ID AL R GR DR + +G PD   RLEIL+  TK     +  VDL ++A  T G+ GA++  LC EA L  I   +D+  +E
Sbjct:  509 EMPKVYWSDIGGQEELKTKMKEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDEIDALSPDRDGSSTSAANHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGRLDRHIYVGPPDVNARLEILKKCTKKFNTEESGVDLHELADRTEGYSGAEVVLLCQEAGLAAIMEDLDVAKVE 746          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: RIX7 (Putative ATPase of the AAA family; required for export of pre-ribosomal large subunits from the nucleus; distributed between the nucleolus, nucleoplasm, and nuclear periphery depending on growth conditions [Source:SGD;Acc:S000003957])

HSP 1 Score: 424.476 bits (1090), Expect = 2.963e-134
Identity = 246/627 (39.23%), Postives = 365/627 (58.21%), Query Frame = 3
Query:  681 IGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREK-THGEVERRIVSQLLTLMDGLKQRSH----VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCT-----------------------------------------EAALQQIRNKMDLIDLE----------EPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKS---PIAKDVDVNYMAK--VTHGFSGADLTEICQRACKQAIRECI--EADIRAARD-------QQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            +GG    +AQ+ E++ LP+ HP++F + GV+PPRG+LL+GPPG GKT IA A+A E    F  I+ P ++S ++GESE  +R  F+EA   +P ++F DE+DAI PKR+     E+ERRIV+QLLT MD L         VI++ ATNRP+S+D ALRR GRFDRE+ + +P+   RL IL+  + N+++   +D  ++A  T G VGADL AL T                                         E++L+   N +D + L           EP +  E L+ L++  EDF  AL    P+A RE    VP+VTW ++G LQ V+ EL   +  P++ P+ + K G++   GVL +GPPGCGKTLLAKA+ANE +ANFISIKGPELL  + GESE ++R +F +AR + PCV+FFDELD++             ++ RV+N LLTE+DG++ ++ +F+IGATNRPD+ID A+LRPGRLD+ ++I LP+ + ++ I+K  L KS   P++ DVD   + +    + FSGADL  + + +   A++       +I++  D       + L  G   E+ I     +T   F  A++  + SV+D D  KY+   + +
Sbjct:  207 LGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNVPNEVSRLHILKKMSDNLKIDGAIDFAKLAKLTPGFVGADLKALVTAAGTCAIKRIFQTYANIKSTPTTATDSSEDNMEIDETANGDESSLKNTANMIDPLPLSVVQQFIRNYPEP-LSGEQLSLLSIKYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRLELNMAIVQPIKRPELYEKVGISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRARASVPCVIFFDELDALVP---RRDTSLSESSSRVVNTLLTELDGLNDRRGIFVIGATNRPDMIDPAMLRPGRLDKSLFIELPNTEEKLDIIKT-LTKSHGTPLSSDVDFEEIIRNEKCNNFSGADLAALVRESSVLALKRKFFQSEEIQSVLDNDLDKEFEDLSVGVSGEEII-----VTMSDFRSALRKIKPSVSDKDRLKYDRLNKKM 823          

HSP 2 Score: 199.134 bits (505), Expect = 3.105e-53
Identity = 105/279 (37.63%), Postives = 172/279 (61.65%), Query Frame = 3
Query:  663 EVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKN--MRLGDDVDLEQVA--SETHGHVGADLAALCTEAALQQIRNKM----DLIDLEEPEIDAEILN--------SLAVTMEDFRWALSKSNPS 1451
            +V + ++G  ++   ++   +  P++ P+L++ +G+  P G+LL+GPPG GKTL+A+AVANE+ + F  I GPE+++K  GESE ++R+ F  A  + P +IF DELDA+ P+R+ +  E   R+V+ LLT +DGL  R  + V+ ATNRP+ IDPA+ R GR D+ + I +P+T  +L+I++  TK+    L  DVD E++    + +   GADLAAL  E+++  ++ K     ++  + + ++D E  +         + VTM DFR AL K  PS
Sbjct:  529 DVTWANVGALQRVRLELNMAIVQPIKRPELYEKVGISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLLTELDGLNDRRGIFVIGATNRPDMIDPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEEIIRNEKCNNFSGADLAALVRESSVLALKRKFFQSEEIQSVLDNDLDKEFEDLSVGVSGEEIIVTMSDFRSALRKIKPS 807          

HSP 3 Score: 191.045 bits (484), Expect = 1.492e-50
Identity = 105/245 (42.86%), Postives = 149/245 (60.82%), Query Frame = 3
Query: 1479 PNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKN----VFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIE--ADIRAA 2195
            PN + + +GG+  V  +L EL+  P+ HP+ FL  G+ P +GVL +GPPGCGKT +A A+A E Q  FISI  P +++   GESE  +RD+FD+AR  APC++FFDE+D+I        G       R++ QLLT MD ++ +K     V IIGATNRPD +DAA+ R GR D+ I + +P+E SR+ ILK       I   +D   +AK+T GF GADL  +   A   AI+   +  A+I++ 
Sbjct:  200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITP--KRDGGAQREMERRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNVPNEVSRLHILKKMSDNLKIDGAIDFAKLAKLTPGFVGADLKALVTAAGTCAIKRIFQTYANIKST 442          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: PEX6 (AAA-peroxin; heterodimerizes with AAA-peroxin Pex1p and participates in the recycling of peroxisomal signal receptor Pex5p from the peroxisomal membrane to the cystosol; mutations in human PEX6 can lead to severe peroxisomal disorders and early death [Source:SGD;Acc:S000005273])

HSP 1 Score: 245.358 bits (625), Expect = 7.360e-68
Identity = 156/419 (37.23%), Postives = 244/419 (58.23%), Query Frame = 3
Query:  954 SPAIIFIDELDAIA----PKREKTHGEVERRIVSQLLTLMDGLKQR-SHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVD-------LEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKS-NPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKN-VFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSR-IQILKANLRKSPIAKDVDVNYMAKVT-HGFSGADLTEICQRACKQAI 2162
            SPA+IF+  LD+I       ++    ++++ I  ++  L+D    +      + + N  +++  + R   RF  E+ + +P    RL I + +  +  L  DV        ++ ++  +     A L  L  ++ ++  R        +E +    +  S+ +T ED   A SK+ N  ++     ++PNVTW+DIGG+  VK E+ + +  P++HP+ F   GM    G+LFYGPPG GKTL+AKAIA     NF S+KGPELL M+ GESEANVR +F KAR+A PCV+FFDE+DS+A  + G+ GD GG  DR+++QLL E+DGMS   + VF+IGATNRPD++D A+LRPGR D+L+Y+ +PD  ++ + IL+A  RK  +  DV +  +AK+    ++GAD   +C  A   A+
Sbjct:  541 SPAVIFLAHLDSILLDVNANQDPEAIKLQKSINFEMSKLLDDFTFKFPGTTFVGSVNNIDNVPSSFRSHMRF--EILVPVPSEAQRLRIFQWYLSSHELNRDVQQKVPVSYMDNISFSSLSSYSAGLTPLDIKSIVETARMTATARFYQESKKCGWLPQSILITQEDLSKATSKARNEFSVSIGAPQIPNVTWDDIGGIDFVKGEILDTIDMPLKHPELFTS-GMKKRSGILFYGPPGTGKTLMAKAIATNFSLNFFSVKGPELLNMYIGESEANVRRVFQKAREAKPCVIFFDEIDSVAP-KRGNQGDSGGVMDRIVSQLLAELDGMSTDADGVFVIGATNRPDLLDEALLRPGRFDKLLYLGIPDTDTKQLNILEALTRKFVLDNDVKLIELAKLCPFNYTGADFYALCSDAMLNAM 955          

HSP 2 Score: 193.356 bits (490), Expect = 6.083e-51
Identity = 114/287 (39.72%), Postives = 170/287 (59.23%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKR--EKTHGEVERRIVSQLLTLMDGLKQRSH-VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDT-TGRLEILRIHTKNMRLGDDVDLEQVASET-HGHVGADLAALCTEAALQQIRNKMDLID---LEEPEIDAEILNS--------------LAVTMEDFRWALSKSNPSALR 1460
            V +DDIGG      +I + +++PL+HP+LF + G+K   GIL YGPPGTGKTL+A+A+A      FF + GPE+++   GESE+N+R+ F++A +  P +IF DE+D++APKR  +   G V  RIVSQLL  +DG+   +  V V+ ATNRP+ +D AL R GRFD+ + +GIPDT T +L IL   T+   L +DV L ++A      + GAD  ALC++A L  +     +++    +  E+  E +++              + V MEDF  A  +  PS  R
Sbjct:  729 VTWDDIGGIDFVKGEILDTIDMPLKHPELFTS-GMKKRSGILFYGPPGTGKTLMAKAIATNFSLNFFSVKGPELLNMYIGESEANVRRVFQKAREAKPCVIFFDEIDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMSTDADGVFVIGATNRPDLLDEALLRPGRFDKLLYLGIPDTDTKQLNILEALTRKFVLDNDVKLIELAKLCPFNYTGADFYALCSDAMLNAMSRIARMVEKKVSQHNELTGENISTRRWFDKIATKEDTKVVVKMEDFLKAQEQLTPSVSR 1014          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Match: YTA7 (Protein that localizes to chromatin; has a role in regulation of histone gene expression; has a bromodomain-like region that interacts with the N-terminal tail of histone H3, and an ATPase domain; relocalizes to the cytosol in response to hypoxia; potentially phosphorylated by Cdc28p [Source:SGD;Acc:S000003502])

HSP 1 Score: 232.646 bits (592), Expect = 3.889e-63
Identity = 124/273 (45.42%), Postives = 171/273 (62.64%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGS-----FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVD-LEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRET 1466
            V +DDIGG    + Q+KEMV LPL +P+L++   + PPRG+L +GPPGTGKTL+ARA+A    S      FF+  G +I+SK  GE+E  LR  FEEA+K+ P+IIF DE+D +AP R     ++   IVS LL LMDG+  R  VIV+ ATNRP+++DPALRR GRFDRE    +PD   R +IL+I T+        + ++++A  T G+ GADL +LCTEAAL  I+     I     ++  +  + + V + DF  AL K  PS+ R T
Sbjct:  410 VNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALAASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTLLALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPLPDVKARFKILQIQTRKWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQRSFPQIYRSNDKLLVDP-SKIKVKVSDFMLALKKIVPSSARST 681          

HSP 2 Score: 191.815 bits (486), Expect = 3.938e-50
Identity = 94/238 (39.50%), Postives = 147/238 (61.76%), Query Frame = 3
Query: 1482 NVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQAN-----FISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRK--SPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECI 2174
            NV ++DIGGL     +L+E+V  P+ +P+ +  F +TP +GVLF+GPPG GKTL+A+A+A  C ++     F   KG ++L+ W GE+E  +R +F++A++  P ++FFDE+D +A                +++ LL  MDGM  +  V +IGATNRPD +D A+ RPGR D+  Y PLPD K+R +IL+   RK  SP++ +  ++ +A +T G+ GADL  +C  A   +I+   
Sbjct:  409 NVNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALAASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAP---VRSSKQEQIHASIVSTLLALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPLPDVKARFKILQIQTRKWSSPLSTNF-IDKLAFLTKGYGGADLRSLCTEAALISIQRSF 642          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO36218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ61])

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 636/754 (84.35%), Postives = 705/754 (93.50%), Query Frame = 3
Query:   93 DDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPME-DDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            D+L TAIL++K++PNRL+VE+ VNDDNSVV+MSQ KM+ELQLFRGDTVL+KGKKR++TVCI L D+T  D+KIRMNR VR NLRVRLGDV+SVQ CP++ YGKR+HVLP DDT+EG+TGN+++VFLKPYFVEAYRP+RK D+F+VRGGMRAVEFKVIETDPSPYCIVAP+TVIH EG+PV R +E+E LNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILL+GPPGTGKTL+ARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDE+DAIAPKR+KTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNS+D ALRRFGRFDREVDIGIPD TGRLEILRIHTKNM+LGDDVDLEQ+A+ETHG+VG+D+A+LC+EAALQQIR KMDLIDLE+  IDAE+L+SLAV+M+DFR+A+  SNPSALRET VEVPNV+W+DIGGL+GVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRD+FDKAR AAPCVLFFDELDSIAKSRGG+VGDGGGAADRVINQ+LTEMDGM+ KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPD+ SR  ILKANLRKSPIAKDVD++Y+AKVTHGFSGADLTEICQRACK AIRE IE DI   + +       ME +D DPVPEI + HFEEAMK+ARRSV+DND+RKYEMFAQTL
Sbjct:    5 DELATAILKNKSRPNRLLVEEAVNDDNSVVTMSQAKMEELQLFRGDTVLIKGKKRKDTVCIVLSDDTISDDKIRMNRVVRMNLRVRLGDVVSVQSCPDVKYGKRIHVLPFDDTVEGLTGNLFDVFLKPYFVEAYRPIRKGDMFLVRGGMRAVEFKVIETDPSPYCIVAPDTVIHCEGEPVKREEEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLFGPPGTGKTLMARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSVDVALRRFGRFDREVDIGIPDATGRLEILRIHTKNMKLGDDVDLEQIAAETHGYVGSDVASLCSEAALQQIREKMDLIDLEDETIDAEVLDSLAVSMDDFRYAMGVSNPSALRETVVEVPNVSWDDIGGLEGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARSAAPCVLFFDELDSIAKSRGGNVGDGGGAADRVINQVLTEMDGMNVKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDGSRSSILKANLRKSPIAKDVDLDYVAKVTHGFSGADLTEICQRACKLAIREAIETDINREKQRVDNPDLDMEVEDEDPVPEIRKDHFEEAMKFARRSVSDNDIRKYEMFAQTL 758          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO39006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBC8])

HSP 1 Score: 525.398 bits (1352), Expect = 7.413e-176
Identity = 268/536 (50.00%), Postives = 370/536 (69.03%), Query Frame = 3
Query:  606 VIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRS---HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLG-DDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLID------LEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEAD 2183
            VIH  G  V++ D + K   V +  IGG + Q+  ++EM+E+PL +P+LF A GV PPRGILLYGP GTGKT+IARAVANETG  FF INGPE++S+  GE+E+ LR+ F EA+  SP+I+FIDELDA+ P+R+K   E ERR+V+ LLTLMDG+  +S   +V+V+AATNRP+++DPALRR GRFDRE++IGIP  T R +IL    KN+     D D+  +A   HG+VGADLAA C EA+L   +  +   D      LE+   DA I   L V+ ED R A     PSA+RE  +EVP V W D+GG + +KR+L+E V++P++HP+ F + G+ P +G+L YGPPGC KTL+A+A+A E   NFI+IKGPEL + W GESE  VR++F KAR  AP ++FFDELD+IA     +   G    DRV+ QLLTE+DG+   K+V  I ATNRPD+ID A++RPGR+D+LIY+PLP   +R  IL+ +L ++P    +D+  + + T G+SGA++  +C+ A   A++E I+A+
Sbjct:    6 VIHPFGS-VIKKDSEAK-KGVSFQSIGGLKTQIQAVREMIEMPLTNPELFTAYGVPPPRGILLYGPSGTGKTMIARAVANETGVHFFCINGPEVLSRYYGETEARLREIFTEAQNKSPSIVFIDELDALCPRRDKVQNEFERRVVATLLTLMDGMHMKSTDTYVMVLAATNRPDALDPALRRPGRFDREIEIGIPSVTDRRDILVTLLKNVPHSLHDEDISSLAESAHGYVGADLAAACKEASLYAFKRSLHNHDNGSSQSLEQR--DARIKRELLVSSEDMRAAFRCVRPSAMREVALEVPKVHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRPPRGILMYGPPGCSKTLIARALATESGLNFIAIKGPELFSKWVGESEKAVREVFLKARATAPSIVFFDELDAIAG--QRNSTGGSDVNDRVLTQLLTELDGVETLKDVIFIAATNRPDMIDKALMRPGRVDRLIYVPLPCWDTRRHILEIHLARTPCEGSLDLEDLVERTEGYSGAEIAAVCREAALAALQENIQAE 535          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO35705 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKV3])

HSP 1 Score: 454.521 bits (1168), Expect = 5.744e-148
Identity = 245/520 (47.12%), Postives = 328/520 (63.08%), Query Frame = 3
Query:  741 HPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR--SHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAAL-----------------------------------QQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKA---NLRKSPIAKDVDVNYMAKVT--HGFSGADLTEICQRACKQAIRECI 2174
            HP++F  +GV P  G LL+GPPG GKTL+A A+A E    F  +   EI+S ++GESE  +R+ F  A   +P I+F+DE+DAI PKRE    ++ERRIVSQLL+ MD L     +HV+V+ ATNRP+S+DPALRR GRFDRE+ +GIPD + R  ILR+  K ++L  D     ++ +T G+VGADL AL  EAA+                                   Q   N M+ +  ++P + +E L+SL +TM+DF  AL+ + PSA RE    VP+VTW ++G L+ V+ EL   +  PV+HP++F   G+T   G+L  GPPGCGKTLLAKAIANE   NFIS+KGPELL M+ GESE  VR +F +AR +APCV+FFDELDS+   R GS   G        NQLLTEMDG+ A+K+VFI+GATNRPDIID A++RPGRLD+++Y+ LP    R  IL+      RK  +  DV +  +A+ T  +GFSGADL  + + A   A+RE I
Sbjct:    3 HPEVFTTLGVTPTTGFLLHGPPGCGKTLLAHAIAGELEMPFLKLAATEIVSGVSGESEEKVRELFTSAVAQAPCILFLDEIDAITPKRENASKDMERRIVSQLLSCMDDLNNNPDAHVLVIGATNRPDSLDPALRRAGRFDREISMGIPDESARASILRVMCKQLKLSADFSFLSLSRQTPGYVGADLMALTREAAMIAVNRTFESLKKDTQTVLSGDDMFQDSVSKPMATPQDSWNVMEWLR-QQPPLTSEQLSSLCITMDDFVGALAVTQPSAKREGFATVPDVTWANVGALKDVREELTMAILAPVQHPEEFSALGLTHPPGILLAGPPGCGKTLLAKAIANESGINFISVKGPELLNMYVGESERAVRQVFQRARNSAPCVIFFDELDSLCPRRSGSSESGSSVRVV--NQLLTEMDGLQARKHVFIMGATNRPDIIDPAVMRPGRLDKVLYVGLPSAHDRQDILRTLTKEGRKPFLLPDVHLGLLAEDTRCNGFSGADLAALVREASMAALRERI 519          

HSP 2 Score: 186.037 bits (471), Expect = 1.231e-49
Identity = 101/239 (42.26%), Postives = 152/239 (63.60%), Query Frame = 3
Query:  663 EVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAP-KREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMR---LGDDVDLEQVASET--HGHVGADLAALCTEAALQQIRNKMDLIDL 1361
            +V + ++G  +    ++   +  P++HP+ F A+G+  P GILL GPPG GKTL+A+A+ANE+G  F  + GPE+++   GESE  +R+ F+ A  ++P +IF DELD++ P +   +      R+V+QLLT MDGL+ R HV +M ATNRP+ IDPA+ R GR D+ + +G+P    R +ILR  TK  R   L  DV L  +A +T  +G  GADLAAL  EA++  +R +++L  L
Sbjct:  286 DVTWANVGALKDVREELTMAILAPVQHPEEFSALGLTHPPGILLAGPPGCGKTLLAKAIANESGINFISVKGPELLNMYVGESERAVRQVFQRARNSAPCVIFFDELDSLCPRRSGSSESGSSVRVVNQLLTEMDGLQARKHVFIMGATNRPDIIDPAVMRPGRLDKVLYVGLPSAHDRQDILRTLTKEGRKPFLLPDVHLGLLAEDTRCNGFSGADLAALVREASMAALRERINLTSL 524          

HSP 3 Score: 154.836 bits (390), Expect = 2.801e-39
Identity = 87/249 (34.94%), Postives = 138/249 (55.42%), Query Frame = 3
Query: 1560 HPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAK--KNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARR 2300
            HP+ F   G+TP+ G L +GPPGCGKTLLA AIA E +  F+ +   E+++   GESE  VR++F  A   APC+LF DE+D+I                R+++QLL+ MD ++     +V +IGATNRPD +D A+ R GR D+ I + +PDE +R  IL+   ++  ++ D     +++ T G+ GADL  + + A   A+    E+ ++      L G +  +D +   P  T +     M++ R+
Sbjct:    3 HPEVFTTLGVTPTTGFLLHGPPGCGKTLLAHAIAGELEMPFLKLAATEIVSGVSGESEEKVRELFTSAVAQAPCILFLDEIDAITP---KRENASKDMERRIVSQLLSCMDDLNNNPDAHVLVIGATNRPDSLDPALRRAGRFDREISMGIPDESARASILRVMCKQLKLSADFSFLSLSRQTPGYVGADLMALTREAAMIAVNRTFES-LKKDTQTVLSGDDMFQDSVSK-PMATPQDSWNVMEWLRQ 246          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO45694 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS74])

HSP 1 Score: 410.609 bits (1054), Expect = 3.155e-130
Identity = 231/591 (39.09%), Postives = 335/591 (56.68%), Query Frame = 3
Query:  681 IGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNS---PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSL-AVTMEDFRWALSKSNPSALR--ETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVF----------------------------------IIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYE 2333
            + G    +  +KE+V+ PL +P+ F  +G+  P+GILL G PG GKTL+      + G      NG ++    AGESE NLR+ F +A   S   P ++FIDELDA+ PKR  +  E E RIV+QLLTLMDGL+ R  VIV+ ATNRPN++DPALRR GRFDREV IG+P    RL+ILR H K + L  DVDL  +A  T G+VGADLA+LC +AA   ++  +           A+  + L  V M DF+ A+  + PS  +  E  V +    W+D+GGL+GVK+ L++ +++P+ HP+ F + G+   +GVL YGPPGC KT L +A A+     F+S+   +L + + G++E  +R++F KAR  AP +LF DELDS+A       G+  G   R++  LL EMDG+    N++                                  ++ ATNRP+ ID A+LRPGR+D +IY+P PD K+R++IL+ + R SP+A DVD++ +A+ T  +SGADL  +C+ A   A+                KG +           I  KHF +A+   + S+T   ++ YE
Sbjct:  131 LSGLDDSIKMLKELVQFPLYYPESFSHLGINGPKGILLVGAPGVGKTLLVHKATVDCGIKLVSTNGTDVFGPHAGESEENLRRVFNKARYASRFGPCVLFIDELDALCPKRGSSGNEEENRIVAQLLTLMDGLESRGRVIVIGATNRPNALDPALRRPGRFDREVVIGVPSAGQRLDILRAHCKPINLSVDVDLTHLAEITVGYVGADLASLCQQAAFAALKRSL-----------AKNKSGLHTVKMSDFQLAMCHTVPSTHKGMEGVVRLQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTLVRAAASSTHCTFMSLSCAQLFSSYVGDAERTLRELFLKARATAPAILFLDELDSLAG----KRGNNLGMETRLLATLLNEMDGVGVSANIYGRECNEREMPQKYKEDRGSKGNIGGESLTNSYLILVAATNRPEAIDGALLRPGRIDCMIYVPPPDMKARLEILRVHTRFSPLAPDVDLSVIAEGTELYSGADLENLCREAALFALEH--------------KGMDTC--------SIDNKHFMKALANLKPSLTTEQLKYYE 684          

HSP 2 Score: 177.948 bits (450), Expect = 2.072e-46
Identity = 115/337 (34.12%), Postives = 166/337 (49.26%), Query Frame = 3
Query:  585 CIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLK----------------------------------QRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTW 1493
            C   P T    EG  VVR      L    +DD+GG       +++ +E PL HP+ F  +G++ PRG+LLYGPPG  KT + RA A+ T   F  ++  ++ S   G++E  LR+ F +A   +PAI+F+DELD++A KR    G +E R+++ LL  MDG+                                     S++I++AATNRP +ID AL R GR D  + +  PD   RLEILR+HT+   L  DVDL  +A  T  + GADL  LC EAAL  + +K               +++ ++  + F  AL+   PS   E      N  W
Sbjct:  375 CHTVPSTHKGMEG--VVR------LQPTRWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTLVRAAASSTHCTFMSLSCAQLFSSYVGDAERTLRELFLKARATAPAILFLDELDSLAGKRGNNLG-METRLLATLLNEMDGVGVSANIYGRECNEREMPQKYKEDRGSKGNIGGESLTNSYLILVAATNRPEAIDGALLRPGRIDCMIYVPPPDMKARLEILRVHTRFSPLAPDVDLSVIAEGTELYSGADLENLCREAALFALEHKG--------------MDTCSIDNKHFMKALANLKPSLTTEQLKYYENKQW 688          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Match: EDO48602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ14])

HSP 1 Score: 278.87 bits (712), Expect = 1.925e-81
Identity = 196/557 (35.19%), Postives = 303/557 (54.40%), Query Frame = 3
Query:  744 PQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSH--VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAA-------LQQIRNKMDL-IDLEEPE--------IDAEILNSLAVTMEDFRWALSKSNPSALRETTV-EVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLP-DEKSRIQILKANLRKSPIAKDVDVNYMA-KVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            P L K +   P   +LL G PGTGK  I  AV+++       I+  +++      +E+ ++  F  A    P I+ +  + AI   ++K   E E RI + L    + +K +S   ++V+A +++P+SI   +  +  F  E+ +  P    RL +L+  +    L  DV+ E +A  T G V AD AAL T A         Q +  K+ L    E+P         I +   + +++  +DF+ AL     S        ++P+++W+D+GGL  VK E+ + +Q P+ HP+ F   G+  S GVL YGPPG GKTL+AKA+A EC  NF+S+KGPEL+ M+ G+SE NVR++F +A+ A+PCV+FFDELDS+A    G  GD GG  DRV+ QLL E+DG+ +  +VF+IGATNRPD++D A+LRPGR D+L+Y+ +  D  +++ +LKA  RK   + D  +   A K+    +GADL  +   A  QA+R  I          Q  GG     + D V E+    F  A++    SV+  ++ +Y+    TL
Sbjct:  136 PYLSKRVNGPPFVQVLLTGLPGTGKRAICMAVSSQLNLAVQEISCFDLIGDSVAATETRIKNLFVRANDCRPCILLLRHIHAIG--KDKEGQEDEPRIAATLQDCTEFIKDQSDWPLVVIATSSQPDSICSGI--YASFLHEIKLESPSEQERLCMLQGISSVYSLAPDVNFEVLARRTAGFVLADFAALFTRATSIASARVTQYLTAKLHLNTKTEDPSQLFTIQQCIKSACRSGVSINFKDFQEALDALQASHADAIGAPKIPDISWKDVGGLDSVKEEILDTIQLPLLHPELFAA-GLRRS-GVLLYGPPGTGKTLMAKAVATECSLNFLSVKGPELINMYVGQSEQNVREVFSRAQAASPCVIFFDELDSLAP-NRGRSGDSGGVMDRVVAQLLAELDGLHSTCDVFVIGATNRPDLLDPALLRPGRFDKLLYLGVSKDHHAQLSVLKALTRKFTFSADFRLEEFANKLPLNLTGADLYAMASDALLQAMRRII----------QETGGNADAAE-DAVIEVCLADFCVALQNLTPSVSFQELERYKQIKNTL 674          

HSP 2 Score: 186.422 bits (472), Expect = 2.120e-49
Identity = 108/270 (40.00%), Postives = 162/270 (60.00%), Query Frame = 3
Query:  654 KLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKT--HGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIP-DTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHV-GADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPS 1451
            K+ ++ + D+GG      +I + ++LPL HP+LF A G++   G+LLYGPPGTGKTL+A+AVA E    F  + GPE+++   G+SE N+R+ F  A+  SP +IF DELD++AP R ++   G V  R+V+QLL  +DGL     V V+ ATNRP+ +DPAL R GRFD+ + +G+  D   +L +L+  T+      D  LE+ A++   ++ GADL A+ ++A LQ +R    +I       DA     + V + DF  AL    PS
Sbjct:  394 KIPDISWKDVGGLDSVKEEILDTIQLPLLHPELFAA-GLR-RSGVLLYGPPGTGKTLMAKAVATECSLNFLSVKGPELINMYVGQSEQNVREVFSRAQAASPCVIFFDELDSLAPNRGRSGDSGGVMDRVVAQLLAELDGLHSTCDVFVIGATNRPDLLDPALLRPGRFDKLLYLGVSKDHHAQLSVLKALTRKFTFSADFRLEEFANKLPLNLTGADLYAMASDALLQAMRR---IIQETGGNADAAEDAVIEVCLADFCVALQNLTPS 658          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:101174924])

HSP 1 Score: 1314.67 bits (3401), Expect = 0.000e+0
Identity = 668/833 (80.19%), Postives = 745/833 (89.44%), Query Frame = 3
Query:   33 IFRFLNFA*SVLINMASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAG--FN-DVEDDLY 2522
            ++ ++N   +V +   S+KNDDL TAIL+ K++PNRLIV++ +N+DNSVVS+SQ KMDELQLFRGDTVL+KGKKRRETVCI L D+TC DEK+RMNR VR NLRVRLGDVIS+QPCP++ YGKR+HVLPIDDT+EG+TGN++EV+LKPYF+EAYRP+RK D+F+VRGGMRAVEFKV+ETDPSPYCIVAP+TVIH EG+P+ R DE+E LNEVGYDDIGG RKQLAQIKEMVELPLRHP LFKAIGVKPPRGILLYGPPGTGKTLIARAVANETG+FFFLINGPEIMSKLAGESESNLRKAFEEAEKN+PAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQR+HVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD TGRLEIL+IHTKNM+L DDVDLEQVA+ETHGHVGADLAALC+EAALQ IR KMDLIDLE+  IDAE++NSLAVTM+DF+WALS+SNPSALRET VEVPN+TW+DIGGL+ VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVR+IFDKARQAAPCVLFFDELDSIAK+RGG+VGDGGGAADRVINQ+LTEMDGMS+KKNVFIIGATNRPDIID AILRPGRLDQLIYIPLPDEKSRI ILKANLRKSPI+KDVD++++AK+T+GFSGADLTEICQRACK AIRE IE++IR  R++Q        ++ DPVPEI + HFEEAM++ARRSV+DND+RKYEMFAQTLQQ                 S G   F   S+T   S      GGAG G  FN D +DDLY
Sbjct:    1 MYLYIN---TVFLCQHSSKNDDLSTAILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLMKGKKRRETVCIVLSDDTCSDEKVRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIRREDEEESLNEVGYDDIGGVRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFKWALSQSNPSALRETIVEVPNITWDDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNVGDGGGAADRVINQILTEMDGMSSKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRISILKANLRKSPISKDVDLDFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRKDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQ-----------------SRGFGSFRFPSSTPGGSGPSHGAGGAGTGPVFNEDNDDDLY 813          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: nvl (nuclear VCP like [Source:NCBI gene;Acc:101154831])

HSP 1 Score: 460.299 bits (1183), Expect = 3.474e-147
Identity = 257/604 (42.55%), Postives = 365/604 (60.43%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQ---RSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAAL----------------------------------QQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLR---KSPIAKDVDVNYMA--KVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            V ++D+GG  + L ++ +++ + + HP++F+ +GV PPRG LL+GPPG GKTL+A+AVA E       ++ PE++S ++GESE  LR+ F++A  +SP I+FIDE+DAI PKRE    ++ERR+V+QLLT MD L        V+++ ATNRP+S+DPALRR GRFDRE+ +GIPD   RL IL    + + L  D D  ++A  T G+VGADL ALC EAA+                                  +Q+++ + L+   E  +  E L  L++ M DF+ ALS   PSA RE    VP+V+WE +G LQ V+ EL   +  PV  P+ F   G+    GVL  GPPGCGKTLLAKA+ANE   NFIS+KGPELL M+ GESE  VR +F + R +APCV+FFDE+D++        G   GA+ RV+NQLLTEMDG+  ++ VFI+ ATNRPDIID A+LRPGRLD+ +Y+ LP    R  IL A  +   +  +  DV +  +A  +    FSGADLT + + A   A+++ +++          +GGE +        +++R HFEEA+   R SV+  +  +YE    +L
Sbjct:  224 VTFEDVGGNEEALTEVCKLL-IYMHHPEVFQQLGVVPPRGFLLHGPPGCGKTLLAQAVAGELQLPLLKVSAPELVSGVSGESEQKLRELFDQAVSSSPCILFIDEIDAITPKREVASKDMERRMVAQLLTCMDDLNSLPVTVQVMIIGATNRPDSLDPALRRAGRFDREISLGIPDEAARLRILETLCRKLTLPADFDFLKLARLTPGYVGADLMALCREAAMNAVNRILMAVGTPAEDQGSSEKKLERSCPAVAKSKQLQHLLSLLKTTE-MLPQEDLAVLSIFMLDFQAALSSVQPSAKREGFATVPDVSWEHVGALQDVREELTMAILAPVRSPELFRALGLGAPSGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCP---RRSGHESGASIRVVNQLLTEMDGLETRRQVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLPGPADRCAILLAITKGGTRPQLGPDVHLEEIASDERCSSFSGADLTALVREASVNALKDYLKSQ---------QGGEALPSGCTVDIQVSRVHFEEALNKVRPSVSPKEQLRYEQLRDSL 813          

HSP 2 Score: 193.356 bits (490), Expect = 1.760e-50
Identity = 107/273 (39.19%), Postives = 162/273 (59.34%), Query Frame = 3
Query:  663 EVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM---RLGDDVDLEQVASE--THGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNS-----LAVTMEDFRWALSKSNPS 1451
            +V ++ +G  +    ++   +  P+R P+LF+A+G+  P G+LL GPPG GKTL+A+AVANE+G  F  + GPE+++   GESE  +R+ F+    ++P +IF DE+DA+ P+R         R+V+QLLT MDGL+ R  V +MAATNRP+ IDPA+ R GR D+ + +G+P    R  IL   TK     +LG DV LE++AS+       GADL AL  EA++  +++ +      + +   E L S     + V+   F  AL+K  PS
Sbjct:  531 DVSWEHVGALQDVREELTMAILAPVRSPELFRALGLGAPSGVLLAGPPGCGKTLLAKAVANESGLNFISVKGPELLNMYVGESERAVRQVFQRGRNSAPCVIFFDEIDALCPRRSGHESGASIRVVNQLLTEMDGLETRRQVFIMAATNRPDIIDPAVLRPGRLDKTLYVGLPGPADRCAILLAITKGGTRPQLGPDVHLEEIASDERCSSFSGADLTALVREASVNALKDYL------KSQQGGEALPSGCTVDIQVSRVHFEEALNKVRPS 797          

HSP 3 Score: 186.037 bits (471), Expect = 3.449e-48
Identity = 100/260 (38.46%), Postives = 155/260 (59.62%), Query Frame = 3
Query: 1434 SKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSA---KKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQ 2204
            +K   +  +   ++ P VT+ED+GG +    E+ +L+ Y + HP+ F + G+ P +G L +GPPGCGKTLLA+A+A E Q   + +  PEL++   GESE  +R++FD+A  ++PC+LF DE+D+I                R++ QLLT MD +++      V IIGATNRPD +D A+ R GR D+ I + +PDE +R++IL+   RK  +  D D   +A++T G+ GADL  +C+ A   A+   + A    A DQ
Sbjct:  207 NKGGAAKWKPLELQYPCVTFEDVGGNEEALTEVCKLLIY-MHHPEVFQQLGVVPPRGFLLHGPPGCGKTLLAQAVAGELQLPLLKVSAPELVSGVSGESEQKLRELFDQAVSSSPCILFIDEIDAITP---KREVASKDMERRMVAQLLTCMDDLNSLPVTVQVMIIGATNRPDSLDPALRRAGRFDREISLGIPDEAARLRILETLCRKLTLPADFDFLKLARLTPGYVGADLMALCREAAMNAVNRILMAVGTPAEDQ 462          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: spata5l1 (spermatogenesis associated 5 like 1 [Source:NCBI gene;Acc:101172062])

HSP 1 Score: 395.201 bits (1014), Expect = 2.993e-123
Identity = 226/627 (36.04%), Postives = 349/627 (55.66%), Query Frame = 3
Query:  561 IETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAE---KNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETT--VEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAK--------------------------------KNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKY 2330
            I  D +   ++ P+T +       VR    + L +     +GG  +  A +KEM++LPL +P++  ++GV  PRG+LL GPPG GKT + + VA E G+    + GPE++    GESE+ LR  FE A    ++ P ++F+DELD++ P+R  +    E R+V+QLLTLMDG+ Q    +V+ ATNRP+S+DPALRR GRFD+EV IG+P  T RL IL++  + + +   V+L ++A  T G+VGADL ALC EA +  +R        E  +  AE      V M  F  AL   +PS LR +    ++P V WE IGGL  VK +L++ +++P++HP+ F++ G++  +GVL +GPPGC KT L KA A      F+S+   +L + + G+SEA +  +F +AR  AP +LF DE+DS+      +         R+++ LL EMDG+  K                                K+V ++ ATNRPD +D+A+LRPGR+D +IY+P PD+++R+ IL+   ++ PI  DV +  +A  T  +SGADL  +C+ A   A+    E +++A+                    I R HF +++   R S+T   ++ Y
Sbjct:  158 INPDSATAGMITPKTSVEISNIQTVRHFRSQ-LQDQQTIPLGGLEEVTASLKEMLQLPLLYPRILSSVGVTCPRGMLLVGPPGVGKTQLVQKVAGEVGASLVPVRGPELVGSRPGESEAALRAVFERARSAAEDGPCVLFLDELDSLFPRRTASSAP-ENRLVAQLLTLMDGIDQSDRFLVVGATNRPDSLDPALRRPGRFDKEVVIGVPTLTQRLAILKVLFEKIPVCPTVNLAELAQRTTGYVGADLNALCREAIMHAVR--------ENAKGSAE----QKVVMRHFEEALKVVSPSCLRSSLGRTDLPRVLWEHIGGLDEVKLKLKQSIEWPMKHPEAFVRLGLSRPRGVLLFGPPGCAKTTLVKAAATSSSCAFLSVSSADLYSSYVGDSEAALAQLFRQARACAPSILFLDEIDSLIG-SRSTNETQNSEQTRLLSVLLNEMDGIGVKTTERRGAEKTLQAEGMTKSGAQEELEWEEVCNKDVMVVAATNRPDCLDSALLRPGRMDHIIYVPPPDQQARLSILRVCTKRMPICADVSLEELADKTELYSGADLENLCKEAALLALL---EENMKAS-------------------TIKRAHFLDSLSNMRPSLTAQQIQAY 747          

HSP 2 Score: 179.104 bits (453), Expect = 4.022e-46
Identity = 108/331 (32.63%), Postives = 175/331 (52.87%), Query Frame = 3
Query: 1353 IDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAA---PCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEM 2336
            ID++   +D    +S    M   + ++  SN   +R    ++ +     +GGL+ V   L+E++Q P+ +P      G+T  +G+L  GPPG GKT L + +A E  A+ + ++GPEL+    GESEA +R +F++AR AA   PCVLF DELDS+               +R++ QLLT MDG+       ++GATNRPD +D A+ RPGR D+ + I +P    R+ ILK    K P+   V++  +A+ T G+ GADL  +C+ A   A+RE    + + + +Q+                +  +HFEEA+K    S   + + + ++
Sbjct:  148 IDIKYAVVDGINPDSATAGMITPKTSVEISNIQTVRHFRSQLQDQQTIPLGGLEEVTASLKEMLQLPLLYPRILSSVGVTCPRGMLLVGPPGVGKTQLVQKVAGEVGASLVPVRGPELVGSRPGESEAALRAVFERARSAAEDGPCVLFLDELDSL----FPRRTASSAPENRLVAQLLTLMDGIDQSDRFLVVGATNRPDSLDPALRRPGRFDKEVVIGVPTLTQRLAILKVLFEKIPVCPTVNLAELAQRTTGYVGADLNALCREAIMHAVRE----NAKGSAEQK----------------VVMRHFEEALKVVSPSCLRSSLGRTDL 454          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: pex6 (peroxisomal biogenesis factor 6 [Source:NCBI gene;Acc:101175128])

HSP 1 Score: 266.159 bits (679), Expect = 1.199e-74
Identity = 187/530 (35.28%), Postives = 292/530 (55.09%), Query Frame = 3
Query:  774 PPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRN-KMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTV-EVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPL-PDEKSRIQILKANLRKSPIAKDVDVNYMA-KVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTL 2351
            P   +LL+GP G+GK  + RA +         ++   + +     SE+ L  AF  AE   P ++ +  L  +   R     E + R+ + L  L+D    R  V V+A  +R   +   +     F   V++       R  +L   ++++ LG DV LE+++  T G V  DL AL  EA     R  +      ++ ++ +   + + V  +DF +AL     +  +     ++PNV WEDIGGLQ VK+E+ + VQ P++HP+  L  G+  + GVL YGPPG GKTLLAKA+A EC   F+S+KGPEL+ M+ G+SE N+R++F +AR AAPCV+FFDELDS+A  R G  GD GG  DRV++QLL E+D +++   VF+IGATNRPD++D ++LRPGR D+LIY+ +  D  S++Q+L+A LRK  +   V++  +  +     +GADL  +C  A   AI+  I   I A  D +       E  +   P+     F  A++  + SV++ ++ +Y+   + L
Sbjct:  402 PRCTVLLHGPAGSGKMTVVRAASCRLHLHLLKVDCVTLCADTPAASEAKLTSAFHRAEVLQPCLLLLRNLQLLVRPRG---AEEDGRVQAALCQLLDSAPTR--VAVVATVSRARDLSGGV--MAAFVHRVELESLTEEQRHAMLISLSRHLHLGRDVSLERLSKLTAGFVLGDLNALVVEAGRAACRRLRQSCASRQQEDLCS---SGVTVQNQDFTFALDVLQDAQSKSVGAPKIPNVHWEDIGGLQLVKKEILDTVQLPLQHPE-LLSLGLNRT-GVLLYGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQSEENIREVFHRARSAAPCVVFFDELDSLAP-RRGRSGDSGGVMDRVVSQLLAELDALNSSVGVFVIGATNRPDLLDQSLLRPGRFDKLIYVGINEDRASQLQVLQAILRKFRLDPAVNLQEVVDRCPAQMTGADLYALCSDAMTAAIKRKISL-IEAGLDSE-------ESPVLLSPD----DFSSALENFKPSVSEQELTRYQNIQKKL 906          

HSP 2 Score: 187.578 bits (475), Expect = 2.539e-48
Identity = 109/282 (38.65%), Postives = 170/282 (60.28%), Query Frame = 3
Query:  654 KLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKT--HGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGI-PDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHV-GADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNV 1487
            K+  V ++DIGG +    +I + V+LPL+HP+L  ++G+    G+LLYGPPGTGKTL+A+AVA E    F  + GPE+++   G+SE N+R+ F  A   +P ++F DELD++AP+R ++   G V  R+VSQLL  +D L     V V+ ATNRP+ +D +L R GRFD+ + +GI  D   +L++L+   +  RL   V+L++V       + GADL ALC++A    I+ K+ LI   E  +D+E  + + ++ +DF  AL    PS   +      N+
Sbjct:  627 KIPNVHWEDIGGLQLVKKEILDTVQLPLQHPELL-SLGLNR-TGVLLYGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQSEENIREVFHRARSAAPCVVFFDELDSLAPRRGRSGDSGGVMDRVVSQLLAELDALNSSVGVFVIGATNRPDLLDQSLLRPGRFDKLIYVGINEDRASQLQVLQAILRKFRLDPAVNLQEVVDRCPAQMTGADLYALCSDAMTAAIKRKISLI---EAGLDSEE-SPVLLSPDDFSSALENFKPSVSEQELTRYQNI 902          
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Match: pex1 (peroxisomal biogenesis factor 1 [Source:NCBI gene;Acc:101174758])

HSP 1 Score: 240.35 bits (612), Expect = 5.944e-65
Identity = 167/483 (34.58%), Postives = 257/483 (53.21%), Query Frame = 3
Query:  783 GILLYGPPGTGKTLIARAVANET----GSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGE--------VERRIVSQLLTLMDGLKQRSHVIVMAATNRP-NSIDPALRRF--GRFDRE-VDIGIPDTTGRLEILR--IHTKNM---RLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPN-VTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIR 2165
             +L+ G  G+GK+ ++R +  +      S   +++  ++  K A      L+  FE+AE   P+++ +D+LD +A  R  T  E        ++  I   L  ++D    RS ++ +  T+   +S+ P+L       F +  V+I  PD   R EIL+  I  K +    +   +DL  VA ET G+   DL  L  E A      +    D E             +T+ DF  AL    P +L    +  P+ V  E +GGL+ V+++L + +  P + P  F    +    G+L YG PG GKTL A+A+A +   NFISIKGPELL+ + G SE  VRD+F +A+ A+PC+LFFDE DS+A        D  G  DRV+NQLLT++DG+   + V+++ AT+RPD+ID A+LRPGRLD+ +Y P PD ++R++ILKA     P+  DVD+  +A  T  F+GADL  +   A  +A+ 
Sbjct:  495 ALLITGAKGSGKSTLSRGLCRKAREDLDSHVEVVDCKKLQGKKAETVRQILQDVFEQAEWRQPSVVLLDDLDYLA--RAPTTPEQDSGPEALLQAHIAQTLRDIVDEFVVRSSLVCLIITSTSEHSLHPSLTEVQGSHFIQGFVNIQPPDQIQRAEILQHLILRKPLFSEEVPSTLDLTAVAKETEGYTAQDLYVLL-ERATHANTTRTGRRDRET-----------CLTLTDFEQALKGFVPPSLWGVDLRAPSGVGLERVGGLKEVRQQLMDTILLPAKFPILFCNLPIRHRSGILLYGAPGTGKTLTARAVAKDSGMNFISIKGPELLSKYIGASEQAVRDVFQRAQAASPCILFFDEFDSLAP---RRGHDSTGVTDRVVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCLYCPPPDLEARLEILKALSTGLPLTPDVDLEQLAAATEQFTGADLKALLYNAQLEAVH 960          

HSP 2 Score: 193.741 bits (491), Expect = 5.347e-50
Identity = 103/226 (45.58%), Postives = 142/226 (62.83%), Query Frame = 3
Query:  666 VGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNK 1343
            VG + +GG ++   Q+ + + LP + P LF  + ++   GILLYG PGTGKTL ARAVA ++G  F  I GPE++SK  G SE  +R  F+ A+  SP I+F DE D++AP+R      V  R+V+QLLT +DG++    V V+AAT+RP+ IDPAL R GR D+ +    PD   RLEIL+  +  + L  DVDLEQ+A+ T    GADL AL   A L+ + NK
Sbjct:  737 VGLERVGGLKEVRQQLMDTILLPAKFPILFCNLPIRHRSGILLYGAPGTGKTLTARAVAKDSGMNFISIKGPELLSKYIGASEQAVRDVFQRAQAASPCILFFDEFDSLAPRRGHDSTGVTDRVVNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCLYCPPPDLEARLEILKALSTGLPLTPDVDLEQLAAATEQFTGADLKALLYNAQLEAVHNK 962          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000009924.1 (SMESG000009924.1)

HSP 1 Score: 1608.19 bits (4163), Expect = 0.000e+0
Identity = 817/817 (100.00%), Postives = 817/817 (100.00%), Query Frame = 3
Query:   75 MASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLYD 2525
            MASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLQQSRGFGGSFRFPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLYD
Sbjct:    1 MASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLQQSRGFGGSFRFPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLYD 817          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000016085.1 (SMESG000016085.1)

HSP 1 Score: 1323.92 bits (3425), Expect = 0.000e+0
Identity = 660/787 (83.86%), Postives = 721/787 (91.61%), Query Frame = 3
Query:  102 ETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSN 2462
            + ++++ KAKPNRLIVE+   DDNSVV++SQ KMDEL LFRGDTVL+KGKKRRE++CIAL+ ETCP+EKI+MNRCVR NLRVRLGD++SV  C NI YGKR+H LPIDDTIEG+TGN+YEVFLKPYF+EAYRPVRK+D+FIVRG MRAVEFKVI TDPSP CIVAP+T+IHFEG+P+ RADE+EKLNE+GYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPP GILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDE+DAIAPKREKT GEVERRIVSQLLTLMDGLKQRSHV+VMAATNRPNSID ALRRFGRFDREVDIGIPD+ GRLEILRIHTKNMRL ++VDLE +A ETHGHVGADLAALC+EAALQQIRNKMDLIDLEE EIDAE+LNSLAVTMEDFRWAL KSNPSALRETTVE+PNV W D+GGL  VK+ELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIA+ECQANFISIKGPELLTMWFGESEAN+R++FDKARQAAPC+LFFDELDSIAKSRG S  DGGGA+DRVINQLLTEMDGMS KKNVFIIGATNRPDIID+AILRPGRLDQLIYIPLPDEKSRIQI KA LRKSPIAKDVD+NY++KVTHGFSGADLTEICQRACK AIRE IEA++++A + + K  E +   +DPVPEITR HFEEAMK ARRSVTDND+RKYEMFAQTLQQSRGFG +FRFP   +   +GGN F       QQ N
Sbjct:   11 DASVVKKKAKPNRLIVEESEQDDNSVVTLSQIKMDELNLFRGDTVLIKGKKRRESICIALMSETCPNEKIKMNRCVRSNLRVRLGDIVSVLTCNNIQYGKRIHTLPIDDTIEGLTGNLYEVFLKPYFLEAYRPVRKNDIFIVRGNMRAVEFKVIATDPSPMCIVAPDTIIHFEGEPIKRADEEEKLNEIGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPSGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKREKTQGEVERRIVSQLLTLMDGLKQRSHVVVMAATNRPNSIDSALRRFGRFDREVDIGIPDSIGRLEILRIHTKNMRLVENVDLEIIAKETHGHVGADLAALCSEAALQQIRNKMDLIDLEEEEIDAEVLNSLAVTMEDFRWALDKSNPSALRETTVEIPNVLWSDVGGLDNVKKELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIASECQANFISIKGPELLTMWFGESEANIRELFDKARQAAPCILFFDELDSIAKSRGSSASDGGGASDRVINQLLTEMDGMSLKKNVFIIGATNRPDIIDSAILRPGRLDQLIYIPLPDEKSRIQIFKAALRKSPIAKDVDLNYLSKVTHGFSGADLTEICQRACKLAIRESIEAELKSANNPKPKCNEKL---VDPVPEITRVHFEEAMKAARRSVTDNDIRKYEMFAQTLQQSRGFGNNFRFPNGADLQGNGGNAFINEPVPLQQVN 794          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000016085.1 (SMESG000016085.1)

HSP 1 Score: 1315.44 bits (3403), Expect = 0.000e+0
Identity = 660/798 (82.71%), Postives = 721/798 (90.35%), Query Frame = 3
Query:  102 ETAILRSKAKPNRLIVEDPVNDDNSVVSMSQK-----------KMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSN 2462
            + ++++ KAKPNRLIVE+   DDNSVV++SQ            KMDEL LFRGDTVL+KGKKRRE++CIAL+ ETCP+EKI+MNRCVR NLRVRLGD++SV  C NI YGKR+H LPIDDTIEG+TGN+YEVFLKPYF+EAYRPVRK+D+FIVRG MRAVEFKVI TDPSP CIVAP+T+IHFEG+P+ RADE+EKLNE+GYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPP GILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDE+DAIAPKREKT GEVERRIVSQLLTLMDGLKQRSHV+VMAATNRPNSID ALRRFGRFDREVDIGIPD+ GRLEILRIHTKNMRL ++VDLE +A ETHGHVGADLAALC+EAALQQIRNKMDLIDLEE EIDAE+LNSLAVTMEDFRWAL KSNPSALRETTVE+PNV W D+GGL  VK+ELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIA+ECQANFISIKGPELLTMWFGESEAN+R++FDKARQAAPC+LFFDELDSIAKSRG S  DGGGA+DRVINQLLTEMDGMS KKNVFIIGATNRPDIID+AILRPGRLDQLIYIPLPDEKSRIQI KA LRKSPIAKDVD+NY++KVTHGFSGADLTEICQRACK AIRE IEA++++A + + K  E +   +DPVPEITR HFEEAMK ARRSVTDND+RKYEMFAQTLQQSRGFG +FRFP   +   +GGN F       QQ N
Sbjct:   11 DASVVKKKAKPNRLIVEESEQDDNSVVTLSQLHSNYEETFYYIKMDELNLFRGDTVLIKGKKRRESICIALMSETCPNEKIKMNRCVRSNLRVRLGDIVSVLTCNNIQYGKRIHTLPIDDTIEGLTGNLYEVFLKPYFLEAYRPVRKNDIFIVRGNMRAVEFKVIATDPSPMCIVAPDTIIHFEGEPIKRADEEEKLNEIGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPSGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKREKTQGEVERRIVSQLLTLMDGLKQRSHVVVMAATNRPNSIDSALRRFGRFDREVDIGIPDSIGRLEILRIHTKNMRLVENVDLEIIAKETHGHVGADLAALCSEAALQQIRNKMDLIDLEEEEIDAEVLNSLAVTMEDFRWALDKSNPSALRETTVEIPNVLWSDVGGLDNVKKELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIASECQANFISIKGPELLTMWFGESEANIRELFDKARQAAPCILFFDELDSIAKSRGSSASDGGGASDRVINQLLTEMDGMSLKKNVFIIGATNRPDIIDSAILRPGRLDQLIYIPLPDEKSRIQIFKAALRKSPIAKDVDLNYLSKVTHGFSGADLTEICQRACKLAIRESIEAELKSANNPKPKCNEKL---VDPVPEITRVHFEEAMKAARRSVTDNDIRKYEMFAQTLQQSRGFGNNFRFPNGADLQGNGGNAFINEPVPLQQVN 805          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000016085.1 (SMESG000016085.1)

HSP 1 Score: 1313.52 bits (3398), Expect = 0.000e+0
Identity = 658/798 (82.46%), Postives = 721/798 (90.35%), Query Frame = 3
Query:  102 ETAILRSKAKPNRLIVEDPVNDDNSVVSMSQK-----------KMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSN 2462
            + ++++ KAKPNRLIVE+   DDNSVV++++            KMDEL LFRGDTVL+KGKKRRE++CIAL+ ETCP+EKI+MNRCVR NLRVRLGD++SV  C NI YGKR+H LPIDDTIEG+TGN+YEVFLKPYF+EAYRPVRK+D+FIVRG MRAVEFKVI TDPSP CIVAP+T+IHFEG+P+ RADE+EKLNE+GYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPP GILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDE+DAIAPKREKT GEVERRIVSQLLTLMDGLKQRSHV+VMAATNRPNSID ALRRFGRFDREVDIGIPD+ GRLEILRIHTKNMRL ++VDLE +A ETHGHVGADLAALC+EAALQQIRNKMDLIDLEE EIDAE+LNSLAVTMEDFRWAL KSNPSALRETTVE+PNV W D+GGL  VK+ELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIA+ECQANFISIKGPELLTMWFGESEAN+R++FDKARQAAPC+LFFDELDSIAKSRG S  DGGGA+DRVINQLLTEMDGMS KKNVFIIGATNRPDIID+AILRPGRLDQLIYIPLPDEKSRIQI KA LRKSPIAKDVD+NY++KVTHGFSGADLTEICQRACK AIRE IEA++++A + + K  E +   +DPVPEITR HFEEAMK ARRSVTDND+RKYEMFAQTLQQSRGFG +FRFP   +   +GGN F       QQ N
Sbjct:   11 DASVVKKKAKPNRLIVEESEQDDNSVVTLTKLHSNYEETFYYIKMDELNLFRGDTVLIKGKKRRESICIALMSETCPNEKIKMNRCVRSNLRVRLGDIVSVLTCNNIQYGKRIHTLPIDDTIEGLTGNLYEVFLKPYFLEAYRPVRKNDIFIVRGNMRAVEFKVIATDPSPMCIVAPDTIIHFEGEPIKRADEEEKLNEIGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPSGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDEIDAIAPKREKTQGEVERRIVSQLLTLMDGLKQRSHVVVMAATNRPNSIDSALRRFGRFDREVDIGIPDSIGRLEILRIHTKNMRLVENVDLEIIAKETHGHVGADLAALCSEAALQQIRNKMDLIDLEEEEIDAEVLNSLAVTMEDFRWALDKSNPSALRETTVEIPNVLWSDVGGLDNVKKELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIASECQANFISIKGPELLTMWFGESEANIRELFDKARQAAPCILFFDELDSIAKSRGSSASDGGGASDRVINQLLTEMDGMSLKKNVFIIGATNRPDIIDSAILRPGRLDQLIYIPLPDEKSRIQIFKAALRKSPIAKDVDLNYLSKVTHGFSGADLTEICQRACKLAIRESIEAELKSANNPKPKCNEKL---VDPVPEITRVHFEEAMKAARRSVTDNDIRKYEMFAQTLQQSRGFGNNFRFPNGADLQGNGGNAFINEPVPLQQVN 805          
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Match: SMESG000027507.1 (SMESG000027507.1)

HSP 1 Score: 1177.16 bits (3044), Expect = 0.000e+0
Identity = 584/797 (73.27%), Postives = 685/797 (85.95%), Query Frame = 3
Query:  135 NRLIVEDPVNDDNSVVSMSQKKMDELQLFRGDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQPCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFIVRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGYDDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASETHGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFRWALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDIFDKARQAAPCVLFFDELDSIAKXXXXXXXXXXXXXXXXINQLLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSRIQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECIEADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVRKYEMFAQTLXXXXXXXXXXXXPGANETPSSGGNDFSRGSATNQQSNIPVSVGGAGAGFNDVEDDLYD 2525
            NRL+V+D + DD+SVV +SQ++MDEL LFRGDTVL+KG  RRETVCIAL D +   EKI MNRC R NL V++ D++ +  C +I YG +VH+LPIDDTIEG+TGN+YEVFLKPYF+++YRPV K ++FIVRGGMRAVEFKVIE +PSP CIV+PET+I  EG P+ R++E+E+ N VGYDDIGGCRKQL  IKEMVELPLRHP+LFK IG+KPPRGILL+GPPGTGKT+IARAVANETG+FFFLINGPEIMSK+AGESESNLRKAFEEAEKNSP+I+FIDE+D+IAPKR+KT+GEVE+RIVSQLLTLMDGLK RS+V+VMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNM++ DDV+LEQVA+ETHG VGADLA+LC+EAALQ IR KMDLID EE EIDAEIL+SLAVTM+DFR+A+SK++PSALRE +VE+PNV+W+D+GGL+ VK+ELQE+VQYPV+HP+ FLKFGM+PSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTM+FGESEAN+R+IFDKARQAAPCVLFFDELDSIA +RG   GD GGA DRVINQLLTEMDGMS+KKNVFIIGATNRPDI+D AILRPGRLDQLIYIPLPDEKSR+ ILKANLRKSP+++ V++ ++A+VT GFSGADLTEICQR CK AIR+CIE DI AAR++    GE +E   DPVPE+T  HFE+AMK AR+SV+ +DV KYEMF+Q L                +     G+ F   SA+NQ++N  +          D EDDLYD
Sbjct:    6 NRLVVDDLLGDDSSVVKLSQERMDELNLFRGDTVLIKGNLRRETVCIALPDASVTKEKILMNRCTRINLGVKISDIVRISCCADIPYGAKVHILPIDDTIEGLTGNLYEVFLKPYFLDSYRPVSKGELFIVRGGMRAVEFKVIEIEPSPRCIVSPETIIFTEGIPISRSEEEERTNLVGYDDIGGCRKQLDLIKEMVELPLRHPELFKTIGIKPPRGILLFGPPGTGKTMIARAVANETGAFFFLINGPEIMSKMAGESESNLRKAFEEAEKNSPSILFIDEVDSIAPKRDKTNGEVEKRIVSQLLTLMDGLKSRSNVVVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMKISDDVNLEQVANETHGCVGADLASLCSEAALQHIRGKMDLIDFEEEEIDAEILHSLAVTMDDFRYAMSKNHPSALREHSVEIPNVSWDDVGGLENVKQELQEMVQYPVQHPEMFLKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMYFGESEANIREIFDKARQAAPCVLFFDELDSIATARGSGAGDAGGAGDRVINQLLTEMDGMSSKKNVFIIGATNRPDILDGAILRPGRLDQLIYIPLPDEKSRLAILKANLRKSPVSQRVNLEHLARVTDGFSGADLTEICQRTCKLAIRQCIEEDI-AARNR----GEEIE---DPVPELTVAHFEDAMKVARKSVSASDVHKYEMFSQNL----------------QRSRGVGSGFKFPSASNQETNQSM----------DAEDDLYD 768          
The following BLAST results are available for this feature:
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VCP0.000e+085.49valosin containing protein [Source:HGNC Symbol;Acc... [more]
SPATA51.940e-16747.47spermatogenesis associated 5 [Source:HGNC Symbol;A... [more]
NVL1.391e-15043.34nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070... [more]
NVL1.337e-14943.34nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070... [more]
NVL3.296e-14943.34nuclear VCP like [Source:HGNC Symbol;Acc:HGNC:8070... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc-48.10.000e+077.42Transitional endoplasmic reticulum ATPase homolog ... [more]
cdc-48.20.000e+078.75Transitional endoplasmic reticulum ATPase homolog ... [more]
cdc-48.20.000e+078.75Transitional endoplasmic reticulum ATPase homolog ... [more]
mac-12.635e-13037.90pep chromosome:WBcel235:II:13311459:13320911:-1 ge... [more]
cdc-48.31.868e-7733.73ATPase family protein 2 homolog [Source:UniProtKB... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TER940.000e+078.46gene:FBgn0286784 transcript:FBtr0088391[more]
TER940.000e+078.60gene:FBgn0286784 transcript:FBtr0343852[more]
TER940.000e+078.50gene:FBgn0286784 transcript:FBtr0112905[more]
TER940.000e+079.10gene:FBgn0286784 transcript:FBtr0112906[more]
CG57761.975e-11838.64gene:FBgn0032450 transcript:FBtr0329925[more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vcp0.000e+085.04valosin containing protein [Source:NCBI gene;Acc:3... [more]
vcp0.000e+085.43valosin containing protein [Source:NCBI gene;Acc:3... [more]
zgc:1369080.000e+081.32zgc:136908 [Source:ZFIN;Acc:ZDB-GENE-060312-22][more]
nvl4.717e-15344.18nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
CABZ01085878.19.821e-13551.01spermatogenesis associated 5 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dtymk0.000e+081.20deoxythymidylate kinase [Source:Xenbase;Acc:XB-GEN... [more]
dtymk0.000e+085.51deoxythymidylate kinase [Source:Xenbase;Acc:XB-GEN... [more]
dtymk0.000e+085.49deoxythymidylate kinase [Source:Xenbase;Acc:XB-GEN... [more]
dtymk0.000e+081.18deoxythymidylate kinase [Source:Xenbase;Acc:XB-GEN... [more]
dtymk0.000e+085.92deoxythymidylate kinase [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vcp0.000e+085.49valosin containing protein [Source:MGI Symbol;Acc:... [more]
Spata52.125e-16746.17spermatogenesis associated 5 [Source:MGI Symbol;Ac... [more]
Spata52.502e-16746.17spermatogenesis associated 5 [Source:MGI Symbol;Ac... [more]
Spata53.639e-16250.20spermatogenesis associated 5 [Source:MGI Symbol;Ac... [more]
Nvl2.340e-14641.88nuclear VCP-like [Source:MGI Symbol;Acc:MGI:191470... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23787|TERA_XENLA0.000e+085.62Transitional endoplasmic reticulum ATPase OS=Xenop... [more]
sp|Q6GL04|TERA_XENTR0.000e+085.49Transitional endoplasmic reticulum ATPase OS=Xenop... [more]
sp|Q7ZU99|TERA_DANRE0.000e+085.43Transitional endoplasmic reticulum ATPase OS=Danio... [more]
sp|Q01853|TERA_MOUSE0.000e+085.49Transitional endoplasmic reticulum ATPase OS=Mus m... [more]
sp|P55072|TERA_HUMAN0.000e+085.49Transitional endoplasmic reticulum ATPase OS=Homo ... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R3E50.000e+082.93Transitional endoplasmic reticulum ATPase OS=Fasci... [more]
A0A4S2LCV90.000e+087.35Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8WPB30.000e+088.69Cell division control protein 48 OS=Opisthorchis v... [more]
A0A5J4NGB20.000e+086.64Transitional endoplasmic reticulum ATPase OS=Parag... [more]
A0A1L8HSA20.000e+085.75Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1369080.000e+078.94zgc:136908 [Source:ZFIN;Acc:ZDB-GENE-060312-22][more]
SPATA55.389e-16041.99spermatogenesis associated 5 [Source:HGNC Symbol;A... [more]
pex62.031e-7634.79peroxisomal biogenesis factor 6 [Source:NCBI gene;... [more]
nvl7.824e-7142.60nuclear VCP like [Source:NCBI gene;Acc:103033742][more]
nvl7.824e-7142.60nuclear VCP like [Source:NCBI gene;Acc:103033742][more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vcp7.691e-5382.27valosin containing protein [Source:NCBI gene;Acc:3... [more]
vcp2.871e-4690.15valosin containing protein [Source:NCBI gene;Acc:3... [more]
nvl2.103e-13342.96nuclear VCP like [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
ENSPMAT00000001672.14.566e-9774.87pep scaffold:Pmarinus_7.0:GL489293:318:4695:-1 gen... [more]
atad2b1.568e-5942.55ATPase family AAA domain containing 2B [Source:ZFI... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC480.000e+066.34AAA ATPase; subunit of polyUb-selective segregase ... [more]
AFG28.484e-15445.41ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms... [more]
RIX72.963e-13439.23Putative ATPase of the AAA family; required for ex... [more]
PEX67.360e-6837.23AAA-peroxin; heterodimerizes with AAA-peroxin Pex1... [more]
YTA73.889e-6345.42Protein that localizes to chromatin; has a role in... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO362180.000e+084.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390067.413e-17650.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357055.744e-14847.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456943.155e-13039.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486021.925e-8135.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vcp0.000e+080.19valosin containing protein [Source:NCBI gene;Acc:1... [more]
nvl3.474e-14742.55nuclear VCP like [Source:NCBI gene;Acc:101154831][more]
spata5l12.993e-12336.04spermatogenesis associated 5 like 1 [Source:NCBI g... [more]
pex61.199e-7435.28peroxisomal biogenesis factor 6 [Source:NCBI gene;... [more]
pex15.944e-6534.58peroxisomal biogenesis factor 1 [Source:NCBI gene;... [more]
back to top
BLAST of Transitional endoplasmic reticulum ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009924.10.000e+0100.00SMESG000009924.1[more]
SMESG000016085.10.000e+083.86SMESG000016085.1[more]
SMESG000016085.10.000e+082.71SMESG000016085.1[more]
SMESG000016085.10.000e+082.46SMESG000016085.1[more]
SMESG000027507.10.000e+073.27SMESG000027507.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000299 ID=SMED30000299|Name=Transitional endoplasmic reticulum ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=3135bp
CGCGTTGTTTAAACAATCTAATTAATTACTAAATCTTTCGTTTCTTAAAT
TTTGCATAGTCAGTTTTAATTAATATGGCTTCAAATAAAAATGATGATCT
CGAAACCGCAATATTACGTAGCAAAGCCAAACCTAATAGATTAATTGTTG
AAGATCCTGTTAATGATGACAATTCAGTTGTTTCCATGTCACAAAAAAAA
ATGGATGAATTACAACTATTTAGAGGTGATACAGTGCTATTAAAGGGGAA
AAAACGCCGTGAGACAGTTTGTATAGCGTTGTTAGATGAAACCTGTCCTG
ATGAAAAAATTAGAATGAATAGATGCGTAAGAAAAAATCTACGTGTTAGA
TTAGGAGACGTTATCTCAGTGCAACCATGCCCGAATATTAATTATGGAAA
GCGTGTTCATGTATTGCCTATCGATGACACAATCGAAGGAGTTACCGGAA
ATATTTATGAAGTTTTCCTAAAGCCATATTTCGTCGAAGCTTATAGACCT
GTGCGAAAGGATGATGTTTTCATTGTCAGGGGCGGCATGAGAGCTGTTGA
ATTCAAAGTTATTGAAACGGATCCGTCGCCGTATTGCATCGTTGCTCCAG
AGACCGTTATTCATTTCGAAGGCGATCCTGTAGTGAGAGCAGACGAAGAT
GAGAAATTAAACGAAGTCGGATATGATGATATTGGAGGATGCCGAAAGCA
ATTGGCTCAGATTAAAGAAATGGTGGAATTACCTCTGAGACATCCGCAGT
TATTCAAGGCGATCGGAGTGAAACCGCCACGTGGAATTCTGTTGTACGGG
CCTCCCGGAACTGGTAAAACCTTGATTGCGCGAGCCGTAGCTAATGAAAC
CGGAAGCTTCTTTTTCCTGATAAATGGGCCTGAAATCATGTCAAAATTAG
CTGGAGAATCCGAGTCAAATCTGAGGAAAGCGTTCGAGGAAGCCGAGAAA
AACTCCCCAGCAATAATCTTTATCGACGAGCTCGACGCGATCGCACCGAA
ACGGGAGAAAACTCATGGAGAAGTCGAACGGCGAATCGTATCACAACTGT
TGACGCTGATGGATGGCCTGAAGCAACGGAGTCACGTAATTGTCATGGCA
GCCACTAATCGACCGAATAGCATCGATCCTGCTTTGCGTCGGTTCGGCCG
GTTCGATAGGGAAGTCGATATCGGCATTCCCGATACGACAGGCAGATTGG
AGATCCTGAGAATCCACACGAAAAATATGCGACTCGGTGACGATGTCGAC
CTAGAGCAAGTCGCGAGTGAGACTCACGGTCACGTCGGTGCTGATTTGGC
TGCGCTGTGCACTGAGGCCGCGCTCCAGCAAATCAGGAACAAAATGGACC
TTATCGATCTGGAGGAGCCGGAAATCGATGCGGAAATACTGAATTCGCTC
GCGGTGACAATGGAGGATTTCCGCTGGGCACTCAGCAAGAGCAACCCTTC
AGCGTTGCGGGAAACGACAGTCGAGGTGCCCAATGTTACCTGGGAGGATA
TTGGAGGCCTCCAGGGCGTCAAGCGGGAATTGCAGGAGCTTGTCCAGTAT
CCGGTGGAACATCCAGACAAATTCCTCAAATTCGGAATGACTCCAAGCAA
AGGCGTTTTGTTTTACGGGCCTCCCGGTTGCGGTAAAACGCTATTGGCCA
AGGCGATAGCCAATGAGTGCCAGGCGAATTTCATCAGCATTAAAGGCCCG
GAATTGCTGACAATGTGGTTTGGGGAGTCCGAGGCAAACGTCAGGGATAT
TTTCGATAAAGCCAGACAAGCCGCTCCTTGCGTTCTGTTTTTCGATGAGT
TGGATTCGATCGCCAAATCTCGAGGCGGTAGCGTTGGTGACGGCGGGGGA
GCAGCGGATCGCGTGATCAACCAGTTGCTCACCGAGATGGACGGAATGTC
CGCCAAGAAGAACGTATTCATCATCGGGGCCACAAATCGACCCGACATAA
TCGATGCCGCGATTCTCCGTCCCGGCAGGCTCGACCAGCTCATCTATATC
CCGCTGCCCGACGAGAAATCGCGCATACAAATCCTCAAGGCCAATCTGCG
CAAATCTCCAATTGCAAAGGATGTCGATGTGAATTATATGGCCAAGGTTA
CCCACGGGTTCTCCGGTGCCGATTTGACAGAGATCTGTCAGCGGGCGTGC
AAGCAGGCGATTCGGGAATGCATTGAGGCGGATATCCGGGCTGCCAGGGA
CCAGCAGCTCAAGGGCGGAGAACCGATGGAGGACGATATTGATCCGGTGC
CGGAAATCACCCGCAAGCATTTCGAGGAGGCGATGAAGTACGCCAGGAGG
TCCGTTACCGACAATGACGTGCGCAAGTACGAGATGTTCGCTCAGACTCT
CCAGCAGTCGCGAGGTTTTGGAGGGAGCTTTAGATTCCCCGGCGCAAATG
AAACGCCATCGAGCGGCGGCAACGATTTCTCACGAGGCAGTGCAACCAAT
CAGCAGTCAAACATCCCCGTGTCGGTCGGGGGCGCCGGAGCTGGATTCAA
TGATGTAGAAGATGACCTCTACGACTGAGGGAGTCTCAACAATTCTGTTA
TCATTTCATGTTGATTAAATTAGCTAATTGGTTTTTTATTCATTACAAGT
ATTTCAAATTTATGATGTATTTGTTGATTTCTAATATATATGTCAGTCGG
CGGCTTTGTTCTGGTTGAGATTGGCCAATCGCAATTGGGGTTGTTGGACC
TTGATGCACTTTATTTGTTGTGTTTTATGTTGGCTAATCATAGTTTGCTG
TTGGATGCATTTGTTGCCCATTGTTATAGTGTTATCTGTTGTGTTTGGTG
TTGGCCAATCACAATTTAGGCTGTTGTTGCACGTTATTTGTTGTTTGATG
TTGGCCAATCACAATTTGGGATGTTGGATCCCTTTTGTTGCCCATTGTTA
TTGTGTTTGGTGTTGGCCAATCCCGATTTAGGCTGTTGCTGAACGTTATT
TGCTGTGTCTGTTGTTGGCCAATCACAATTTTGGATCCTTTGGTTGTCCT
TTATTATCGTGTTATCTGTTGTGTTTGATGTTTGTTTCTATTTTTCCATA
TTATCATTTTTTATTATCGGGTTTTTCTATTACATAAATTTTTTACGTCA
TAATAAATAAAATCTCATTGTACAATGACACAAAA
back to top

protein sequence of SMED30000299-orf-1

>SMED30000299-orf-1 ID=SMED30000299-orf-1|Name=SMED30000299-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=818bp
MASNKNDDLETAILRSKAKPNRLIVEDPVNDDNSVVSMSQKKMDELQLFR
GDTVLLKGKKRRETVCIALLDETCPDEKIRMNRCVRKNLRVRLGDVISVQ
PCPNINYGKRVHVLPIDDTIEGVTGNIYEVFLKPYFVEAYRPVRKDDVFI
VRGGMRAVEFKVIETDPSPYCIVAPETVIHFEGDPVVRADEDEKLNEVGY
DDIGGCRKQLAQIKEMVELPLRHPQLFKAIGVKPPRGILLYGPPGTGKTL
IARAVANETGSFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFI
DELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRSHVIVMAATNRPNSI
DPALRRFGRFDREVDIGIPDTTGRLEILRIHTKNMRLGDDVDLEQVASET
HGHVGADLAALCTEAALQQIRNKMDLIDLEEPEIDAEILNSLAVTMEDFR
WALSKSNPSALRETTVEVPNVTWEDIGGLQGVKRELQELVQYPVEHPDKF
LKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFG
ESEANVRDIFDKARQAAPCVLFFDELDSIAKSRGGSVGDGGGAADRVINQ
LLTEMDGMSAKKNVFIIGATNRPDIIDAAILRPGRLDQLIYIPLPDEKSR
IQILKANLRKSPIAKDVDVNYMAKVTHGFSGADLTEICQRACKQAIRECI
EADIRAARDQQLKGGEPMEDDIDPVPEITRKHFEEAMKYARRSVTDNDVR
KYEMFAQTLQQSRGFGGSFRFPGANETPSSGGNDFSRGSATNQQSNIPVS
VGGAGAGFNDVEDDLYD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0042802identical protein binding
GO:0044877macromolecular complex binding
GO:0005524ATP binding
GO:0008289lipid binding
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:0032403protein complex binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0010494cytoplasmic stress granule
GO:0035861site of double-strand break
GO:0000785chromatin
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0010498proteasomal protein catabolic process
GO:0016236macroautophagy
GO:0032510endosome to lysosome transport via multivesicular body sorting pathway
GO:0034605cellular response to heat
GO:0035617stress granule disassembly
GO:0061857endoplasmic reticulum stress-induced pre-emptive quality control
GO:1903843cellular response to arsenite ion
GO:0006810transport
GO:0006914autophagy
GO:0006974cellular response to DNA damage stimulus
GO:0016567protein ubiquitination
GO:0018279protein N-linked glycosylation via asparagine
GO:0019985translesion synthesis
GO:0030433ubiquitin-dependent ERAD pathway
GO:0034214protein hexamerization
GO:0036503ERAD pathway
GO:0043161proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0097352autophagosome maturation
GO:0006281DNA repair
GO:0006302double-strand break repair
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041569AAA_lid_3
IPR005938AAA_ATPase_CDC48
IPR003593AAA+_ATPase
IPR004201Cdc48_dom2
IPR003338CDC4_N-term_subdom
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
IPR015415Vps4_C
IPR029067CDC48_domain_2-like_sf
IPR003960ATPase_AAA_CS
IPR009010Asp_de-COase-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004201CDC48, domain 2SMARTSM01072CDC48_2_2coord: 122..188
e-value: 6.6E-10
score: 48.9
IPR004201CDC48, domain 2PFAMPF02933CDC48_2coord: 125..186
e-value: 2.7E-7
score: 30.3
IPR003338CDC48, N-terminal subdomainSMARTSM01073CDC48_N_2coord: 22..105
e-value: 3.3E-28
score: 109.7
IPR003338CDC48, N-terminal subdomainPFAMPF02359CDC48_Ncoord: 23..103
e-value: 3.0E-20
score: 72.2
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 234..370
e-value: 2.5E-23
score: 93.5
coord: 507..646
e-value: 1.5E-24
score: 97.5
IPR015415Vps4 oligomerisation, C-terminalPFAMPF09336Vps4_Ccoord: 725..757
e-value: 2.3E-5
score: 24.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 465..645
e-value: 4.3E-73
score: 246.9
NoneNo IPR availableGENE3DG3DSA:3.10.330.10coord: 105..201
e-value: 4.0E-45
score: 153.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 202..367
e-value: 2.2E-65
score: 221.7
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 369..464
e-value: 5.9E-34
score: 117.9
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 646..760
e-value: 7.3E-43
score: 147.6
NoneNo IPR availableGENE3DG3DSA:2.40.40.20coord: 1..104
e-value: 1.7E-45
score: 154.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 777..817
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 777..800
NoneNo IPR availablePANTHERPTHR23077AAA-FAMILY ATPASEcoord: 3..790
NoneNo IPR availablePANTHERPTHR23077:SF69TRANSITIONAL ENDOPLASMIC RETICULUM ATPASEcoord: 3..790
NoneNo IPR availableCDDcd00009AAAcoord: 477..644
e-value: 3.71059E-30
score: 114.551
NoneNo IPR availableCDDcd00009AAAcoord: 225..367
e-value: 1.2065E-30
score: 115.706
IPR041569AAA ATPase, AAA+ lid domainPFAMPF17862AAA_lid_3coord: 666..705
e-value: 4.7E-10
score: 39.1
coord: 390..430
e-value: 4.4E-11
score: 42.4
IPR005938AAA ATPase, CDC48 familyTIGRFAMTIGR01243TIGR01243coord: 34..760
e-value: 1.6E-253
score: 841.3
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 238..367
e-value: 6.1E-47
score: 159.3
coord: 511..644
e-value: 9.5E-47
score: 158.7
IPR003960ATPase, AAA-type, conserved sitePROSITEPS00674AAAcoord: 338..356
IPR003960ATPase, AAA-type, conserved sitePROSITEPS00674AAAcoord: 614..632
IPR009010Aspartate decarboxylase-like domain superfamilySUPERFAMILYSSF50692ADC-likecoord: 19..102
IPR029067CDC48 domain 2-like superfamilySUPERFAMILYSSF54585Cdc48 domain 2-likecoord: 104..194
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 197..459
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 469..758