GH12743

Overview
NameGH12743
Smed IDSMED30000294
Length (bp)1026
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GH12743 (SMED30000294) t-SNE clustered cells

Violin plots show distribution of expression levels for GH12743 (SMED30000294) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GH12743 (SMED30000294) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GH12743 (SMED30000294) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000294

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30000294SMESG000029312.1 dd_Smed_v4_10976_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GH12743 vs. Ensembl Human
Match: NDUFAF6 (NADH:ubiquinone oxidoreductase complex assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:28625])

HSP 1 Score: 89.3521 bits (220), Expect = 3.577e-33
Identity = 55/188 (29.26%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVY 976
            L + W+ +I D R K + +  ++++KE   Y +    SLLY+    + I D+  DH  SH+G+ QG++  +R  T     R+KV +P D+   + +S  D +R      + DK +++++Y IAS AH       S +   K+ P      F   +    +L+K++  DF++F+ SL Q + LL  ++Y
Sbjct:  147 LTKRWLMKIVDEREKNLDDKAYRNIKELENYAENTQSSLLYLTLEILGIKDLHADHAASHIGKAQGIVTCLRA-TPYHGSRRKVFLPMDICMLHGVSQEDFLR-----RNQDKNVRDVIYDIASQAHLHLKHARSFH---KTVPVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLY 325          

HSP 2 Score: 72.4034 bits (176), Expect = 3.577e-33
Identity = 28/76 (36.84%), Postives = 52/76 (68.42%), Query Frame = 1
Query:   88 NYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF-DNDSKTKI 312
            +YC E++RK D+E Y+C+L+LP  ++ + FALR  N+EL+ + +SVS+  IG ++ +FW+  ++ ++ DN     +
Sbjct:   59 HYCLELLRKRDYEGYLCSLLLPAESRSSVFALRAFNVELAQVKDSVSEKTIGLMRMQFWKKTVEDIYCDNPPHQPV 134          
BLAST of GH12743 vs. Ensembl Human
Match: NDUFAF6 (NADH:ubiquinone oxidoreductase complex assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:28625])

HSP 1 Score: 89.3521 bits (220), Expect = 3.729e-20
Identity = 55/188 (29.26%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVY 976
            L + W+ +I D R K + +  ++++KE   Y +    SLLY+    + I D+  DH  SH+G+ QG++  +R  T     R+KV +P D+   + +S  D +R      + DK +++++Y IAS AH       S +   K+ P      F   +    +L+K++  DF++F+ SL Q + LL  ++Y
Sbjct:   55 LTKRWLMKIVDEREKNLDDKAYRNIKELENYAENTQSSLLYLTLEILGIKDLHADHAASHIGKAQGIVTCLRA-TPYHGSRRKVFLPMDICMLHGVSQEDFLR-----RNQDKNVRDVIYDIASQAHLHLKHARSFH---KTVPVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLY 233          
BLAST of GH12743 vs. Ensembl Human
Match: NDUFAF6 (NADH:ubiquinone oxidoreductase complex assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:28625])

HSP 1 Score: 89.3521 bits (220), Expect = 3.729e-20
Identity = 55/188 (29.26%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVY 976
            L + W+ +I D R K + +  ++++KE   Y +    SLLY+    + I D+  DH  SH+G+ QG++  +R  T     R+KV +P D+   + +S  D +R      + DK +++++Y IAS AH       S +   K+ P      F   +    +L+K++  DF++F+ SL Q + LL  ++Y
Sbjct:   55 LTKRWLMKIVDEREKNLDDKAYRNIKELENYAENTQSSLLYLTLEILGIKDLHADHAASHIGKAQGIVTCLRA-TPYHGSRRKVFLPMDICMLHGVSQEDFLR-----RNQDKNVRDVIYDIASQAHLHLKHARSFH---KTVPVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLY 233          
BLAST of GH12743 vs. Ensembl Human
Match: NDUFAF6 (NADH:ubiquinone oxidoreductase complex assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:28625])

HSP 1 Score: 72.0182 bits (175), Expect = 1.060e-14
Identity = 28/76 (36.84%), Postives = 52/76 (68.42%), Query Frame = 1
Query:   88 NYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF-DNDSKTKI 312
            +YC E++RK D+E Y+C+L+LP  ++ + FALR  N+EL+ + +SVS+  IG ++ +FW+  ++ ++ DN     +
Sbjct:   40 HYCLELLRKRDYEGYLCSLLLPAESRSSVFALRAFNVELAQVKDSVSEKTIGLMRMQFWKKTVEDIYCDNPPHQPV 115          
BLAST of GH12743 vs. Ensembl Human
Match: NDUFAF6 (NADH:ubiquinone oxidoreductase complex assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:28625])

HSP 1 Score: 53.5286 bits (127), Expect = 7.102e-9
Identity = 19/40 (47.50%), Postives = 31/40 (77.50%), Query Frame = 1
Query:   88 NYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELS 207
            +YC E++RK D+E Y+C+L+LP  ++ + FALR  N+EL+
Sbjct:   40 HYCLELLRKRDYEGYLCSLLLPAESRSSVFALRAFNVELA 79          
BLAST of GH12743 vs. Ensembl Fly
Match: sicily (gene:FBgn0030352 transcript:FBtr0073572)

HSP 1 Score: 95.5153 bits (236), Expect = 4.399e-37
Identity = 64/194 (32.99%), Postives = 105/194 (54.12%), Query Frame = 2
Query:  428 INRIFDARLKLMYEIP----FKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKR 997
            +N+++  RL    E P    F+S++E  EY +    SLL +L     + D++ DH  SHLG+ QG+  L+R I  LA  +Q   IP +V+  + +S   IIR      SDDK +++ ++ +ASAA+        ++ ++   P  VR++F   +    YLE+LR A+F L +KS    D LL   ++WK ++ R
Sbjct:  148 LNKVYLRRLVTARERPPTHAFESIRELEEYTEQTFSSLLLLLLEVGGVRDLNADHAASHLGKAQGIATLLRSIP-LAGRQQAPCIPLEVLVLHGVSQERIIR----SKSDDKGVEDCIFDVASAANTHLKLARQLHDKV---PPQVRKIFLSAVATDAYLERLRRANFLLTHKSCVGRDTLLPARLFWKSLLNR 333          

HSP 2 Score: 78.5666 bits (192), Expect = 4.399e-37
Identity = 33/89 (37.08%), Postives = 60/89 (67.42%), Query Frame = 1
Query:   91 YCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELS-NINNSVSKPEIGKIKFKFWENEMKILFDNDS-KTKINESPLMKELIQIV 351
            +C  +V K D+ENY+C L+LP+  ++AAFALR  N+E+S +++    +P+I K++ KFW + +   F+ DS ++ + + P+++EL   V
Sbjct:   55 HCMSLVEKYDYENYLCTLLLPRELRRAAFALRAFNVEVSRSVSGHQIEPQIAKMRLKFWHDSIDKCFEPDSQRSYVEDQPVLRELKHTV 143          
BLAST of GH12743 vs. Ensembl Fly
Match: sicily (gene:FBgn0030352 transcript:FBtr0346165)

HSP 1 Score: 95.5153 bits (236), Expect = 4.399e-37
Identity = 64/194 (32.99%), Postives = 105/194 (54.12%), Query Frame = 2
Query:  428 INRIFDARLKLMYEIP----FKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKR 997
            +N+++  RL    E P    F+S++E  EY +    SLL +L     + D++ DH  SHLG+ QG+  L+R I  LA  +Q   IP +V+  + +S   IIR      SDDK +++ ++ +ASAA+        ++ ++   P  VR++F   +    YLE+LR A+F L +KS    D LL   ++WK ++ R
Sbjct:  148 LNKVYLRRLVTARERPPTHAFESIRELEEYTEQTFSSLLLLLLEVGGVRDLNADHAASHLGKAQGIATLLRSIP-LAGRQQAPCIPLEVLVLHGVSQERIIR----SKSDDKGVEDCIFDVASAANTHLKLARQLHDKV---PPQVRKIFLSAVATDAYLERLRRANFLLTHKSCVGRDTLLPARLFWKSLLNR 333          

HSP 2 Score: 78.5666 bits (192), Expect = 4.399e-37
Identity = 33/89 (37.08%), Postives = 60/89 (67.42%), Query Frame = 1
Query:   91 YCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELS-NINNSVSKPEIGKIKFKFWENEMKILFDNDS-KTKINESPLMKELIQIV 351
            +C  +V K D+ENY+C L+LP+  ++AAFALR  N+E+S +++    +P+I K++ KFW + +   F+ DS ++ + + P+++EL   V
Sbjct:   55 HCMSLVEKYDYENYLCTLLLPRELRRAAFALRAFNVEVSRSVSGHQIEPQIAKMRLKFWHDSIDKCFEPDSQRSYVEDQPVLRELKHTV 143          
BLAST of GH12743 vs. Ensembl Zebrafish
Match: ndufaf6 (NADH:ubiquinone oxidoreductase complex assembly factor 6 [Source:ZFIN;Acc:ZDB-GENE-100112-1])

HSP 1 Score: 78.5666 bits (192), Expect = 2.587e-31
Identity = 58/195 (29.74%), Postives = 98/195 (50.26%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVY---WKVI 988
            L R W+ RI   R K M +  ++++++   Y +    SLLY+L   + + +V  DH  SH+G+ QG++  +R  T     R+KV +P D+   +  S  D IR      S D+ ++++VY IAS AH   +      S  +S P      F   +    YL+++R  DF++F+ SL + +  L   +Y   W+ I
Sbjct:  142 LTRRWMLRIVSEREKDMEDRAYRNLQDLEAYGENTQSSLLYLLLETLGVKNVHADHAASHIGKAQGILTCLRA-TPFNSSRRKVYLPMDICMLHGASQEDFIR-----GSRDQNVRDVVYDIASQAH---VHLQHARSFAESVPHSAMPAFLQTVVLEDYLQRVRKVDFDVFHPSLQKRNPTLPLQLYLRSWRKI 327          

HSP 2 Score: 76.6406 bits (187), Expect = 2.587e-31
Identity = 31/88 (35.23%), Postives = 59/88 (67.05%), Query Frame = 1
Query:   88 NYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQIV 351
             YC ++VRK D+E ++C+L+LP++ +++A ALR  N+EL+ I +SVS   IG ++ +FW++ ++ ++ +D   +    P+  EL + V
Sbjct:   54 QYCIDIVRKKDYEGFLCSLLLPEAARRSALALRAFNVELAQIKDSVSHKTIGLMRMQFWKSAVEDIYRDDPPAQ----PVSAELWRAV 137          
BLAST of GH12743 vs. Ensembl Xenopus
Match: cnpy2 (canopy FGF signaling regulator 2 [Source:Xenbase;Acc:XB-GENE-943173])

HSP 1 Score: 93.2041 bits (230), Expect = 4.220e-21
Identity = 60/193 (31.09%), Postives = 99/193 (51.30%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVY---WK 982
            L + W  R+ DAR + + +  +++++E   Y +    SLLY++   + I DV  DH  SH+G+ QG+I  +R +   +  RQ V +P D+   ++ S  D IR      S +K +K++++ IAS AH       S   R+   P      F   +    +L+ LR ADFN+F+ SL + + LL   +Y   WK
Sbjct:  121 LTKRWFMRMIDAREQNLDDRTYRNIQELETYAENTQSSLLYLILETLGIKDVQADHAASHIGKAQGIITCMRAVPYHSSRRQ-VFLPIDICMLHRASQEDFIR-----GSLEKNVKDVIFDIASQAHVHLEHARSFKKRV---PKSAFPAFNITVALDWHLKTLRKADFNIFHPSLQRKNTLLPLSLYVRSWK 304          

HSP 2 Score: 74.7146 bits (182), Expect = 1.369e-14
Identity = 28/69 (40.58%), Postives = 49/69 (71.01%), Query Frame = 1
Query:   82 SYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF 288
            S NYC  + RK D+E ++C L+LP+ +Q + FALR LN+ELS + +SVS+  +G ++ +FW + ++ ++
Sbjct:   31 SANYCAYLYRKRDYEGFLCTLLLPQESQNSVFALRALNVELSQVKDSVSQKSLGLMRMQFWRDAVQDIY 99          
BLAST of GH12743 vs. Ensembl Xenopus
Match: cnpy2 (canopy FGF signaling regulator 2 [Source:Xenbase;Acc:XB-GENE-943173])

HSP 1 Score: 92.8189 bits (229), Expect = 5.434e-21
Identity = 60/193 (31.09%), Postives = 99/193 (51.30%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVY---WK 982
            L + W  R+ DAR + + +  +++++E   Y +    SLLY++   + I DV  DH  SH+G+ QG+I  +R +   +  RQ V +P D+   ++ S  D IR      S +K +K++++ IAS AH       S   R+   P      F   +    +L+ LR ADFN+F+ SL + + LL   +Y   WK
Sbjct:  122 LTKRWFMRMIDAREQNLDDRTYRNIQELETYAENTQSSLLYLILETLGIKDVQADHAASHIGKAQGIITCMRAVPYHSSRRQ-VFLPIDICMLHRASQEDFIR-----GSLEKNVKDVIFDIASQAHVHLEHARSFKKRV---PKSAFPAFNITVALDWHLKTLRKADFNIFHPSLQRKNTLLPLSLYVRSWK 305          

HSP 2 Score: 65.855 bits (159), Expect = 1.525e-11
Identity = 23/59 (38.98%), Postives = 43/59 (72.88%), Query Frame = 1
Query:  112 KNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF 288
            K D+E ++C L+LP+ +Q + FALR LN+ELS + +SVS+  +G ++ +FW + ++ ++
Sbjct:   42 KRDYEGFLCTLLLPQESQNSVFALRALNVELSQVKDSVSQKSLGLMRMQFWRDAVQDIY 100          
BLAST of GH12743 vs. Ensembl Xenopus
Match: cnpy2 (canopy FGF signaling regulator 2 [Source:Xenbase;Acc:XB-GENE-943173])

HSP 1 Score: 75.8702 bits (185), Expect = 5.650e-15
Identity = 28/69 (40.58%), Postives = 50/69 (72.46%), Query Frame = 1
Query:   82 SYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF 288
            +  YC E+VRK D+E ++C L+LP+ +Q + FALR LN+ELS + +SVS+  +G ++ +FW + ++ ++
Sbjct:   25 AAGYCVELVRKRDYEGFLCTLLLPQESQNSVFALRALNVELSQVKDSVSQKSLGLMRMQFWRDAVQDIY 93          

HSP 2 Score: 66.6254 bits (161), Expect = 9.011e-12
Identity = 35/106 (33.02%), Postives = 60/106 (56.60%), Query Frame = 2
Query:  476 FKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAH 793
            +++++E   Y +    SLLY++   + I DV  DH  SH+G+ QG+I  +R +   +  RQ V +P D+   ++ S  D IR      S +K +K++++ IAS AH
Sbjct:  117 YRNIQELETYAENTQSSLLYLILETLGIKDVQADHAASHIGKAQGIITCMRAVPYHSSRRQ-VFLPIDICMLHRASQEDFIR-----GSLEKNVKDVIFDIASQAH 216          
BLAST of GH12743 vs. Ensembl Xenopus
Match: cnpy2 (canopy FGF signaling regulator 2 [Source:Xenbase;Acc:XB-GENE-943173])

HSP 1 Score: 76.2554 bits (186), Expect = 5.706e-15
Identity = 28/69 (40.58%), Postives = 50/69 (72.46%), Query Frame = 1
Query:   82 SYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF 288
            +  YC E+VRK D+E ++C L+LP+ +Q + FALR LN+ELS + +SVS+  +G ++ +FW + ++ ++
Sbjct:   25 AAGYCVELVRKRDYEGFLCTLLLPQESQNSVFALRALNVELSQVKDSVSQKSLGLMRMQFWRDAVQDIY 93          

HSP 2 Score: 75.8702 bits (185), Expect = 7.639e-15
Identity = 41/127 (32.28%), Postives = 71/127 (55.91%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAH 793
            L + W  R+ DAR + + +  +++++E   Y +    SLLY++   + I DV  DH  SH+G+ QG+I  +R +   +  RQ V +P D+   ++ S  D IR      S +K +K++++ IAS AH
Sbjct:  115 LTKRWFMRMIDAREQNLDDRTYRNIQELETYAENTQSSLLYLILETLGIKDVQADHAASHIGKAQGIITCMRAVPYHSSRRQ-VFLPIDICMLHRASQEDFIR-----GSLEKNVKDVIFDIASQAH 235          
BLAST of GH12743 vs. Ensembl Mouse
Match: Ndufaf6 (NADH:ubiquinone oxidoreductase complex assembly factor 6 [Source:MGI Symbol;Acc:MGI:1924197])

HSP 1 Score: 99.7525 bits (247), Expect = 3.153e-36
Identity = 63/195 (32.31%), Postives = 101/195 (51.79%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKR 997
            L + W+ RI D R K + +  ++SM+E   Y +   GSLLY+    + + D+  DH  SH+G+ QG++  +R     +  RQ V +P DV  Q+ +S  D +R      + DK ++++VY IAS AH   L      S  +S P      F   +    YL+K++  DF++F+ SL Q + LL   +Y +   KR
Sbjct:  147 LTKRWLMRIIDEREKNLDDKAYRSMQELENYAENTQGSLLYLTLEVLGVKDLHADHAASHIGKAQGIVTCLRATPYHSSRRQ-VFLPMDVCVQHGVSQEDFLR-----RNQDKNVRDVVYDIASQAH---LHLKHARSFHRSVPAEAFPAFLQTVSLEDYLKKIQRVDFDIFHPSLQQKNMLLPLSLYIQSWRKR 332          

HSP 2 Score: 71.633 bits (174), Expect = 3.153e-36
Identity = 29/78 (37.18%), Postives = 53/78 (67.95%), Query Frame = 1
Query:   82 SYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF-DNDSKTKI 312
            S+ YC E++RK D+E+Y+C+L+ P   Q++A ALR  N+EL+ + +SVS+  IG ++ +FW+  ++ ++ DN     +
Sbjct:   57 SHLYCLELLRKRDYESYLCSLLFPAECQRSASALRAFNVELAQVKDSVSEKTIGLMRMQFWKKAVEDMYCDNPPHQPV 134          
BLAST of GH12743 vs. UniProt/SwissProt
Match: sp|Q9VYS5|NDUF6_DROME (NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 homolog OS=Drosophila melanogaster OX=7227 GN=sicily PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.314e-36
Identity = 64/194 (32.99%), Postives = 105/194 (54.12%), Query Frame = 2
Query:  428 INRIFDARLKLMYEIP----FKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKR 997
            +N+++  RL    E P    F+S++E  EY +    SLL +L     + D++ DH  SHLG+ QG+  L+R I  LA  +Q   IP +V+  + +S   IIR      SDDK +++ ++ +ASAA+        ++ ++   P  VR++F   +    YLE+LR A+F L +KS    D LL   ++WK ++ R
Sbjct:  148 LNKVYLRRLVTARERPPTHAFESIRELEEYTEQTFSSLLLLLLEVGGVRDLNADHAASHLGKAQGIATLLRSIP-LAGRQQAPCIPLEVLVLHGVSQERIIR----SKSDDKGVEDCIFDVASAANTHLKLARQLHDKV---PPQVRKIFLSAVATDAYLERLRRANFLLTHKSCVGRDTLLPARLFWKSLLNR 333          

HSP 2 Score: 78.5666 bits (192), Expect = 3.314e-36
Identity = 33/89 (37.08%), Postives = 60/89 (67.42%), Query Frame = 1
Query:   91 YCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELS-NINNSVSKPEIGKIKFKFWENEMKILFDNDS-KTKINESPLMKELIQIV 351
            +C  +V K D+ENY+C L+LP+  ++AAFALR  N+E+S +++    +P+I K++ KFW + +   F+ DS ++ + + P+++EL   V
Sbjct:   55 HCMSLVEKYDYENYLCTLLLPRELRRAAFALRAFNVEVSRSVSGHQIEPQIAKMRLKFWHDSIDKCFEPDSQRSYVEDQPVLRELKHTV 143          
BLAST of GH12743 vs. UniProt/SwissProt
Match: sp|D3ZN43|NDUF6_RAT (NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Rattus norvegicus OX=10116 GN=Ndufaf6 PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 4.689e-36
Identity = 62/195 (31.79%), Postives = 102/195 (52.31%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKR 997
            L + W+ RI D R K + +  ++S++E   Y +    SLLY+    + + DV  DH  SH+G+ QG++  +R  T     R++V +P DV  Q+ +S  D +R      + DK ++++VY IAS AH       S +SR+   P      F   +    YL+K++  DF++F+ SL Q + LL   +Y +   KR
Sbjct:  147 LTKRWLLRIIDEREKNLDDKAYRSIRELETYAENTQSSLLYLTLEVLGVKDVHADHAASHIGKAQGIVTCLRA-TPYHSSRRQVFLPMDVCVQHGVSQEDFLR-----RNQDKNVRDVVYDIASQAHLHLKHARSFHSRV---PAEAFPAFLQTVSLEDYLKKIQRVDFDIFHPSLQQKNTLLPLSLYIQSWRKR 332          

HSP 2 Score: 72.7886 bits (177), Expect = 4.689e-36
Identity = 34/91 (37.36%), Postives = 57/91 (62.64%), Query Frame = 1
Query:   82 SYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF-DNDSKTKINESPLMKELIQIV 351
            S+ YC E++RK D+E+Y+C+L+ P   Q++A ALR  N+EL+ + +SVS+  IG ++ +FW   ++ +F DN         P+  EL + V
Sbjct:   57 SHLYCLELLRKRDYESYLCSLLFPAECQRSASALRAFNVELAQVKDSVSEKTIGLMRMQFWRKAVEDMFCDNPP-----HQPVAMELWKAV 142          
BLAST of GH12743 vs. UniProt/SwissProt
Match: sp|A2AIL4|NDUF6_MOUSE (NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Mus musculus OX=10090 GN=Ndufaf6 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.878e-35
Identity = 63/195 (32.31%), Postives = 101/195 (51.79%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKR 997
            L + W+ RI D R K + +  ++SM+E   Y +   GSLLY+    + + D+  DH  SH+G+ QG++  +R     +  RQ V +P DV  Q+ +S  D +R      + DK ++++VY IAS AH   L      S  +S P      F   +    YL+K++  DF++F+ SL Q + LL   +Y +   KR
Sbjct:  147 LTKRWLMRIIDEREKNLDDKAYRSMQELENYAENTQGSLLYLTLEVLGVKDLHADHAASHIGKAQGIVTCLRATPYHSSRRQ-VFLPMDVCVQHGVSQEDFLR-----RNQDKNVRDVVYDIASQAH---LHLKHARSFHRSVPAEAFPAFLQTVSLEDYLKKIQRVDFDIFHPSLQQKNMLLPLSLYIQSWRKR 332          

HSP 2 Score: 71.633 bits (174), Expect = 1.878e-35
Identity = 29/78 (37.18%), Postives = 53/78 (67.95%), Query Frame = 1
Query:   82 SYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF-DNDSKTKI 312
            S+ YC E++RK D+E+Y+C+L+ P   Q++A ALR  N+EL+ + +SVS+  IG ++ +FW+  ++ ++ DN     +
Sbjct:   57 SHLYCLELLRKRDYESYLCSLLFPAECQRSASALRAFNVELAQVKDSVSEKTIGLMRMQFWKKAVEDMYCDNPPHQPV 134          
BLAST of GH12743 vs. UniProt/SwissProt
Match: sp|A7YVD7|NDUF6_BOVIN (NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Bos taurus OX=9913 GN=NDUFAF6 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.934e-33
Identity = 56/195 (28.72%), Postives = 100/195 (51.28%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKR 997
            L + W+ +I D R K + +  +++++E   Y +    SLLY+    + I D+  DH  SH+G+ QG++  +R  T     R++V +P D+   + +S  D +R      S D+ ++++VY +AS AH       S +   +S P      F   +    YL+K++  DF+LF+ SL + + LL   +Y +   KR
Sbjct:  147 LTKRWLMKIIDEREKNLDDKAYRNIQELENYAENTQSSLLYLTLEILGIKDLHADHAASHIGKAQGIVTCLRA-TPYHGSRRRVFLPMDICMLHGVSQEDFLR-----KSQDRNVRDVVYDVASQAHLHLKHARSFH---RSIPVKAFPAFLQTVALEDYLKKIQQVDFDLFHPSLQRKNTLLPLSLYIQSWRKR 332          

HSP 2 Score: 75.0998 bits (183), Expect = 5.934e-33
Identity = 32/88 (36.36%), Postives = 56/88 (63.64%), Query Frame = 1
Query:   88 NYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQIV 351
             YC E++RK D+E Y+C+L+LP  ++ +AFALR  N+EL+ I +SVS+  IG ++ +FW+  +  ++ ++        P+  EL + V
Sbjct:   59 RYCLELLRKRDYEGYLCSLLLPAESRSSAFALRAFNVELAQIKDSVSEKTIGLMRMQFWKKTVDDIYSDNPP----HQPVAIELWKAV 142          
BLAST of GH12743 vs. UniProt/SwissProt
Match: sp|Q330K2|NDUF6_HUMAN (NADH dehydrogenase (ubiquinone) complex I, assembly factor 6 OS=Homo sapiens OX=9606 GN=NDUFAF6 PE=1 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 1.546e-32
Identity = 55/188 (29.26%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVY 976
            L + W+ +I D R K + +  ++++KE   Y +    SLLY+    + I D+  DH  SH+G+ QG++  +R  T     R+KV +P D+   + +S  D +R      + DK +++++Y IAS AH       S +   K+ P      F   +    +L+K++  DF++F+ SL Q + LL  ++Y
Sbjct:  147 LTKRWLMKIVDEREKNLDDKAYRNIKELENYAENTQSSLLYLTLEILGIKDLHADHAASHIGKAQGIVTCLRA-TPYHGSRRKVFLPMDICMLHGVSQEDFLR-----RNQDKNVRDVIYDIASQAHLHLKHARSFH---KTVPVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLY 325          

HSP 2 Score: 72.4034 bits (176), Expect = 1.546e-32
Identity = 28/76 (36.84%), Postives = 52/76 (68.42%), Query Frame = 1
Query:   88 NYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF-DNDSKTKI 312
            +YC E++RK D+E Y+C+L+LP  ++ + FALR  N+EL+ + +SVS+  IG ++ +FW+  ++ ++ DN     +
Sbjct:   59 HYCLELLRKRDYEGYLCSLLLPAESRSSVFALRAFNVELAQVKDSVSEKTIGLMRMQFWKKTVEDIYCDNPPHQPV 134          
BLAST of GH12743 vs. TrEMBL
Match: E9FYX2 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_306430 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 9.356e-43
Identity = 63/189 (33.33%), Postives = 111/189 (58.73%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYW 979
            L + W+ R+  +R   +    F+S+ +  +Y +    S+LY+    +NI  VD DH  SH+GR QGL+ L+R I   +  RQ+V +P D++ Q+++S +D +R      SDDK++K+L++ +AS A+    K  ++  ++   P+  +    P+I    YL++LR ADFN+F+  L Q +NLL + ++W
Sbjct:  126 LSKRWLQRLISSRENHLSSKAFQSLSKVEDYAEHSVSSVLYLTLESLNIRKVDSDHAASHIGRAQGLVTLLRAIPYNS-KRQQVYVPLDLLVQHKVSQNDFLR-----GSDDKKVKDLIFDVASTANAHIQKARTIIPKV---PSEAKIALMPLISVDSYLDQLRAADFNVFDPKLSQRNNLLPWKLWW 305          

HSP 2 Score: 81.2629 bits (199), Expect = 9.356e-43
Identity = 31/97 (31.96%), Postives = 65/97 (67.01%), Query Frame = 1
Query:   22 KNLLYINRYFTSFLTIRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKI 312
            +++ ++ R  +S +    N S+ YCQE+VRK+D+EN++ AL+LP++++Q+  A+R  N+ L+ + + VS+  IG+++ KFW   ++ ++ N    ++
Sbjct:   17 RSIFFVARKLSSKVQTSKN-SFLYCQELVRKHDYENFLAALLLPQASRQSTIAVRAFNVSLAQVQDQVSQGTIGQMRMKFWSETLEAVYQNTPPAQL 112          
BLAST of GH12743 vs. TrEMBL
Match: J9JYI3 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 GN=100164489 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 4.328e-42
Identity = 62/190 (32.63%), Postives = 109/190 (57.37%), Query Frame = 2
Query:  422 IWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIV 991
            I++ R+  +R   M     K++++   Y +     + Y+    M I D+ VDH +SHLG+CQG+I +IRGI        ++ IP D++ +Y++S+ +IIR     NS ++ +++ +Y +AS A+   +K  S+    K     ++ +  P +P   YLEKLR+ADFN+F+K L + +NLL   + W+ +V
Sbjct:  119 IYLKRLISSRENYMLNSSLKTIEDLETYAENSVSPVYYLFLEAMGIKDMKVDHAVSHLGKCQGIINIIRGIPY-NTKSGRISIPQDILLKYKVSYENIIR-----NSSEQNVRDAIYELASRANSHLMKAKSLE---KEGNKRIKSVCLPFVPLHLYLEKLRLADFNVFDKKLQERNNLLPMKLLWRKMV 299          

HSP 2 Score: 85.8853 bits (211), Expect = 4.328e-42
Identity = 38/91 (41.76%), Postives = 63/91 (69.23%), Query Frame = 1
Query:   67 IRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKEL 339
            +R N +  YC E+VRK+DFENY+C L+L KS ++  FA+R  NIE++ + + +S  +IG+++FKFWE+ +  ++ N    KI + P++ EL
Sbjct:   21 VRKNSTAKYCLELVRKHDFENYLCTLLLHKSIRRTGFAVRAFNIEVATLQDQISDMKIGEMRFKFWESSLTEIYKN----KIPKHPVLIEL 107          
BLAST of GH12743 vs. TrEMBL
Match: A0A2H8TPH4 (UPF0551 protein C8orf38, mitochondrial OS=Melanaphis sacchari OX=742174 GN=CH038_0 PE=4 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 6.422e-41
Identity = 61/190 (32.11%), Postives = 108/190 (56.84%), Query Frame = 2
Query:  422 IWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIV 991
            I++ R+  +R   M     K++++   Y +     + Y+    M I D+ VDH +SHLG+CQG++ +IRGI   +    ++ IP D++ +Y++S+ +IIR     NS ++++++ +Y +AS A+   +K   +    K     ++ +  P +P   YLEKLR ADFN+F+K L + +NLL   + W  IV
Sbjct:  119 IYLKRLISSRENYMLNSSLKTIEDLETYAENSVSPIYYLFLEAMEIKDMTVDHTVSHLGKCQGIVNIIRGIPYNS-KSGRISIPQDILLKYKVSYENIIR-----NSSEQKVRDAIYELASRANSHLMKAKKLE---KEGNKRIKSICLPFVPLHLYLEKLRKADFNVFDKQLQERNNLLPMKLLWHKIV 299          

HSP 2 Score: 85.1149 bits (209), Expect = 6.422e-41
Identity = 38/99 (38.38%), Postives = 65/99 (65.66%), Query Frame = 1
Query:   43 RYFTSFLTIRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKEL 339
            R+  +   +R N +  YC E+VRK+DFENY+C L+L K+ ++  FA+R  NIE++ + + +S  +IG+++FKFWE  +  ++ N    KI + P++ EL
Sbjct:   13 RFVQTISCVRKNSTAKYCLELVRKHDFENYLCTLLLHKNIRRTGFAVRAFNIEIATLQDQISDMKIGEMRFKFWETSLIEIYKN----KIPKHPVLIEL 107          
BLAST of GH12743 vs. TrEMBL
Match: A0A2S2PLH9 (UPF0551 protein OS=Schizaphis graminum OX=13262 GN=CH038 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.719e-40
Identity = 59/190 (31.05%), Postives = 107/190 (56.32%), Query Frame = 2
Query:  422 IWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIV 991
            I++ R+  +R   M     K++++   Y +     + Y+    M I D+ +DH +SHLG+CQG++ +IRGI   +    ++ IP D++ +Y++S+ +IIR     NS ++ +++ +Y +AS A+   +K   +    K     ++ ++ P +P   YLEKLR ADFN+F++ L   +NLL   + W  IV
Sbjct:  119 IYLKRLITSRENYMLNSSLKTIEDLETYAENSVSPVYYLFLEAMGIKDITIDHAVSHLGKCQGIVNIIRGIPYNS-KSGRISIPQDILLKYKVSYENIIR-----NSSEQNVRDAIYELASRANSHLMKARKLE---KEGNKRIKSIYLPFVPLHLYLEKLRKADFNVFDEKLQTRNNLLPMKLLWHKIV 299          

HSP 2 Score: 85.8853 bits (211), Expect = 1.719e-40
Identity = 41/106 (38.68%), Postives = 68/106 (64.15%), Query Frame = 1
Query:   34 YINRYFTSFLT----IRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKEL 339
            YI   F+ F+     +R N +  YC E+VRK+DFENY+C L+L K+ ++  FA+R  NIE++ + + +S  +IG+++FKFWE  +  ++ N    KI + P++ EL
Sbjct:    6 YIKGLFSRFVQTKCCVRKNSTAKYCLELVRKHDFENYLCTLLLHKNIRRTGFAIRAFNIEIATLQDQISDMKIGEMRFKFWETSLIEIYKN----KIPKHPVLIEL 107          
BLAST of GH12743 vs. TrEMBL
Match: A0A2S2PY58 (UPF0551 protein OS=Sipha flava OX=143950 GN=CH038 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.170e-40
Identity = 62/189 (32.80%), Postives = 106/189 (56.08%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYW 979
            L + ++ R+  +R + M     K++ +   Y +    S+ Y+    M I  V VDH +SHLG+CQG++ +IRGI        ++ IP D+M + ++S+ +IIR     NS+++ +++ +Y +AS A+   +K   +   +      V+ +F P IP   YLEKL+  DFNLF+K+L Q +NLL   + W
Sbjct:  119 LSKTYLKRLISSREQFMLNSTLKTIGDMDTYAENSVSSIYYLFLETMGIKSVSVDHAVSHLGKCQGIVNIIRGIPHNVKL-GRISIPQDIMLKNKVSYENIIR-----NSNERNVQDAIYEMASRANSHLIKANKLEKDVDKR---VKSIFLPFIPLRLYLEKLQKVDFNLFDKTLQQRNNLLPIKLLW 298          

HSP 2 Score: 83.5741 bits (205), Expect = 3.170e-40
Identity = 36/91 (39.56%), Postives = 62/91 (68.13%), Query Frame = 1
Query:   67 IRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKEL 339
            +R N +  YC ++VRK+D+ENY+C L+L K  ++  FA+R  NIE++ I + VS  +IG+++FKFWE  +  ++++    KI + P++ EL
Sbjct:   24 VRNNSTAKYCLDLVRKHDYENYLCTLLLHKDIRRTGFAIRAFNIEVATIQDQVSDLKIGEMRFKFWETSLAEIYND----KIPKHPVLIEL 110          
BLAST of GH12743 vs. Ensembl Cavefish
Match: ndufaf6 (NADH:ubiquinone oxidoreductase complex assembly factor 6 [Source:ZFIN;Acc:ZDB-GENE-100112-1])

HSP 1 Score: 81.2629 bits (199), Expect = 4.422e-30
Identity = 54/200 (27.00%), Postives = 97/200 (48.50%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIR-----YLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKR 997
            L R W+ RI   R K M +  +++++E   Y +    SLLY+    + + +V  DH  SH+G+  G++  +R  T     R++V +P D+   +  S  D IR      S ++ ++++VY IAS AH                      L   ++P ++     YL+++R  DF++F++SL + + LL   +Y +   KR
Sbjct:  145 LTRRWLLRIIAEREKDMEDRAYRNLQELESYAENTQSSLLYLQLETLGVKNVHADHAASHIGKAHGIVTCLRA-TPYHSQRRRVYLPMDICMLHGASQEDFIR-----GSREQNVRDVVYDIASQAHVHLQHKF---------------LTVAIVPVLQVSIEDYLQRVRKVDFDVFHQSLQKRNPLLPIRLYLQSWKKR 323          

HSP 2 Score: 69.3218 bits (168), Expect = 4.422e-30
Identity = 27/88 (30.68%), Postives = 58/88 (65.91%), Query Frame = 1
Query:   88 NYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQIV 351
             YC ++VR  D+E ++C+L+LP++ ++++ AL+  N+EL+ + +SVS+  IG ++ +FW+  ++ ++ +D   +    P+  EL + V
Sbjct:   57 EYCLKLVRSRDYEGFVCSLLLPEAARRSSLALKAFNVELAQVKDSVSQKTIGLMRMQFWKTVVEDIYRDDPPVQ----PVSVELWRAV 140          
BLAST of GH12743 vs. Ensembl Nematostella
Match: EDO35447 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG0])

HSP 1 Score: 85.8853 bits (211), Expect = 3.080e-19
Identity = 53/187 (28.34%), Postives = 98/187 (52.41%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKL----MYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLL 961
            L ++W  R+ +AR++     + E  + ++K    Y +    S LY+    + + DV+ DH  SH+G+  G++ L+R  T     R KV++PND++ ++ +SH DIIR      S  + +K+  + +AS A+       ++ S++   P    R   P +    YL  ++ ADF+LF+ +L + + LL
Sbjct:   99 LSKMWFTRMIEARVRGQESNLNERAYPNIKSLETYAENSAPSGLYLTLESLGVKDVNADHAASHVGKAFGIVTLLRA-TPYHGNRGKVLLPNDILIKHGVSHQDIIR-----GSTSQPVKDAGFELASLANTHLNMARALKSKL---PKAALRALLPAVSCQEYLNHIQRADFDLFHPTLRERNQLL 276          

HSP 2 Score: 72.0182 bits (175), Expect = 2.434e-14
Identity = 24/67 (35.82%), Postives = 52/67 (77.61%), Query Frame = 1
Query:   88 NYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILF 288
             YC  +VR+ D+EN++C+L++PKS++ + F++R  N EL+ + +SVS+ +IG+++ +FW++ ++ ++
Sbjct:   13 QYCVNLVRRIDYENFLCSLLIPKSSRNSVFSIRAFNAELAQVRDSVSERDIGRMRMQFWKDTLQSIY 79          
BLAST of GH12743 vs. Ensembl Medaka
Match: ndufaf6 (NADH:ubiquinone oxidoreductase complex assembly factor 6 [Source:NCBI gene;Acc:101160194])

HSP 1 Score: 90.5077 bits (223), Expect = 1.532e-32
Identity = 58/195 (29.74%), Postives = 100/195 (51.28%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVY---WKVI 988
            L + W+ RI   R K + +  +++++E   Y +  + SL+Y+L   + + DV  DH  SH+G+ QG++  +R I   +  R+KV +P D+   +  S  D IR      S ++ ++++VY IAS AH       S    +   P      F   +    YL+++R ADF++F+KSL   + LL   +Y   W+ I
Sbjct:  145 LTKRWLLRIVTEREKDLDDRAYRTLQELETYAEKTHSSLIYLLLECLGVRDVHADHAASHIGKAQGIVTCLRAIPYHS-SRRKVYLPMDICMLHGASQEDFIR-----GSREQNVRDVVYDIASQAHAHLQHARSFSHNV---PAAAFPAFLHTVGLEDYLQRVRKADFDVFHKSLQNRNPLLPIQLYIRSWRNI 330          

HSP 2 Score: 68.5514 bits (166), Expect = 1.532e-32
Identity = 28/96 (29.17%), Postives = 58/96 (60.42%), Query Frame = 1
Query:   64 TIRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQIV 351
            T+ ++ S  YC ++VR  D+E ++C+L+LPK   ++   L+  N+EL+ + +SVS+  IG ++ +FW+  +  ++ ++   +    P+  EL + V
Sbjct:   49 TVGSDHSEKYCVDLVRSRDYEGFLCSLLLPKEVWRSCLTLKAFNVELAQVKDSVSQKTIGLMRMQFWKTALDDIYRDEPPNQ----PVGTELWKAV 140          
BLAST of GH12743 vs. Planmine SMEST
Match: SMESG000029312.1 (SMESG000029312.1)

HSP 1 Score: 404.831 bits (1039), Expect = 0.000e+0
Identity = 197/197 (100.00%), Postives = 197/197 (100.00%), Query Frame = 2
Query:  416 YRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKRNLQ 1006
            YRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKRNLQ
Sbjct:  121 YRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKRNLQ 317          

HSP 2 Score: 253.062 bits (645), Expect = 0.000e+0
Identity = 122/124 (98.39%), Postives = 124/124 (100.00%), Query Frame = 1
Query:    4 MNFGATKNLLYINRYFTSFLTIRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQIVLIFPYRLF 375
            MNFGATKNLLYINRYFTSFLTIRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQIVLIFPYR++
Sbjct:    1 MNFGATKNLLYINRYFTSFLTIRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQIVLIFPYRIW 124          
BLAST of GH12743 vs. Planmine SMEST
Match: SMESG000029312.1 (SMESG000029312.1)

HSP 1 Score: 407.142 bits (1045), Expect = 3.580e-178
Identity = 198/198 (100.00%), Postives = 198/198 (100.00%), Query Frame = 2
Query:  413 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKRNLQ 1006
            LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKRNLQ
Sbjct:  122 LYRIWINRIFDARLKLMYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQGLIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLKELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRIADFNLFNKSLYQTDNLLAFHVYWKVIVKRNLQ 319          

HSP 2 Score: 237.654 bits (605), Expect = 3.580e-178
Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 1
Query:    4 MNFGATKNLLYINRYFTSFLTIRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQI 348
            MNFGATKNLLYINRYFTSFLTIRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQI
Sbjct:    1 MNFGATKNLLYINRYFTSFLTIRTNLSYNYCQEVVRKNDFENYICALILPKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDSKTKINESPLMKELIQI 115          
The following BLAST results are available for this feature:
BLAST of GH12743 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NDUFAF63.577e-3329.26NADH:ubiquinone oxidoreductase complex assembly fa... [more]
NDUFAF63.729e-2029.26NADH:ubiquinone oxidoreductase complex assembly fa... [more]
NDUFAF63.729e-2029.26NADH:ubiquinone oxidoreductase complex assembly fa... [more]
NDUFAF61.060e-1436.84NADH:ubiquinone oxidoreductase complex assembly fa... [more]
NDUFAF67.102e-947.50NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of GH12743 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GH12743 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sicily4.399e-3732.99gene:FBgn0030352 transcript:FBtr0073572[more]
sicily4.399e-3732.99gene:FBgn0030352 transcript:FBtr0346165[more]
back to top
BLAST of GH12743 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufaf62.587e-3129.74NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of GH12743 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cnpy24.220e-2131.09canopy FGF signaling regulator 2 [Source:Xenbase;A... [more]
cnpy25.434e-2131.09canopy FGF signaling regulator 2 [Source:Xenbase;A... [more]
cnpy25.650e-1540.58canopy FGF signaling regulator 2 [Source:Xenbase;A... [more]
cnpy25.706e-1540.58canopy FGF signaling regulator 2 [Source:Xenbase;A... [more]
back to top
BLAST of GH12743 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ndufaf63.153e-3632.31NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of GH12743 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VYS5|NDUF6_DROME3.314e-3632.99NADH dehydrogenase (ubiquinone) complex I, assembl... [more]
sp|D3ZN43|NDUF6_RAT4.689e-3631.79NADH dehydrogenase (ubiquinone) complex I, assembl... [more]
sp|A2AIL4|NDUF6_MOUSE1.878e-3532.31NADH dehydrogenase (ubiquinone) complex I, assembl... [more]
sp|A7YVD7|NDUF6_BOVIN5.934e-3328.72NADH dehydrogenase (ubiquinone) complex I, assembl... [more]
sp|Q330K2|NDUF6_HUMAN1.546e-3229.26NADH dehydrogenase (ubiquinone) complex I, assembl... [more]
back to top
BLAST of GH12743 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9FYX29.356e-4333.33Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
J9JYI34.328e-4232.63Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A2H8TPH46.422e-4132.11UPF0551 protein C8orf38, mitochondrial OS=Melanaph... [more]
A0A2S2PLH91.719e-4031.05UPF0551 protein OS=Schizaphis graminum OX=13262 GN... [more]
A0A2S2PY583.170e-4032.80UPF0551 protein OS=Sipha flava OX=143950 GN=CH038 ... [more]
back to top
BLAST of GH12743 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufaf64.422e-3027.00NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of GH12743 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GH12743 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GH12743 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO354473.080e-1928.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GH12743 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufaf61.532e-3229.74NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of GH12743 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000029312.10.000e+0100.00SMESG000029312.1[more]
SMESG000029312.13.580e-178100.00SMESG000029312.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000294 ID=SMED30000294|Name=GH12743|organism=Schmidtea mediterranea sexual|type=transcript|length=1026bp
TTTATGAATTTTGGGGCTACAAAAAATTTGCTTTATATTAATAGATATTT
TACATCTTTTCTGACCATCAGAACTAATTTATCATATAATTATTGTCAAG
AAGTAGTCAGGAAAAATGATTTTGAGAATTATATCTGTGCTCTAATTTTA
CCTAAAAGTACACAACAAGCTGCATTTGCATTAAGATGCTTAAATATTGA
ACTATCAAACATTAATAATTCAGTATCTAAACCAGAAATTGGTAAAATAA
AGTTTAAATTTTGGGAAAACGAAATGAAAATATTATTTGATAATGATAGT
AAAACTAAAATAAATGAATCACCACTGATGAAAGAATTAATTCAAATAGT
GCTTATTTTTCCTTATAGGTTATTTCAATGTTTTTAATCAACAGAATTTT
TCAAATTCAAACTTATACAGAATTTGGATTAATCGTATTTTTGATGCCCG
ATTAAAATTAATGTATGAAATTCCTTTTAAATCTATGAAAGAAGCATATG
AGTATTTTGATGCAATTAATGGATCGTTGCTATATATATTAGCTAATCAT
ATGAATATTGCCGATGTTGATGTTGATCACGGTTTGAGTCATTTAGGAAG
GTGCCAAGGACTAATTATATTAATCAGGGGAATTACTATGCTTGCGTATT
ATCGACAAAAGGTCATTATTCCGAATGACGTAATGACACAGTATCAATTG
AGCCATTCTGACATAATTCGAATAGTGTCAGCTAAAAATTCTGATGATAA
GCGTTTAAAAGAACTTGTATATCATATTGCAAGTGCTGCTCACGAGGAGG
CGCTTAAAACGCTGTCGGTTTATTCTAGAATAAAATCTAATCCAACATTA
GTCCGTCGATTGTTTGCGCCAGTGATTCCAGCGATTAGATATTTGGAAAA
GTTGAGAATAGCGGATTTCAACTTATTTAATAAAAGTCTTTATCAGACTG
ACAATTTGCTAGCGTTTCATGTATATTGGAAAGTGATAGTTAAACGTAAT
TTGCAATAATGGATTTTAAATTATTT
back to top

protein sequence of SMED30000294-orf-1

>SMED30000294-orf-1 ID=SMED30000294-orf-1|Name=SMED30000294-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=183bp
MYEIPFKSMKEAYEYFDAINGSLLYILANHMNIADVDVDHGLSHLGRCQG
LIILIRGITMLAYYRQKVIIPNDVMTQYQLSHSDIIRIVSAKNSDDKRLK
ELVYHIASAAHEEALKTLSVYSRIKSNPTLVRRLFAPVIPAIRYLEKLRI
ADFNLFNKSLYQTDNLLAFHVYWKVIVKRNLQ*
back to top

protein sequence of SMED30000294-orf-2

>SMED30000294-orf-2 ID=SMED30000294-orf-2|Name=SMED30000294-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=129bp
FMNFGATKNLLYINRYFTSFLTIRTNLSYNYCQEVVRKNDFENYICALIL
PKSTQQAAFALRCLNIELSNINNSVSKPEIGKIKFKFWENEMKILFDNDS
KTKINESPLMKELIQIVLIFPYRLFQCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0050821protein stabilization
GO:0009058biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002060Squ/phyt_synthse
IPR008949Isoprenoid_synthase_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF00494SQS_PSYcoord: 5..157
e-value: 9.9E-12
score: 44.9
NoneNo IPR availablePANTHERPTHR21181FAMILY NOT NAMEDcoord: 3..176
NoneNo IPR availablePANTHERPTHR21181:SF13NADH DEHYDROGENASE (UBIQUINONE) COMPLEX I, ASSEMBLY FACTOR 6coord: 3..176
IPR008949Isoprenoid synthase domain superfamilySUPERFAMILYSSF48576Terpenoid synthasescoord: 2..178