Electron transfer flavoprotein subunit beta

Overview
NameElectron transfer flavoprotein subunit beta
Smed IDSMED30000284
Length (bp)924
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Electron transfer flavoprotein subunit beta (SMED30000284) t-SNE clustered cells

Violin plots show distribution of expression levels for Electron transfer flavoprotein subunit beta (SMED30000284) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Electron transfer flavoprotein subunit beta (SMED30000284) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Electron transfer flavoprotein subunit beta (SMED30000284) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000284

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000284SMESG000025689.1 dd_Smed_v4_1315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000284SMESG000025689.1 dd_Smed_v4_1315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000284SMESG000025689.1 dd_Smed_v4_1315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000284SMESG000025689.1 dd_Smed_v4_1315_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000284SMESG000080622.1 SMESG000068757.1 SMESG000038294.1 SMESG000032747.1 SMESG000025690.1 SMESG000025689.1 SMESG000023322.1 Contig18510newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000284SMESG000080622.1 SMESG000068757.1 SMESG000038294.1 SMESG000032747.1 SMESG000025690.1 SMESG000025689.1 SMESG000023322.1 Contig18510uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Human
Match: ETFB (electron transfer flavoprotein subunit beta [Source:HGNC Symbol;Acc:HGNC:3482])

HSP 1 Score: 349.747 bits (896), Expect = 2.125e-121
Identity = 166/255 (65.10%), Postives = 205/255 (80.39%), Query Frame = 1
Query:   67 IMSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            +  LRVLV +KRVIDYAVK+RVKPD+TGVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVE+  A  E L P  ++++L+K+ +KEK D+ + GKQAIDDDCNQT QMTAG L+W Q TFAS++ ++  KL+V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E I   DLGVDL+ +  V+ V DPP R+AG+KVE+ E+LV KLKE G I
Sbjct:    1 MAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI 255          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Human
Match: ETFB (electron transfer flavoprotein subunit beta [Source:HGNC Symbol;Acc:HGNC:3482])

HSP 1 Score: 323.168 bits (827), Expect = 1.506e-109
Identity = 153/239 (64.02%), Postives = 191/239 (79.92%), Query Frame = 1
Query:  115 AVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            A ++RVKPD+TGVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVE+  A  E L P  ++++L+K+ +KEK D+ + GKQAIDDDCNQT QMTAG L+W Q TFAS++ ++  KL+V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E I   DLGVDL+ +  V+ V DPP R+AG+KVE+ E+LV KLKE G I
Sbjct:  108 AGQIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI 346          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Human
Match: ETFB (electron transfer flavoprotein subunit beta [Source:HGNC Symbol;Acc:HGNC:3482])

HSP 1 Score: 237.269 bits (604), Expect = 3.358e-78
Identity = 123/228 (53.95%), Postives = 146/228 (64.04%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPP 759
            LRVLV +KRVIDYAVK+RVKPD+TGVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +C                                                     QAIDDDCNQT QMTAG L+W Q TFAS++ ++  KL+V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E I   DLGVDL+ +  V+ V DPP
Sbjct:    4 LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQC-----------------------------------------------------QAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP 178          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Celegans
Match: F23C8.5 (pep chromosome:WBcel235:I:2418450:2420801:-1 gene:WBGene00017734.1 transcript:F23C8.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F23C8.5)

HSP 1 Score: 315.079 bits (806), Expect = 4.273e-108
Identity = 148/253 (58.50%), Postives = 197/253 (77.87%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIE-MKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            +++LVG+KRV+DYAVK+RVKPD++GVVT+G++HSMNPFDEI +EEAV++KEK +A+E +A S G  K  E LRTALA G D+A+HV++  A    L+ FH++K L K++++EK D    GKQAIDDD +QTA + AGLLEW QA +ASK+E      ++VTRE+DGGL+ ++V +P VLS DLRLNEPRYATLPNIMKAKKKPL+ IP+KDL VD++ + + L+V +PP R AG  V+ V  LV KLKEKG +
Sbjct:    1 MKILVGVKRVVDYAVKIRVKPDRSGVVTEGVQHSMNPFDEIALEEAVKLKEKKLATEVVAFSLGGPKSAEVLRTALAKGADKAVHVQVTDAEAGKLESFHVAKALQKIVEQEKFDAVFLGKQAIDDDSSQTAPILAGLLEWPQALYASKVEDAGAGHMKVTREIDGGLDTIKVKVPFVLSADLRLNEPRYATLPNIMKAKKKPLKNIPIKDLNVDITPQTETLEVTEPPVRQAGGFVDDVSALVAKLKEKGFV 253          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Celegans
Match: F23C8.5 (pep chromosome:WBcel235:I:2418450:2420353:-1 gene:WBGene00017734.1 transcript:F23C8.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F23C8.5)

HSP 1 Score: 315.079 bits (806), Expect = 4.273e-108
Identity = 148/253 (58.50%), Postives = 197/253 (77.87%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIE-MKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            +++LVG+KRV+DYAVK+RVKPD++GVVT+G++HSMNPFDEI +EEAV++KEK +A+E +A S G  K  E LRTALA G D+A+HV++  A    L+ FH++K L K++++EK D    GKQAIDDD +QTA + AGLLEW QA +ASK+E      ++VTRE+DGGL+ ++V +P VLS DLRLNEPRYATLPNIMKAKKKPL+ IP+KDL VD++ + + L+V +PP R AG  V+ V  LV KLKEKG +
Sbjct:    1 MKILVGVKRVVDYAVKIRVKPDRSGVVTEGVQHSMNPFDEIALEEAVKLKEKKLATEVVAFSLGGPKSAEVLRTALAKGADKAVHVQVTDAEAGKLESFHVAKALQKIVEQEKFDAVFLGKQAIDDDSSQTAPILAGLLEWPQALYASKVEDAGAGHMKVTREIDGGLDTIKVKVPFVLSADLRLNEPRYATLPNIMKAKKKPLKNIPIKDLNVDITPQTETLEVTEPPVRQAGGFVDDVSALVAKLKEKGFV 253          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Celegans
Match: F23C8.5 (pep chromosome:WBcel235:I:2418461:2418849:-1 gene:WBGene00017734.1 transcript:F23C8.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F23C8.5)

HSP 1 Score: 63.929 bits (154), Expect = 2.434e-13
Identity = 32/57 (56.14%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  661 MKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            MKAKKKPL+ IP+KDL VD++ + + L+V +PP R AG  V+ V  LV KLKEKG +
Sbjct:    1 MKAKKKPLKNIPIKDLNVDITPQTETLEVTEPPVRQAGGFVDDVSALVAKLKEKGFV 57          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Fly
Match: CG7834 (gene:FBgn0039697 transcript:FBtr0085535)

HSP 1 Score: 333.569 bits (854), Expect = 2.494e-115
Identity = 172/251 (68.53%), Postives = 198/251 (78.88%), Query Frame = 1
Query:   79 RVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            RVLVG+KRVIDYAVKVRVKPDKTGVVT G+KHSMNPFDEI VEEAV++KEK +A E IAVS GP + QE +RTALAMG DR +HVEI  A +E LQP H+SKIL+K+   EKAD+ I GKQAIDDD NQTAQMTA +L+W Q TF +KIE  D+ L +TRE+DGGLE ++   PAVLS DLRLN PRYATLPNIMKAKKKPL+K+  KDLGVD S R +V+ V DPP R AG  V  V+ LV KLKE G I
Sbjct:    3 RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGPAQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGGHI 253          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Fly
Match: CG7834 (gene:FBgn0039697 transcript:FBtr0085536)

HSP 1 Score: 333.569 bits (854), Expect = 2.494e-115
Identity = 172/251 (68.53%), Postives = 198/251 (78.88%), Query Frame = 1
Query:   79 RVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            RVLVG+KRVIDYAVKVRVKPDKTGVVT G+KHSMNPFDEI VEEAV++KEK +A E IAVS GP + QE +RTALAMG DR +HVEI  A +E LQP H+SKIL+K+   EKAD+ I GKQAIDDD NQTAQMTA +L+W Q TF +KIE  D+ L +TRE+DGGLE ++   PAVLS DLRLN PRYATLPNIMKAKKKPL+K+  KDLGVD S R +V+ V DPP R AG  V  V+ LV KLKE G I
Sbjct:    3 RVLVGVKRVIDYAVKVRVKPDKTGVVTQGVKHSMNPFDEIAVEEAVKLKEKKLAEEVIAVSVGPAQSQEVIRTALAMGADRGVHVEIPAAEYELLQPIHVSKILAKLALDEKADLVILGKQAIDDDANQTAQMTAAVLDWPQGTFCNKIEKTDAGLTITREIDGGLETIKTKTPAVLSADLRLNTPRYATLPNIMKAKKKPLKKVTAKDLGVDTSPRIEVISVEDPPVRQAGATVADVDALVAKLKEGGHI 253          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Zebrafish
Match: etfb (electron transfer flavoprotein subunit beta [Source:ZFIN;Acc:ZDB-GENE-040426-1931])

HSP 1 Score: 320.857 bits (821), Expect = 3.443e-110
Identity = 165/252 (65.48%), Postives = 203/252 (80.56%), Query Frame = 1
Query:   70 MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKG 825
            MS RVLVG+KRVIDYAVK+RVKPD TGVVTDG+KHSMNPF EI VEEAV++KEK +  E +AVSCGP + QET+RTALAMG DR IHVE+    +ETL P  +SKIL+ + +KE+A + I GKQAIDDDCNQT QMTA LL+W Q TFAS++  +  KL+V RE+DGGLE +++ +PAV++ DLRLN PRYATLPNIMKAKKK +  +   DLGVD+S R +VL+V +PPTR AG+KVE+VE+LV KLKE G
Sbjct:    1 MSARVLVGVKRVIDYAVKIRVKPDHTGVVTDGVKHSMNPFCEIAVEEAVKLKEKKLIKEVVAVSCGPQQVQETIRTALAMGADRGIHVEVSGKDYETLGPLQVSKILAALAKKEEASLIILGKQAIDDDCNQTGQMTAALLDWPQGTFASELAFEADKLKVVREIDGGLETIKIKMPAVVTADLRLNTPRYATLPNIMKAKKKKIAMVKPADLGVDVSSRLEVLKVDEPPTRQAGVKVETVEDLVGKLKEAG 252          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Zebrafish
Match: etfb (electron transfer flavoprotein subunit beta [Source:ZFIN;Acc:ZDB-GENE-040426-1931])

HSP 1 Score: 320.857 bits (821), Expect = 3.443e-110
Identity = 165/252 (65.48%), Postives = 203/252 (80.56%), Query Frame = 1
Query:   70 MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKG 825
            MS RVLVG+KRVIDYAVK+RVKPD TGVVTDG+KHSMNPF EI VEEAV++KEK +  E +AVSCGP + QET+RTALAMG DR IHVE+    +ETL P  +SKIL+ + +KE+A + I GKQAIDDDCNQT QMTA LL+W Q TFAS++  +  KL+V RE+DGGLE +++ +PAV++ DLRLN PRYATLPNIMKAKKK +  +   DLGVD+S R +VL+V +PPTR AG+KVE+VE+LV KLKE G
Sbjct:    1 MSARVLVGVKRVIDYAVKIRVKPDHTGVVTDGVKHSMNPFCEIAVEEAVKLKEKKLIKEVVAVSCGPQQVQETIRTALAMGADRGIHVEVSGKDYETLGPLQVSKILAALAKKEEASLIILGKQAIDDDCNQTGQMTAALLDWPQGTFASELAFEADKLKVVREIDGGLETIKIKMPAVVTADLRLNTPRYATLPNIMKAKKKKIAMVKPADLGVDVSSRLEVLKVDEPPTRQAGVKVETVEDLVGKLKEAG 252          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Xenopus
Match: pdhb (pyruvate dehydrogenase E1 beta subunit [Source:Xenbase;Acc:XB-GENE-977343])

HSP 1 Score: 273.092 bits (697), Expect = 1.446e-90
Identity = 129/211 (61.14%), Postives = 162/211 (76.78%), Query Frame = 1
Query:  199 GVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            G     R+KEK I SE IAVSCGP +CQET+RTALAMG DR IHVE+     E+L PF +SKI++ + +KE  ++ + GKQAIDDDCNQT QMTA LL+W Q TFAS+++++  KL V REVDGGLE + V +PAV++ DLRLNEPRYATLPNIMKAKKK +E +   DLGVD++ R +VL V DPP R AG+KVE+V++LV+KLKE G I
Sbjct:   92 GTTPTHRLKEKKIVSEIIAVSCGPQQCQETIRTALAMGADRGIHVEVAAKDAESLGPFQVSKIMAALAKKENVNLVLMGKQAIDDDCNQTGQMTAALLDWPQGTFASEVKVEGEKLTVVREVDGGLETISVKLPAVVTADLRLNEPRYATLPNIMKAKKKKIETVKPSDLGVDITSRIRVLSVEDPPQRLAGVKVETVQDLVSKLKESGRI 302          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Mouse
Match: Etfb (electron transferring flavoprotein, beta polypeptide [Source:MGI Symbol;Acc:MGI:106098])

HSP 1 Score: 348.206 bits (892), Expect = 7.691e-121
Identity = 164/252 (65.08%), Postives = 204/252 (80.95%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            LR LV +KRVID+AVK+RVKPDK+GVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVEI  A  E+L P  ++++L+K+ +KEK D+   GKQAIDDDCNQT QMTAGLL+W Q TFAS++ ++  K++V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E +   DLGVDL+ +  V+ V +PP RSAG+KVE+ E+LV KLKE G I
Sbjct:    4 LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPSQCQETIRTALAMGADRGIHVEIPGAQAESLGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVVKAGDLGVDLTSKVSVISVEEPPQRSAGVKVETTEDLVAKLKEVGRI 255          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Mouse
Match: Etfbl (electron transferring flavoprotein, beta polypeptide like [Source:MGI Symbol;Acc:MGI:5753809])

HSP 1 Score: 295.434 bits (755), Expect = 1.305e-100
Identity = 138/212 (65.09%), Postives = 173/212 (81.60%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLG 711
            LR LV +KRVID+AVK+RVKPDK+GVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVEI  A  E+L P  ++++L+K+ +KEK D+   GKQAIDDDCNQT QMTAGLL+W Q TFAS++ ++  K++V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIM+AK+  L  + + DLG
Sbjct:    4 LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPSQCQETIRTALAMGADRGIHVEIPGAQAESLGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMEAKQPFL--LDLSDLG 213          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Mouse
Match: Etfb (electron transferring flavoprotein, beta polypeptide [Source:MGI Symbol;Acc:MGI:106098])

HSP 1 Score: 290.812 bits (743), Expect = 7.746e-99
Identity = 132/200 (66.00%), Postives = 165/200 (82.50%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKK 675
            LR LV +KRVID+AVK+RVKPDK+GVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVEI  A  E+L P  ++++L+K+ +KEK D+   GKQAIDDDCNQT QMTAGLL+W Q TFAS++ ++  K++V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIM+  +
Sbjct:    4 LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPSQCQETIRTALAMGADRGIHVEIPGAQAESLGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMQESR 203          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Mouse
Match: Etfb (electron transferring flavoprotein, beta polypeptide [Source:MGI Symbol;Acc:MGI:106098])

HSP 1 Score: 247.669 bits (631), Expect = 1.591e-82
Identity = 113/174 (64.94%), Postives = 142/174 (81.61%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTI 597
            LR LV +KRVID+AVK+RVKPDK+GVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVEI  A  E+L P  ++++L+K+ +KEK D+   GKQAIDDDCNQT QMTAGLL+W Q TFAS++ ++  K++V RE+DGGLE L++ +
Sbjct:    4 LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPSQCQETIRTALAMGADRGIHVEIPGAQAESLGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKL 177          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Mouse
Match: Etfb (electron transferring flavoprotein, beta polypeptide [Source:MGI Symbol;Acc:MGI:106098])

HSP 1 Score: 230.72 bits (587), Expect = 9.516e-76
Identity = 118/227 (51.98%), Postives = 145/227 (63.88%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDP 756
            LR LV +KRVID+AVK+RVKPDK+GVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +C                                                     QAIDDDCNQT QMTAGLL+W Q TFAS++ ++  K++V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E +   DLGVDL+ +  V+ V +P
Sbjct:    4 LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPSQC-----------------------------------------------------QAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVVKAGDLGVDLTSKVSVISVEEP 177          
BLAST of Electron transfer flavoprotein subunit beta vs. UniProt/SwissProt
Match: sp|P38117|ETFB_HUMAN (Electron transfer flavoprotein subunit beta OS=Homo sapiens OX=9606 GN=ETFB PE=1 SV=3)

HSP 1 Score: 349.747 bits (896), Expect = 1.021e-120
Identity = 166/255 (65.10%), Postives = 205/255 (80.39%), Query Frame = 1
Query:   67 IMSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            +  LRVLV +KRVIDYAVK+RVKPD+TGVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVE+  A  E L P  ++++L+K+ +KEK D+ + GKQAIDDDCNQT QMTAG L+W Q TFAS++ ++  KL+V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E I   DLGVDL+ +  V+ V DPP R+AG+KVE+ E+LV KLKE G I
Sbjct:    1 MAELRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI 255          
BLAST of Electron transfer flavoprotein subunit beta vs. UniProt/SwissProt
Match: sp|Q5RFK0|ETFB_PONAB (Electron transfer flavoprotein subunit beta OS=Pongo abelii OX=9601 GN=ETFB PE=2 SV=3)

HSP 1 Score: 348.591 bits (893), Expect = 3.875e-120
Identity = 165/255 (64.71%), Postives = 204/255 (80.00%), Query Frame = 1
Query:   67 IMSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            +  LR LV +KRVIDYAVK+RVKPD+TGVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVE+  A  E L P  ++++L+K+ +KEK D+ + GKQAIDDDCNQT QMTAG L+W Q TFAS++ ++  KL+V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E I   DLGVDL+ +  V+ V DPP R+AG+KVE+ E+LV KLKE G I
Sbjct:    1 MAELRALVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALAMGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI 255          
BLAST of Electron transfer flavoprotein subunit beta vs. UniProt/SwissProt
Match: sp|Q9DCW4|ETFB_MOUSE (Electron transfer flavoprotein subunit beta OS=Mus musculus OX=10090 GN=Etfb PE=1 SV=3)

HSP 1 Score: 348.206 bits (892), Expect = 5.380e-120
Identity = 164/252 (65.08%), Postives = 204/252 (80.95%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            LR LV +KRVID+AVK+RVKPDK+GVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVEI  A  E+L P  ++++L+K+ +KEK D+   GKQAIDDDCNQT QMTAGLL+W Q TFAS++ ++  K++V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E +   DLGVDL+ +  V+ V +PP RSAG+KVE+ E+LV KLKE G I
Sbjct:    4 LRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPSQCQETIRTALAMGADRGIHVEIPGAQAESLGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVVKAGDLGVDLTSKVSVISVEEPPQRSAGVKVETTEDLVAKLKEVGRI 255          
BLAST of Electron transfer flavoprotein subunit beta vs. UniProt/SwissProt
Match: sp|Q2TBV3|ETFB_BOVIN (Electron transfer flavoprotein subunit beta OS=Bos taurus OX=9913 GN=ETFB PE=1 SV=3)

HSP 1 Score: 345.895 bits (886), Expect = 3.304e-119
Identity = 163/252 (64.68%), Postives = 202/252 (80.16%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            LR LV +KRVID+AVK+RVKPDKTGVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVE+  A    L P  ++++L+K+ +KEK D+ + GKQAIDDDCNQT QMTAG L+W Q TFAS++ ++  K++V RE+DGGLE L++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E I   DLGVDL+ +  V+ V DPP R+AG+KVE+ E+LV KLKE G I
Sbjct:    4 LRALVAVKRVIDFAVKIRVKPDKTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPAQCQETIRTALAMGADRGIHVEVPAAEANHLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQGTFASQVTLEGDKIKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKAGDLGVDLTSKLSVISVEDPPQRTAGVKVETTEDLVAKLKEIGRI 255          
BLAST of Electron transfer flavoprotein subunit beta vs. UniProt/SwissProt
Match: sp|Q68FU3|ETFB_RAT (Electron transfer flavoprotein subunit beta OS=Rattus norvegicus OX=10116 GN=Etfb PE=1 SV=3)

HSP 1 Score: 342.428 bits (877), Expect = 8.404e-118
Identity = 162/255 (63.53%), Postives = 203/255 (79.61%), Query Frame = 1
Query:   67 IMSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            +  LR LV +KRVID+AVK+RVKPDK+GVVTDG+KHSMNPF EI VEEAVR+KEK +  E IAVSCGP +CQET+RTALAMG DR IHVE+  A  E L P  ++++L+K+ +KEK D+   GKQAIDDDCNQT QMTAGLL+W Q TFAS++ ++  K++V RE+DGGLE +++ +PAV++ DLRLNEPRYATLPNIMKAKKK +E I   DLGVDL+ +  V+ V +PP R AG+KVE+ E+LV KLKE G I
Sbjct:    1 MAELRALVAVKRVIDFAVKIRVKPDKSGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEIIAVSCGPPQCQETIRTALAMGADRGIHVEVPGAEAENLGPLQVARVLAKLAEKEKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQGTFASQVTLEGDKVKVEREIDGGLETIRLKLPAVVTADLRLNEPRYATLPNIMKAKKKKIEVIKAGDLGVDLTSKVSVISVEEPPQRLAGVKVETTEDLVAKLKEVGRI 255          
BLAST of Electron transfer flavoprotein subunit beta vs. TrEMBL
Match: A0A210QHH2 (Electron transfer flavoprotein subunit beta OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21976 PE=4 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 2.650e-131
Identity = 184/254 (72.44%), Postives = 211/254 (83.07%), Query Frame = 1
Query:   70 MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            MSLR+LVG KRVIDYAVKVRVKPDK GVVTDG+KHSMNPFDEI +EEA+RMKEK +ASE IAVSCGP + QETLRTALAMG DRAIHV+I+   +ETLQPFH+SKIL+K++++EK D+ + GKQAIDDDCNQT QMTAGLL+W Q TF S +E  D  L V RE+DGGLE ++V+IPAVL+ DLRLNEPRYATLPNIMKAKKKP+      D GVD S RQ+VL V DPPTR AG KVESVEELV KLK+ G I
Sbjct:    1 MSLRILVGCKRVIDYAVKVRVKPDKLGVVTDGVKHSMNPFDEIAMEEAMRMKEKKLASEVIAVSCGPQQSQETLRTALAMGADRAIHVKIEPKDYETLQPFHVSKILAKIVEEEKIDLVVLGKQAIDDDCNQTGQMTAGLLDWPQGTFVSNVEKVDGHLNVLREIDGGLETVKVSIPAVLTADLRLNEPRYATLPNIMKAKKKPMAVKSAADYGVDTSPRQEVLSVEDPPTREAGQKVESVEELVQKLKDGGFI 254          
BLAST of Electron transfer flavoprotein subunit beta vs. TrEMBL
Match: K1PB82 (Electron transfer flavoprotein subunit beta OS=Crassostrea gigas OX=29159 GN=CGI_10011511 PE=4 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 2.984e-130
Identity = 183/252 (72.62%), Postives = 210/252 (83.33%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
             R+LVG KRVIDYAVKVRVKPDKTGVVT+G+KHSMNPFDEI VEEAVRMKEK +ASE IAVSCGP +CQETLRTALAMG+DRAIHV  +   +ET+QP H+SKILSK+  +EKAD+ I GKQAIDDDCNQT QMTA LL+W QATFASKIE  +  L V RE+DGGLE ++V +PAVL++DLRLNEPRYATLPNIMKAKKKPL      D GVD++ RQ+V+ V DPP R AG KVESVEELV KLKE G++
Sbjct:    4 FRILVGCKRVIDYAVKVRVKPDKTGVVTEGVKHSMNPFDEIAVEEAVRMKEKKLASEIIAVSCGPQQCQETLRTALAMGVDRAIHVITEAKEYETMQPIHVSKILSKIATEEKADLVIVGKQAIDDDCNQTGQMTASLLDWPQATFASKIEKSNGDLSVMREIDGGLETIKVKVPAVLTSDLRLNEPRYATLPNIMKAKKKPLVTKKPSDYGVDITPRQEVVSVEDPPVRQAGQKVESVEELVTKLKEAGLV 255          
BLAST of Electron transfer flavoprotein subunit beta vs. TrEMBL
Match: J3JYG8 (ETF domain-containing protein OS=Dendroctonus ponderosae OX=77166 PE=2 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 3.356e-128
Identity = 180/249 (72.29%), Postives = 212/249 (85.14%), Query Frame = 1
Query:   79 RVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKG 825
            RVLVG+KRVIDYAVK+RVKPDK+GVVTDG+KHSMNPFDEI VEEAV++KEK IASE IAVSCGP + QE LRTALAMG+D+ IHVE+    +ETLQP H+SKIL+K+ Q EK DI I GKQAIDDDCNQTAQMTAG+L+WSQATFASK+E  D+++ VTREVDGGLEV++  +PAV+S DLRLNEPRYATLPNIMKAKKKP++K+  KDLGVD++ R KV+ V DPPTR AG  V  V+ L+ KLKE G
Sbjct:    3 RVLVGVKRVIDYAVKIRVKPDKSGVVTDGVKHSMNPFDEIAVEEAVKLKEKKIASEIIAVSCGPAQSQEVLRTALAMGVDKGIHVEVTGPEYETLQPIHVSKILAKIAQNEKIDIVIVGKQAIDDDCNQTAQMTAGVLDWSQATFASKVEKGDNEITVTREVDGGLEVIKSKLPAVISADLRLNEPRYATLPNIMKAKKKPIQKLTPKDLGVDVTPRIKVVSVEDPPTRQAGQIVPDVDTLIGKLKEGG 251          
BLAST of Electron transfer flavoprotein subunit beta vs. TrEMBL
Match: A0A4Y2AQ24 (Electron transfer flavoprotein subunit beta OS=Araneus ventricosus OX=182803 GN=ETFB PE=4 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 1.699e-127
Identity = 180/254 (70.87%), Postives = 209/254 (82.28%), Query Frame = 1
Query:   70 MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            MS+R+LVG KRVIDYAV++R+KPDKTGVVT+G+KHS+NPFDEI VEEAVRMKEK + SE IAVSCGP  CQETLRTALAMG D+ IHVE+D   +ETLQP H+SKIL+ + Q+EK D+ I GKQAIDDD NQTAQMTA +L+W QATFASKIE  D  L+VTREVDGGLE + V +PAV+S DLRLNEPRYATLPNIMKAKKKP+      DLGVD+S R +V+ V DPPTR AG KVESV+EL+ KLK  G I
Sbjct:    1 MSMRILVGCKRVIDYAVRIRIKPDKTGVVTEGVKHSLNPFDEIAVEEAVRMKEKKLCSEIIAVSCGPTTCQETLRTALAMGADKGIHVEVDGKDYETLQPLHVSKILAALAQQEKVDLVILGKQAIDDDANQTAQMTAAILDWPQATFASKIEKDDGNLKVTREVDGGLENISVKLPAVVSADLRLNEPRYATLPNIMKAKKKPIAVKKPSDLGVDVSSRIEVISVEDPPTREAGTKVESVDELLEKLKALGRI 254          
BLAST of Electron transfer flavoprotein subunit beta vs. TrEMBL
Match: N6U2K5 (ETF domain-containing protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=YQE_10601 PE=4 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 2.722e-127
Identity = 180/249 (72.29%), Postives = 212/249 (85.14%), Query Frame = 1
Query:   79 RVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKG 825
            RVLVG+KRVIDYAVK+RVKPDK+GVVTDG+KHSMNPFDEI VEEAV++KEK IASE IAVSCGP + QE LRTALAMG+D+ IHVE+    +ETLQP H+SKIL+K+ Q EK DI I GKQAIDDDCNQTAQMTAG+L+WSQATFASK+E  D+++ VTREVDGGLEV++  +PAV+S DLRLNEPRYATLPNIMKAKKKP++K+  KDLGVD++ R KV+ V DPPTR AG  V  V+ L+ KLKE G
Sbjct:   38 RVLVGVKRVIDYAVKIRVKPDKSGVVTDGVKHSMNPFDEIAVEEAVKLKEKKIASEIIAVSCGPAQSQEVLRTALAMGVDKGIHVEVTGPEYETLQPIHVSKILAKIAQNEKIDIVIVGKQAIDDDCNQTAQMTAGVLDWSQATFASKVEKGDNEITVTREVDGGLEVIKSKLPAVISADLRLNEPRYATLPNIMKAKKKPIQKLTPKDLGVDVTPRIKVVSVEDPPTRQAGQIVPDVDTLIGKLKEGG 286          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Cavefish
Match: etfb (electron transfer flavoprotein subunit beta [Source:NCBI gene;Acc:103034022])

HSP 1 Score: 331.643 bits (849), Expect = 1.863e-114
Identity = 161/254 (63.39%), Postives = 202/254 (79.53%), Query Frame = 1
Query:   70 MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            M+ RVLVG+KRVIDYAVK+RVKPD TGVVTDG+KHSMNPF EI VEEAVR+KEK +  E +AVSCGP + QET+RTALAMG DR IHVE+    ++TL P  +SKIL+ + +KE+A + I GKQAIDDDCNQT QMTA LL+W Q TFAS++ +   K++V RE+DGGLE +++ +PAV++ DLRLN PRYATLPNIMKAKKK +  +   +LGVDL+ R +VL+V +P  R AG+KVE+VE+LV KLKE G I
Sbjct:    1 MAARVLVGVKRVIDYAVKIRVKPDNTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVVAVSCGPQQVQETIRTALAMGADRGIHVEVSGKDYDTLGPLQVSKILAALAKKEEASLVILGKQAIDDDCNQTGQMTAALLDWPQGTFASEVTIDGDKIKVIREIDGGLETIKINMPAVVTADLRLNTPRYATLPNIMKAKKKKIASVKPGELGVDLTSRLEVLRVEEPAQRQAGVKVETVEDLVGKLKEAGRI 254          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Cavefish
Match: etfb (electron transfer flavoprotein subunit beta [Source:NCBI gene;Acc:103034022])

HSP 1 Score: 280.026 bits (715), Expect = 1.547e-94
Identity = 144/254 (56.69%), Postives = 184/254 (72.44%), Query Frame = 1
Query:   70 MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            M+ RVLVG+KRVIDYAVK+RVKPD TGVVTDG+KHSMNPF EI VEEAVR+KEK +  E +AVSCGP + QET+RTALAMG DR IHVE+    ++TL P  +SKIL+ + +KE+A + I GK                     Q TFAS++ +   K++V RE+DGGLE +++ +PAV++ DLRLN PRYATLPNIMKAKKK +  +   +LGVDL+ R +VL+V +P  R AG+KVE+VE+LV KLKE G I
Sbjct:    1 MAARVLVGVKRVIDYAVKIRVKPDNTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVVAVSCGPQQVQETIRTALAMGADRGIHVEVSGKDYDTLGPLQVSKILAALAKKEEASLVILGK---------------------QGTFASEVTIDGDKIKVIREIDGGLETIKINMPAVVTADLRLNTPRYATLPNIMKAKKKKIASVKPGELGVDLTSRLEVLRVEEPAQRQAGVKVETVEDLVGKLKEAGRI 233          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Sea Lamprey
Match: etfb (electron transfer flavoprotein subunit beta [Source:ZFIN;Acc:ZDB-GENE-040426-1931])

HSP 1 Score: 178.333 bits (451), Expect = 1.326e-56
Identity = 84/137 (61.31%), Postives = 107/137 (78.10%), Query Frame = 1
Query:  421 IAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            I +   QAIDDDCN+T QMTA LL+W Q TFAS+I ++  KL+V RE+DGGLE + + +PAV++ DLRLNEPRYATLPNIMKAKKK ++ +  KDLGVD++ R ++L V DPP R AGIKVE+ E+LV KL+E G I
Sbjct:    4 IIVSAPQAIDDDCNETGQMTAALLDWPQGTFASEIHLEGDKLKVVREIDGGLETIVINMPAVITADLRLNEPRYATLPNIMKAKKKKIDMVTPKDLGVDMASRVEILSVEDPPQRQAGIKVETTEQLVAKLREIGRI 140          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Yeast
Match: CIR1 (Mitochondrial protein that interacts with frataxin (Yfh1p); putative ortholog of mammalian electron transfer flavoprotein complex subunit ETF-beta; may have a role in oxidative stress response [Source:SGD;Acc:S000003439])

HSP 1 Score: 241.891 bits (616), Expect = 4.929e-80
Identity = 127/253 (50.20%), Postives = 179/253 (70.75%), Query Frame = 1
Query:   76 LRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEK--SIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDS-KLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPV-KDLG-VDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKE 819
            LR+LV +KRV+D+ +K RV    TG+ T GIK S+NPFD+I VEEA+R+KEK  S+   T AVS G  K Q+ LR  LA GID      ID    E ++P  I+KIL  V++K+ +++ + GKQAIDDDCN T QM AGLL W QAT A+K+E  D+ +++VTRE+D G EV++ ++P V++TDLRLN PRY  LP +MKAKKKP+EK+ + KD   +++  + K++ + +P T+S G+K+ SV+EL+ KLKE
Sbjct:    7 LRILVPVKRVVDFQIKPRVNKTLTGIETSGIKFSINPFDDIAVEEAIRIKEKNKSLVESTHAVSIGSAKAQDILRNCLAKGIDTCSL--IDSVGKENIEPLAIAKILKAVVEKKGSNLVLMGKQAIDDDCNNTGQMLAGLLNWPQATNAAKVEFLDNGRVQVTREIDDGEEVIEASLPMVITTDLRLNTPRYVGLPKLMKAKKKPIEKLDIAKDFPEINIEPQLKIVSMEEPKTKSPGVKLNSVDELIEKLKE 257          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Nematostella
Match: EDO33621 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRQ1])

HSP 1 Score: 340.887 bits (873), Expect = 1.366e-118
Identity = 169/253 (66.80%), Postives = 208/253 (82.21%), Query Frame = 1
Query:   67 IMSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKG 825
            + SLRVLVG KRVIDYAVK+RVKPDKTGVVTDG+KHSMNPFDEI VEEAVR+KEK IASE +AVSCGP K +ETLRTALAMG DR +HV +    +E LQP  ++K+L+KV+++E+  + I GKQAIDDDCNQT+QM + +L W QA +ASK+E KD KL+V RE+DGGLE + V +P V+STDLRLNEPRYATLPNIMKAKKK ++K   +DLGVD++ R ++L V DPP R AGIKVE+V++LV KLK+ G
Sbjct:    1 MASLRVLVGCKRVIDYAVKIRVKPDKTGVVTDGVKHSMNPFDEIAVEEAVRLKEKKIASEIVAVSCGPAKSEETLRTALAMGADRGVHVVLGDKEYEGLQPLAVAKLLAKVVEQEQPGLVILGKQAIDDDCNQTSQMLSAILNWPQAMYASKLEPKDGKLDVVREIDGGLETITVKLPCVVSTDLRLNEPRYATLPNIMKAKKKKIDKKTPEDLGVDVTPRIQILNVQDPPVREAGIKVETVDDLVAKLKDAG 253          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Nematostella
Match: EDO26394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC48])

HSP 1 Score: 82.4185 bits (202), Expect = 2.084e-20
Identity = 37/51 (72.55%), Postives = 44/51 (86.27%), Query Frame = 1
Query:  511 FASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIM 663
            +ASK+E KD KL+V RE+DGGLE + V +P V+STDLRLNEPRYATLPNIM
Sbjct:    2 YASKLEPKDGKLDVVREIDGGLETITVKLPCVVSTDLRLNEPRYATLPNIM 52          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Nematostella
Match: EDO26393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC47])

HSP 1 Score: 54.299 bits (129), Expect = 4.331e-10
Identity = 25/42 (59.52%), Postives = 34/42 (80.95%), Query Frame = 1
Query:  700 KDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKG 825
            +DLGVD++ R ++L V DPP R AGIKVE+V++LV KLK+ G
Sbjct:   13 EDLGVDVTPRIQILNVQDPPVREAGIKVETVDDLVTKLKDAG 54          
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Medaka
Match: etfb (electron transfer flavoprotein subunit beta [Source:NCBI gene;Acc:105356004])

HSP 1 Score: 306.605 bits (784), Expect = 1.473e-104
Identity = 158/252 (62.70%), Postives = 202/252 (80.16%), Query Frame = 1
Query:   70 MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKG 825
            MS RVLVG+KRVIDYAVK+RVKPD +GVVTDG+KHSMNPF EI VEEAV++KEK +  E + VSCGP + QET+RTALAMG DR IHV++    +ETL P  +SKIL+ + +KE A + I GKQAIDDDCNQT QMTA LL+W Q TFAS++ +++  ++V RE+DGGLE ++++ PAVL+ DLRLN PRYATLPNIMKAKKK +  +   DLGVDL+ R +VL+V +PP R AG+KVE+V++LV+KLK+ G
Sbjct:    1 MSGRVLVGVKRVIDYAVKIRVKPDHSGVVTDGVKHSMNPFCEIAVEEAVKLKEKKLMKEVVVVSCGPQQSQETIRTALAMGADRGIHVQVSGKDYETLGPLQVSKILAALAKKEDAQLIILGKQAIDDDCNQTGQMTAALLDWPQGTFASEVSLENDGIKVVREIDGGLETIKISTPAVLTADLRLNTPRYATLPNIMKAKKKKIANVKPADLGVDLTSRLEVLRVDEPPQRQAGMKVETVDDLVSKLKDAG 252          
BLAST of Electron transfer flavoprotein subunit beta vs. Planmine SMEST
Match: SMESG000025689.1 (SMESG000025689.1)

HSP 1 Score: 512.301 bits (1318), Expect = 0.000e+0
Identity = 253/254 (99.61%), Postives = 253/254 (99.61%), Query Frame = 1
Query:   70 MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 831
            MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKI SKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI
Sbjct:    1 MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVRMKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQPFHISKIFSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFASKIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKAKKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKEKGVI 254          
The following BLAST results are available for this feature:
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ETFB2.125e-12165.10electron transfer flavoprotein subunit beta [Sourc... [more]
ETFB1.506e-10964.02electron transfer flavoprotein subunit beta [Sourc... [more]
ETFB3.358e-7853.95electron transfer flavoprotein subunit beta [Sourc... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F23C8.54.273e-10858.50pep chromosome:WBcel235:I:2418450:2420801:-1 gene:... [more]
F23C8.54.273e-10858.50pep chromosome:WBcel235:I:2418450:2420353:-1 gene:... [more]
F23C8.52.434e-1356.14pep chromosome:WBcel235:I:2418461:2418849:-1 gene:... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG78342.494e-11568.53gene:FBgn0039697 transcript:FBtr0085535[more]
CG78342.494e-11568.53gene:FBgn0039697 transcript:FBtr0085536[more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
etfb3.443e-11065.48electron transfer flavoprotein subunit beta [Sourc... [more]
etfb3.443e-11065.48electron transfer flavoprotein subunit beta [Sourc... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pdhb1.446e-9061.14pyruvate dehydrogenase E1 beta subunit [Source:Xen... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Etfb7.691e-12165.08electron transferring flavoprotein, beta polypepti... [more]
Etfbl1.305e-10065.09electron transferring flavoprotein, beta polypepti... [more]
Etfb7.746e-9966.00electron transferring flavoprotein, beta polypepti... [more]
Etfb1.591e-8264.94electron transferring flavoprotein, beta polypepti... [more]
Etfb9.516e-7651.98electron transferring flavoprotein, beta polypepti... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P38117|ETFB_HUMAN1.021e-12065.10Electron transfer flavoprotein subunit beta OS=Hom... [more]
sp|Q5RFK0|ETFB_PONAB3.875e-12064.71Electron transfer flavoprotein subunit beta OS=Pon... [more]
sp|Q9DCW4|ETFB_MOUSE5.380e-12065.08Electron transfer flavoprotein subunit beta OS=Mus... [more]
sp|Q2TBV3|ETFB_BOVIN3.304e-11964.68Electron transfer flavoprotein subunit beta OS=Bos... [more]
sp|Q68FU3|ETFB_RAT8.404e-11863.53Electron transfer flavoprotein subunit beta OS=Rat... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QHH22.650e-13172.44Electron transfer flavoprotein subunit beta OS=Miz... [more]
K1PB822.984e-13072.62Electron transfer flavoprotein subunit beta OS=Cra... [more]
J3JYG83.356e-12872.29ETF domain-containing protein OS=Dendroctonus pond... [more]
A0A4Y2AQ241.699e-12770.87Electron transfer flavoprotein subunit beta OS=Ara... [more]
N6U2K52.722e-12772.29ETF domain-containing protein (Fragment) OS=Dendro... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
etfb1.863e-11463.39electron transfer flavoprotein subunit beta [Sourc... [more]
etfb1.547e-9456.69electron transfer flavoprotein subunit beta [Sourc... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
etfb1.326e-5661.31electron transfer flavoprotein subunit beta [Sourc... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CIR14.929e-8050.20Mitochondrial protein that interacts with frataxin... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO336211.366e-11866.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263942.084e-2072.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263934.331e-1059.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
etfb1.473e-10462.70electron transfer flavoprotein subunit beta [Sourc... [more]
back to top
BLAST of Electron transfer flavoprotein subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000025689.10.000e+099.61SMESG000025689.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000284 ID=SMED30000284|Name=Electron transfer flavoprotein subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=924bp
AAATCTATATAAATCTTATATGACTTATTTTGAGAATTAAATAAAAAATT
ATCATTCAATAAAATTATCATGTCTTTACGGGTGCTTGTTGGAATTAAAA
GAGTAATAGATTATGCAGTAAAAGTAAGAGTTAAACCTGATAAAACTGGT
GTCGTAACTGATGGGATAAAACATTCAATGAATCCGTTTGATGAAATTGG
AGTTGAAGAAGCGGTCAGAATGAAAGAGAAAAGTATTGCTTCTGAAACGA
TTGCGGTTAGTTGTGGTCCTGATAAATGTCAAGAAACATTACGTACTGCT
CTTGCAATGGGAATCGATAGAGCTATCCATGTCGAAATTGATCAGGCAAC
ATTCGAAACTTTACAGCCATTTCATATATCCAAAATATTATCTAAAGTGA
TTCAAAAAGAGAAAGCTGATATTGCAATATTTGGCAAACAAGCAATCGAC
GATGACTGCAATCAAACCGCTCAAATGACTGCTGGACTTTTAGAATGGTC
TCAAGCTACTTTTGCGTCAAAGATCGAAATGAAAGATTCGAAATTGGAAG
TTACGAGAGAAGTCGACGGTGGATTAGAAGTGTTACAAGTGACGATTCCA
GCAGTTCTCAGCACGGATTTGCGATTGAATGAGCCTCGTTATGCCACCTT
ACCAAATATCATGAAAGCCAAGAAAAAGCCATTAGAAAAAATTCCGGTTA
AAGATCTTGGAGTTGATCTGAGTTGCCGGCAGAAAGTTCTCCAAGTTCTA
GATCCTCCTACTCGCAGTGCTGGGATTAAAGTAGAATCTGTTGAAGAATT
AGTAAACAAGTTAAAGGAAAAGGGCGTCATTTAATTGTCAGTGGGAAAAT
ATTAGGATTGTTTTGAAAAATAAATTTCGACATTGACTTTATATGTATTT
ATTATTATTAATGTTTTATTATTT
back to top

protein sequence of SMED30000284-orf-1

>SMED30000284-orf-1 ID=SMED30000284-orf-1|Name=SMED30000284-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=255bp
MSLRVLVGIKRVIDYAVKVRVKPDKTGVVTDGIKHSMNPFDEIGVEEAVR
MKEKSIASETIAVSCGPDKCQETLRTALAMGIDRAIHVEIDQATFETLQP
FHISKILSKVIQKEKADIAIFGKQAIDDDCNQTAQMTAGLLEWSQATFAS
KIEMKDSKLEVTREVDGGLEVLQVTIPAVLSTDLRLNEPRYATLPNIMKA
KKKPLEKIPVKDLGVDLSCRQKVLQVLDPPTRSAGIKVESVEELVNKLKE
KGVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005759mitochondrial matrix
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0022900electron transport chain
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR033948ETF_beta_N
IPR014730ETF_a/b_N
IPR012255ETF_b
IPR014729Rossmann-like_a/b/a_fold
IPR000049ET-Flavoprotein_bsu_CS
Vocabulary: molecular function
TermDefinition
GO:0009055electron carrier activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014730Electron transfer flavoprotein, alpha/beta-subunit, N-terminalSMARTSM00893ETF_2coord: 25..217
e-value: 2.4E-59
score: 213.1
IPR014730Electron transfer flavoprotein, alpha/beta-subunit, N-terminalPFAMPF01012ETFcoord: 28..212
e-value: 4.2E-43
score: 147.3
IPR012255Electron transfer flavoprotein, beta subunitPIRSFPIRSF000090Beta-ETFcoord: 3..254
e-value: 1.9E-81
score: 270.9
IPR012255Electron transfer flavoprotein, beta subunitPANTHERPTHR21294ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNITcoord: 3..253
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 3..254
e-value: 9.4E-86
score: 289.0
NoneNo IPR availablePANTHERPTHR21294:SF8ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETAcoord: 3..253
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 3..248
IPR000049Electron transfer flavoprotein, beta-subunit, conserved sitePROSITEPS01065ETF_BETAcoord: 161..181
IPR033948Electron transfer flavoprotein, beta subunit, N-terminalCDDcd01714ETF_betacoord: 4..208
e-value: 5.09527E-91
score: 265.18