SMED30000293

Overview
NameSMED30000293
Smed IDSMED30000293
Length (bp)1292
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30000293 (SMED30000293) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30000293 (SMED30000293) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30000293 (SMED30000293) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30000293 (SMED30000293) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000293

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000293SMESG000049936.1 Contig319newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000293SMESG000049936.1 Contig319uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000293SMESG000030582.1 Contig319newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000293SMESG000030582.1 Contig319uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30000293SMESG000049936.1 SmedASXL_017821SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30000293SMESG000049936.1 Contig55newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000293SMESG000049936.1 Contig55uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000293SMESG000049936.1 Contig56newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000293SMESG000049936.1 Contig56uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000293SMESG000025013.1 SMESG000025003.1 Contig56newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000293SMESG000025013.1 SMESG000025003.1 Contig56uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000293SMESG000013676.1 Contig55newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000293SMESG000013676.1 Contig55uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30000293SMESG000049936.1 OX_Smed_1.0.15224ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000293 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000358:101666..107334 -6289
Homology
BLAST of SMED30000293 vs. TrEMBL
Match: A0A2T8I2A3 (HTH myb-type domain-containing protein OS=Panicum hallii OX=206008 GN=PAHAL_9G235500 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 3.378e-6
Identity = 32/71 (45.07%), Postives = 48/71 (67.61%), Query Frame = -1
Query:  114 DTITTYSTSQGKDKKSIGK---NRWSSRETFCLYKGVQE-GL-QWQEIKNKYFKRSKRTNVNLKDRWRNVL 311
            DT     T+ G+++K I +   +RW+ +E   L +GV + G+ +W E+K KYFK S RT+VNLKD+WRN+L
Sbjct:   64 DTFIFGGTTLGRNRKYITRKNNSRWTGKEVKLLVQGVSKFGVGRWSEMKKKYFKTSVRTSVNLKDKWRNLL 134          
BLAST of SMED30000293 vs. TrEMBL
Match: A0A2S3ILU9 (HTH myb-type domain-containing protein OS=Panicum hallii OX=206008 GN=PAHAL_9G235500 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 4.388e-6
Identity = 32/71 (45.07%), Postives = 48/71 (67.61%), Query Frame = -1
Query:  114 DTITTYSTSQGKDKKSIGK---NRWSSRETFCLYKGVQE-GL-QWQEIKNKYFKRSKRTNVNLKDRWRNVL 311
            DT     T+ G+++K I +   +RW+ +E   L +GV + G+ +W E+K KYFK S RT+VNLKD+WRN+L
Sbjct:  114 DTFIFGGTTLGRNRKYITRKNNSRWTGKEVKLLVQGVSKFGVGRWSEMKKKYFKTSVRTSVNLKDKWRNLL 184          
BLAST of SMED30000293 vs. TrEMBL
Match: A0A2T8I2D9 (HTH myb-type domain-containing protein OS=Panicum hallii OX=206008 GN=PAHAL_9G235500 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 4.524e-6
Identity = 32/71 (45.07%), Postives = 48/71 (67.61%), Query Frame = -1
Query:  114 DTITTYSTSQGKDKKSIGK---NRWSSRETFCLYKGVQE-GL-QWQEIKNKYFKRSKRTNVNLKDRWRNVL 311
            DT     T+ G+++K I +   +RW+ +E   L +GV + G+ +W E+K KYFK S RT+VNLKD+WRN+L
Sbjct:   64 DTFIFGGTTLGRNRKYITRKNNSRWTGKEVKLLVQGVSKFGVGRWSEMKKKYFKTSVRTSVNLKDKWRNLL 134          
BLAST of SMED30000293 vs. TrEMBL
Match: A0A2S3ILT8 (HTH myb-type domain-containing protein OS=Panicum hallii OX=206008 GN=PAHAL_9G235500 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 5.709e-6
Identity = 32/71 (45.07%), Postives = 48/71 (67.61%), Query Frame = -1
Query:  114 DTITTYSTSQGKDKKSIGK---NRWSSRETFCLYKGVQE-GL-QWQEIKNKYFKRSKRTNVNLKDRWRNVL 311
            DT     T+ G+++K I +   +RW+ +E   L +GV + G+ +W E+K KYFK S RT+VNLKD+WRN+L
Sbjct:  114 DTFIFGGTTLGRNRKYITRKNNSRWTGKEVKLLVQGVSKFGVGRWSEMKKKYFKTSVRTSVNLKDKWRNLL 184          
BLAST of SMED30000293 vs. Planmine SMEST
Match: SMESG000049936.1 (SMESG000049936.1)

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 315/315 (100.00%), Postives = 315/315 (100.00%), Query Frame = -1
Query:   57 MNDISFIENQLKCLKKFSQKNENMNCIVKAFENNVVNMKKTVDNDEENSLEEFKDAIKMFQDLFYLFAPSILKQILCALALMEGRDEMEMYRKLQLMLANQVRCKNDLTKYCQLLQNNPEINFQDFLNNIDSRIFSANQGKEIKETFSKYENLASLLALKEAVCKKCSERRDDIDLDSDEHTLPSSRSTDIDQFPVTSTPILSNPIRXXXXXXXXXXXXXSIGKGGAHNDDTITTYSTSQGKDKKSIGKNRWSSRETFCLYKGVQEGLQWQEIKNKYFKRSKRTNVNLKDRWRNVLLNLDLMNELKSMLQKESAG 1001
            MNDISFIENQLKCLKKFSQKNENMNCIVKAFENNVVNMKKTVDNDEENSLEEFKDAIKMFQDLFYLFAPSILKQILCALALMEGRDEMEMYRKLQLMLANQVRCKNDLTKYCQLLQNNPEINFQDFLNNIDSRIFSANQGKEIKETFSKYENLASLLALKEAVCKKCSERRDDIDLDSDEHTLPSSRSTDIDQFPVTSTPILSNPIRVSSNSNVSDSVGNSIGKGGAHNDDTITTYSTSQGKDKKSIGKNRWSSRETFCLYKGVQEGLQWQEIKNKYFKRSKRTNVNLKDRWRNVLLNLDLMNELKSMLQKESAG
Sbjct:    1 MNDISFIENQLKCLKKFSQKNENMNCIVKAFENNVVNMKKTVDNDEENSLEEFKDAIKMFQDLFYLFAPSILKQILCALALMEGRDEMEMYRKLQLMLANQVRCKNDLTKYCQLLQNNPEINFQDFLNNIDSRIFSANQGKEIKETFSKYENLASLLALKEAVCKKCSERRDDIDLDSDEHTLPSSRSTDIDQFPVTSTPILSNPIRVSSNSNVSDSVGNSIGKGGAHNDDTITTYSTSQGKDKKSIGKNRWSSRETFCLYKGVQEGLQWQEIKNKYFKRSKRTNVNLKDRWRNVLLNLDLMNELKSMLQKESAG 315          
BLAST of SMED30000293 vs. Planmine SMEST
Match: SMESG000049936.1 (SMESG000049936.1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 292/292 (100.00%), Postives = 292/292 (100.00%), Query Frame = -1
Query:   57 MNCIVKAFENNVVNMKKTVDNDEENSLEEFKDAIKMFQDLFYLFAPSILKQILCALALMEGRDEMEMYRKLQLMLANQVRCKNDLTKYCQLLQNNPEINFQDFLNNIDSRIFSANQGKEIKETFSKYENLASLLALKEAVCKKCSERRDDIDLDSDEHTLPSSRSTDIDQFPVTSTPILSNPIRXXXXXXXXXXXXXSIGKGGAHNDDTITTYSTSQGKDKKSIGKNRWSSRETFCLYKGVQEGLQWQEIKNKYFKRSKRTNVNLKDRWRNVLLNLDLMNELKSMLQKESAG 932
            MNCIVKAFENNVVNMKKTVDNDEENSLEEFKDAIKMFQDLFYLFAPSILKQILCALALMEGRDEMEMYRKLQLMLANQVRCKNDLTKYCQLLQNNPEINFQDFLNNIDSRIFSANQGKEIKETFSKYENLASLLALKEAVCKKCSERRDDIDLDSDEHTLPSSRSTDIDQFPVTSTPILSNPIRVSSNSNVSDSVGNSIGKGGAHNDDTITTYSTSQGKDKKSIGKNRWSSRETFCLYKGVQEGLQWQEIKNKYFKRSKRTNVNLKDRWRNVLLNLDLMNELKSMLQKESAG
Sbjct:    1 MNCIVKAFENNVVNMKKTVDNDEENSLEEFKDAIKMFQDLFYLFAPSILKQILCALALMEGRDEMEMYRKLQLMLANQVRCKNDLTKYCQLLQNNPEINFQDFLNNIDSRIFSANQGKEIKETFSKYENLASLLALKEAVCKKCSERRDDIDLDSDEHTLPSSRSTDIDQFPVTSTPILSNPIRVSSNSNVSDSVGNSIGKGGAHNDDTITTYSTSQGKDKKSIGKNRWSSRETFCLYKGVQEGLQWQEIKNKYFKRSKRTNVNLKDRWRNVLLNLDLMNELKSMLQKESAG 292          
BLAST of SMED30000293 vs. Planmine SMEST
Match: SMESG000020857.1 (SMESG000020857.1)

HSP 1 Score: 77.0258 bits (188), Expect = 5.103e-15
Identity = 33/65 (50.77%), Postives = 49/65 (75.38%), Query Frame = -1
Query:   63 KNRWSSRETFCLYKGVQEGLQWQEIKNKYFKRSKRTNVNLKDRWRNVLLNLDLMNELKSMLQKES 257
            + +W+  E+  +YKGVQEGL W +IK+ YF+ S RTNV++KDRWR +L   +LMNEL+ +L+ E+
Sbjct:  349 RTQWNLNESLLIYKGVQEGLTWSDIKSTYFRNSFRTNVHIKDRWRVILKKPELMNELQVLLESEN 413          
The following BLAST results are available for this feature:
BLAST of SMED30000293 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A2T8I2A33.378e-645.07HTH myb-type domain-containing protein OS=Panicum ... [more]
A0A2S3ILU94.388e-645.07HTH myb-type domain-containing protein OS=Panicum ... [more]
A0A2T8I2D94.524e-645.07HTH myb-type domain-containing protein OS=Panicum ... [more]
A0A2S3ILT85.709e-645.07HTH myb-type domain-containing protein OS=Panicum ... [more]
back to top
BLAST of SMED30000293 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30000293 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000049936.10.000e+0100.00SMESG000049936.1[more]
SMESG000049936.10.000e+0100.00SMESG000049936.1[more]
SMESG000020857.15.103e-1550.77SMESG000020857.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000293 ID=SMED30000293|Name=SMED30000293|organism=Schmidtea mediterranea sexual|type=transcript|length=1292bp
AAAATCCTTATCAATTTATTAAAAGCAATATAAAAACAAAATCCGAAGTC
ATATCAGCCAGCTGACTCTTTTTGAAGCATCGATTTCAACTCATTCATCA
AATCCAAATTCAACAGAACATTCCGCCATCTGTCTTTTAAATTGACATTA
GTTCTTTTTGATCTTTTAAAATATTTGTTTTTAATTTCTTGCCACTGGAG
ACCTTCTTGAACACCTTTATATAGACAAAATGTTTCGCGCGAAGACCATC
GATTTTTTCCGATCGATTTTTTATCCTTTCCTTGACTGGTTGAATAAGTG
GTTATTGTATCGTCATTATGCGCACCCCCTTTCCCAATACTGTTACCGAC
ACTATCGCTAACATTGCTATTGGACGATACTCTAATCGGATTGGATAAAA
TCGGCGTTGACGTCACAGGAAACTGATCGATGTCAGTCGAGCGGGAACTG
GGAAGCGTATGTTCATCTGAATCCAAATCGATATCATCCCTCCTTTCTGA
GCATTTCTTGCAAACTGCCTCTTTCAAAGCAAGAAGTGAAGCAAGATTTT
CATATTTAGAAAAAGTTTCTTTAATTTCTTTTCCTTGATTCGCCGAGAAA
ATCCTGGAATCGATATTGTTTAAAAAATCCTGGAAATTAATTTCAGGATT
ATTTTGTAACAGTTGGCAATATTTAGTGAGATCATTTTTACAACGGACTT
GATTAGCCAGCATCAACTGCAATTTCCGATACATTTCCATTTCATCCCTT
CCTTCCATCAACGCCAAGGCGCACAGAATCTGTTTGAGTATTGATGGGGC
AAATAAATAAAACAGATCTTGAAACATTTTAATTGCATCTTTAAATTCTT
CTAATGAATTTTCTTCATCATTATCAACGGTTTTTTTCATATTAACAACA
TTATTTTCAAAAGCTTTTACAATACAATTCATATTTTCATTTTTTTGTGA
AAATTTTTTAAGACACTTCAATTGGTTCTCAATAAATGAAATATCATTCA
TAATTGATTGTTTAATGAATCGCAAATTGTGGCGACAATAACCAGAATTT
TTATATTTTAGGCTTAAATATATCCAATTTGATTTTAGAATGATAACTAA
AAATCTATATTTTTCAAAATCAATGCTGCTGATACAATTGATCGAAGTAA
AATGAACTAGATCACTTATTCTAGAAATCTCATTTACATTAAAATTCGAT
TTTTGATACAAGTAAAATAAGGAGTCAATGATAGACATTTGATTTTTTAA
TAAAAAAAGAATATTTAAACAAATAGTTCAACCTAAATTATA
back to top

protein sequence of SMED30000293-orf-1

>SMED30000293-orf-1 ID=SMED30000293-orf-1|Name=SMED30000293-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=395bp
MSIIDSLFYLYQKSNFNVNEISRISDLVHFTSINCISSIDFEKYRFLVII
LKSNWIYLSLKYKNSGYCRHNLRFIKQSIMNDISFIENQLKCLKKFSQKN
ENMNCIVKAFENNVVNMKKTVDNDEENSLEEFKDAIKMFQDLFYLFAPSI
LKQILCALALMEGRDEMEMYRKLQLMLANQVRCKNDLTKYCQLLQNNPEI
NFQDFLNNIDSRIFSANQGKEIKETFSKYENLASLLALKEAVCKKCSERR
DDIDLDSDEHTLPSSRSTDIDQFPVTSTPILSNPIRVSSNSNVSDSVGNS
IGKGGAHNDDTITTYSTSQGKDKKSIGKNRWSSRETFCLYKGVQEGLQWQ
EIKNKYFKRSKRTNVNLKDRWRNVLLNLDLMNELKSMLQKESAG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR009057Homeobox-like_sf
IPR017877Myb-like_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 93..127
NoneNo IPR availableGENE3DG3DSA:1.10.246.220coord: 317..392
e-value: 7.2E-9
score: 37.4
NoneNo IPR availableCDDcd11660SANT_TRFcoord: 330..375
e-value: 2.10798E-11
score: 56.4215
IPR017877Myb-like domainPROSITEPS50090MYB_LIKEcoord: 323..375
score: 7.747
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 326..377