Histone H3

Overview
NameHistone H3
Smed IDSMED30000270
Length (bp)712
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone H3 (SMED30000270) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone H3 (SMED30000270) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone H3 (SMED30000270) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone H3 (SMED30000270) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000270

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30000270SMESG000049112.1 SMESG000049109.1 JX070082smed_ncbi_20200123PMID:23629965
Zeng et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30000270SMESG000049112.1 SMESG000049109.1 SmedASXL_003772SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000270SMESG000049112.1 SMESG000049109.1 SmedASXL_003772SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v4_532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v4_532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v4_532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v4_532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v4_532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v4_532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v4_532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v4_532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v4_532_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000270SMESG000049112.1 SMESG000049109.1 Contig52141newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000270SMESG000049112.1 SMESG000049109.1 Contig52141uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30000270SMESG000049112.1 SMESG000049109.1 dd_Smed_v6_532_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000270SMESG000049112.1 SMESG000049109.1 KC916784smed_ncbi_20200123PMID:24903754
Rouhana et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
chromatoid bodySMED30000270SMESG000049112.1 SMESG000049109.1 KC916784smed_ncbi_20200123PMID:24903754
Rouhana et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone H3 vs. Ensembl Human
Match: H3-3A (H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764])

HSP 1 Score: 273.092 bits (697), Expect = 4.122e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Human
Match: H3-3A (H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764])

HSP 1 Score: 273.092 bits (697), Expect = 4.122e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Human
Match: H3-3A (H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764])

HSP 1 Score: 273.092 bits (697), Expect = 4.122e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Human
Match: H3-3A (H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764])

HSP 1 Score: 273.092 bits (697), Expect = 4.122e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Human
Match: H3-3A (H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764])

HSP 1 Score: 273.092 bits (697), Expect = 4.122e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-71 (Histone H3.3 type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q10453])

HSP 1 Score: 271.937 bits (694), Expect = 5.307e-94
Identity = 134/136 (98.53%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-72 (Histone H3.3 type 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9U281])

HSP 1 Score: 270.781 bits (691), Expect = 1.486e-93
Identity = 133/136 (97.79%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDMQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-63 (Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P08898])

HSP 1 Score: 262.307 bits (669), Expect = 3.462e-90
Identity = 129/136 (94.85%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPGTVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDLRFQS+AV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-59 (Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P08898])

HSP 1 Score: 262.307 bits (669), Expect = 3.462e-90
Identity = 129/136 (94.85%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPGTVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDLRFQS+AV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Celegans
Match: his-55 (Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P08898])

HSP 1 Score: 262.307 bits (669), Expect = 3.462e-90
Identity = 129/136 (94.85%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP++GGVKKPHRYRPGTVALREIRRYQKSTELLIR+ PFQRLVREIAQDFKTDLRFQS+AV ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3.3A (gene:FBgn0014857 transcript:FBtr0079010)

HSP 1 Score: 273.092 bits (697), Expect = 1.975e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3.3A (gene:FBgn0014857 transcript:FBtr0333537)

HSP 1 Score: 273.092 bits (697), Expect = 1.975e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3.3A (gene:FBgn0014857 transcript:FBtr0333536)

HSP 1 Score: 273.092 bits (697), Expect = 1.975e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3.3B (gene:FBgn0004828 transcript:FBtr0071347)

HSP 1 Score: 273.092 bits (697), Expect = 1.975e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Fly
Match: His3.3B (gene:FBgn0004828 transcript:FBtr0071345)

HSP 1 Score: 273.092 bits (697), Expect = 1.975e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: h3f3b.1 (H3 histone, family 3B.1 [Source:ZFIN;Acc:ZDB-GENE-050417-65])

HSP 1 Score: 273.092 bits (697), Expect = 2.622e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: h3f3c (H3 histone, family 3C [Source:ZFIN;Acc:ZDB-GENE-030131-8175])

HSP 1 Score: 273.092 bits (697), Expect = 2.622e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: h3f3c (H3 histone, family 3C [Source:ZFIN;Acc:ZDB-GENE-030131-8175])

HSP 1 Score: 273.092 bits (697), Expect = 2.622e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: h3f3b.1 (H3 histone, family 3B.1 [Source:ZFIN;Acc:ZDB-GENE-050417-65])

HSP 1 Score: 273.092 bits (697), Expect = 2.622e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Zebrafish
Match: h3f3b.1 (H3 histone, family 3B.1 [Source:ZFIN;Acc:ZDB-GENE-050417-65])

HSP 1 Score: 273.092 bits (697), Expect = 2.622e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: wfikkn1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:Xenbase;Acc:XB-GENE-923256])

HSP 1 Score: 273.092 bits (697), Expect = 3.737e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: snapc1 (small nuclear RNA activating complex polypeptide 1 [Source:Xenbase;Acc:XB-GENE-993180])

HSP 1 Score: 273.092 bits (697), Expect = 3.737e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: polr3k (polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa [Source:Xenbase;Acc:XB-GENE-5913354])

HSP 1 Score: 273.092 bits (697), Expect = 3.737e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: lamtor2 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 2 [Source:Xenbase;Acc:XB-GENE-992364])

HSP 1 Score: 268.47 bits (685), Expect = 2.648e-92
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Xenopus
Match: hist2h3c (histone H3 [Source:NCBI gene;Acc:100493100])

HSP 1 Score: 268.47 bits (685), Expect = 2.648e-92
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3f3a (H3.3 histone A [Source:MGI Symbol;Acc:MGI:1097686])

HSP 1 Score: 273.092 bits (697), Expect = 2.830e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3f3a (H3.3 histone A [Source:MGI Symbol;Acc:MGI:1097686])

HSP 1 Score: 273.092 bits (697), Expect = 2.830e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3f3b (H3.3 histone B [Source:MGI Symbol;Acc:MGI:1101768])

HSP 1 Score: 273.092 bits (697), Expect = 2.830e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3f3b (H3.3 histone B [Source:MGI Symbol;Acc:MGI:1101768])

HSP 1 Score: 273.092 bits (697), Expect = 2.830e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Mouse
Match: H3c13 (H3 clustered histone 13 [Source:MGI Symbol;Acc:MGI:2448351])

HSP 1 Score: 268.47 bits (685), Expect = 2.005e-92
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|Q6P823|H33_XENTR (Histone H3.3 OS=Xenopus tropicalis OX=8364 GN=TGas113e22.1 PE=1 SV=3)

HSP 1 Score: 273.092 bits (697), Expect = 1.980e-93
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|Q6PI79|H33_XENLA (Histone H3.3 OS=Xenopus laevis OX=8355 PE=1 SV=3)

HSP 1 Score: 273.092 bits (697), Expect = 1.980e-93
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|P84248|H33_SPISO (Histone H3.3 OS=Spisula solidissima OX=6584 PE=2 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 1.980e-93
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|P84245|H33_RAT (Histone H3.3 OS=Rattus norvegicus OX=10116 GN=H3-3b PE=1 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 1.980e-93
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. UniProt/SwissProt
Match: sp|P84246|H33_RABIT (Histone H3.3 OS=Oryctolagus cuniculus OX=9986 GN=H3-3A PE=2 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 1.980e-93
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. TrEMBL
Match: A0A2H1CLU5 (Histone H3 OS=Fasciola hepatica OX=6192 GN=D915_04183 PE=3 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 2.414e-93
Identity = 137/140 (97.86%), Postives = 140/140 (100.00%), Query Frame = 3
Query:   66 INIVMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            +N++MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:   11 LNLLMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 150          
BLAST of Histone H3 vs. TrEMBL
Match: A0A4E0RCN4 (Histone H3 OS=Fasciola hepatica OX=6192 GN=D915_002825 PE=3 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 5.648e-93
Identity = 137/140 (97.86%), Postives = 140/140 (100.00%), Query Frame = 3
Query:   66 INIVMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            +N++MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:   32 LNLLMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 171          
BLAST of Histone H3 vs. TrEMBL
Match: A0A3Q3K8E7 (Histone H3 OS=Monopterus albus OX=43700 PE=3 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.674e-92
Identity = 137/139 (98.56%), Postives = 138/139 (99.28%), Query Frame = 3
Query:   69 NIVMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
             IVMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 GIVMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 139          
BLAST of Histone H3 vs. TrEMBL
Match: A0A3P8UG44 (Histone H3 OS=Amphiprion percula OX=161767 PE=3 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 1.126e-91
Identity = 136/139 (97.84%), Postives = 137/139 (98.56%), Query Frame = 3
Query:   69 NIVMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
             I MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 GIAMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 139          
BLAST of Histone H3 vs. TrEMBL
Match: T2MEU0 (Histone H3 (Fragment) OS=Hydra vulgaris OX=6087 GN=H3F3A PE=2 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 1.370e-91
Identity = 134/139 (96.40%), Postives = 139/139 (100.00%), Query Frame = 3
Query:   69 NIVMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            +++MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:   10 DVLMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 148          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: ENSAMXT00000056477.1 (histone H3.3 [Source:NCBI gene;Acc:103046944])

HSP 1 Score: 273.092 bits (697), Expect = 2.223e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: si:ch1073-429i10.3 (histone H3.3 [Source:NCBI gene;Acc:103046944])

HSP 1 Score: 273.092 bits (697), Expect = 2.223e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: h3f3d (histone H3.3 [Source:NCBI gene;Acc:103046944])

HSP 1 Score: 273.092 bits (697), Expect = 2.223e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: ENSAMXT00000051731.1 (histone H3.3 [Source:NCBI gene;Acc:103046944])

HSP 1 Score: 273.092 bits (697), Expect = 2.223e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Cavefish
Match: si:dkey-23a13.21 (si:dkey-23a13.21 [Source:ZFIN;Acc:ZDB-GENE-160113-53])

HSP 1 Score: 247.284 bits (630), Expect = 5.848e-84
Identity = 126/137 (91.97%), Postives = 129/137 (94.16%), Query Frame = 3
Query:   78 MARTKQT-ARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQT  +     KAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    6 MARTKQTRPQVHRLAKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 142          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005970.1 (pep scaffold:Pmarinus_7.0:GL479001:12719:15748:1 gene:ENSPMAG00000005373.1 transcript:ENSPMAT00000005970.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.092 bits (697), Expect = 4.508e-95
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006727.1 (pep scaffold:Pmarinus_7.0:GL480101:14396:18168:1 gene:ENSPMAG00000006073.1 transcript:ENSPMAT00000006727.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.092 bits (697), Expect = 4.508e-95
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011162.1 (pep scaffold:Pmarinus_7.0:GL476820:703693:704103:-1 gene:ENSPMAG00000010135.1 transcript:ENSPMAT00000011162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.544 bits (680), Expect = 2.171e-92
Identity = 132/136 (97.06%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLV LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011073.1 (pep scaffold:Pmarinus_7.0:GL476925:255214:255624:-1 gene:ENSPMAG00000010047.1 transcript:ENSPMAT00000011073.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.544 bits (680), Expect = 2.171e-92
Identity = 132/136 (97.06%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLV LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011065.1 (pep scaffold:Pmarinus_7.0:GL476925:237524:237934:-1 gene:ENSPMAG00000010039.1 transcript:ENSPMAT00000011065.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 266.544 bits (680), Expect = 2.171e-92
Identity = 132/136 (97.06%), Postives = 134/136 (98.53%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLV LFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Yeast
Match: HHT1 (Histone H3; core histone protein required for chromatin assembly, part of heterochromatin-mediated telomeric and HM silencing; one of two identical histone H3 proteins (see HHT2); regulated by acetylation, methylation, and phosphorylation; H3K14 acetylation plays an important role in the unfolding of strongly positioned nucleosomes during repair of UV damage [Source:SGD;Acc:S000000214])

HSP 1 Score: 250.366 bits (638), Expect = 2.801e-86
Identity = 122/136 (89.71%), Postives = 131/136 (96.32%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLA+KAARKSAPSTGGVKKPHRY+PGTVALREIRR+QKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+GALQE+ EAYLV LFEDTNL AIHAKRVTI  KDI+LARR+RGER+
Sbjct:    1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS 136          
BLAST of Histone H3 vs. Ensembl Yeast
Match: HHT2 (Histone H3; core histone protein required for chromatin assembly, part of heterochromatin-mediated telomeric and HM silencing; one of two identical histone H3 proteins (see HHT1); regulated by acetylation, methylation, and phosphorylation; H3K14 acetylation plays an important role in the unfolding of strongly positioned nucleosomes during repair of UV damage [Source:SGD;Acc:S000004976])

HSP 1 Score: 250.366 bits (638), Expect = 2.801e-86
Identity = 122/136 (89.71%), Postives = 131/136 (96.32%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLA+KAARKSAPSTGGVKKPHRY+PGTVALREIRR+QKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+GALQE+ EAYLV LFEDTNL AIHAKRVTI  KDI+LARR+RGER+
Sbjct:    1 MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS 136          
BLAST of Histone H3 vs. Ensembl Yeast
Match: CSE4 (Histone H3-like centromere protein; associated with promoters, accessible chromatin, RNAPII-bound regions; phosphorylated Cse4p associates with centromeres; required for proper kinetochore function; levels regulated by E3 ubiquitin ligase Psh1p; phosphorylation may destabilize defective kinetochores to promote bi-orientation; ubiquitination of N-terminus regulates proteolysis for faithful chromosome segregation; yeast CSE4 can complement mutations in human homolog CENPA [Source:SGD;Acc:S000001532])

HSP 1 Score: 135.191 bits (339), Expect = 8.939e-40
Identity = 64/97 (65.98%), Postives = 79/97 (81.44%), Query Frame = 3
Query:  198 RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT---DLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE 479
            +Y P  +AL EIR+YQ+ST+LLI K+PF RLV+E+  +F T   DLR+QS A+ ALQEASEAYLVGL E TNL A+HAKR+TIM KD+QLARRIRG+
Sbjct:  131 KYTPSELALYEIRKYQRSTDLLISKIPFARLVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRIRGQ 227          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO31666 (Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7SX94])

HSP 1 Score: 271.937 bits (694), Expect = 3.191e-94
Identity = 134/136 (98.53%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO40554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S708])

HSP 1 Score: 272.707 bits (696), Expect = 2.010e-93
Identity = 149/205 (72.68%), Postives = 161/205 (78.54%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA-*VXXXXXXXXXICNKCS*C*SYLTVINII*CDFVNNIISMFRSFNAIFNEGLKYAYNFLK*KLVSNEI 689
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  V   ++    I +K       + ++N     FVN+I      F  I  E  + A+   K  + S EI
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERAHEVLKQVHHDTGISSKA------MGIMN----SFVNDI------FERIAGEASRLAHYNKKSTITSREI 189          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO27768 (Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1])

HSP 1 Score: 268.47 bits (685), Expect = 5.749e-93
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO26659 (Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1])

HSP 1 Score: 268.47 bits (685), Expect = 5.749e-93
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Nematostella
Match: EDO26704 (Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1])

HSP 1 Score: 268.47 bits (685), Expect = 5.749e-93
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: ENSORLT00000030026.1 (histone H3.3 [Source:NCBI gene;Acc:101175183])

HSP 1 Score: 273.092 bits (697), Expect = 2.209e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: ENSORLT00000046325.1 (pep primary_assembly:ASM223467v1:13:17992240:17994436:1 gene:ENSORLG00000028044.1 transcript:ENSORLT00000046325.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.092 bits (697), Expect = 2.209e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: ENSORLT00000029477.1 (pep primary_assembly:ASM223467v1:13:17996287:18000034:1 gene:ENSORLG00000024385.1 transcript:ENSORLT00000029477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.092 bits (697), Expect = 2.209e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: h3f3d (histone H3.3 [Source:NCBI gene;Acc:101163693])

HSP 1 Score: 273.092 bits (697), Expect = 2.209e-94
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Ensembl Medaka
Match: H3-3B (histone H3.3 [Source:NCBI gene;Acc:101160039])

HSP 1 Score: 272.707 bits (696), Expect = 4.140e-94
Identity = 135/138 (97.83%), Postives = 136/138 (98.55%), Query Frame = 3
Query:   72 IVMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
              MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAA+GALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    3 FAMARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 140          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000049109.1 (SMESG000049109.1)

HSP 1 Score: 273.863 bits (699), Expect = 8.934e-95
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000049112.1 (SMESG000049112.1)

HSP 1 Score: 271.937 bits (694), Expect = 5.326e-94
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR ERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRAERA 136          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000074937.1 (SMESG000074937.1)

HSP 1 Score: 269.626 bits (688), Expect = 4.362e-93
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000074574.1 (SMESG000074574.1)

HSP 1 Score: 269.626 bits (688), Expect = 4.362e-93
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
BLAST of Histone H3 vs. Planmine SMEST
Match: SMESG000074479.1 (SMESG000074479.1)

HSP 1 Score: 269.626 bits (688), Expect = 4.362e-93
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 3
Query:   78 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 485
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+AV ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136          
The following BLAST results are available for this feature:
BLAST of Histone H3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H3-3A4.122e-9499.26H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764][more]
H3-3A4.122e-9499.26H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764][more]
H3-3A4.122e-9499.26H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764][more]
H3-3A4.122e-9499.26H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764][more]
H3-3A4.122e-9499.26H3.3 histone A [Source:HGNC Symbol;Acc:HGNC:4764][more]
back to top
BLAST of Histone H3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
his-715.307e-9498.53Histone H3.3 type 1 [Source:UniProtKB/Swiss-Prot;... [more]
his-721.486e-9397.79Histone H3.3 type 2 [Source:UniProtKB/Swiss-Prot;... [more]
his-633.462e-9094.85Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P0889... [more]
his-593.462e-9094.85Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P0889... [more]
his-553.462e-9094.85Histone H3 [Source:UniProtKB/Swiss-Prot;Acc:P0889... [more]
back to top
BLAST of Histone H3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His3.3A1.975e-9499.26gene:FBgn0014857 transcript:FBtr0079010[more]
His3.3A1.975e-9499.26gene:FBgn0014857 transcript:FBtr0333537[more]
His3.3A1.975e-9499.26gene:FBgn0014857 transcript:FBtr0333536[more]
His3.3B1.975e-9499.26gene:FBgn0004828 transcript:FBtr0071347[more]
His3.3B1.975e-9499.26gene:FBgn0004828 transcript:FBtr0071345[more]
back to top
BLAST of Histone H3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
h3f3b.12.622e-9499.26H3 histone, family 3B.1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
h3f3c2.622e-9499.26H3 histone, family 3C [Source:ZFIN;Acc:ZDB-GENE-03... [more]
h3f3c2.622e-9499.26H3 histone, family 3C [Source:ZFIN;Acc:ZDB-GENE-03... [more]
h3f3b.12.622e-9499.26H3 histone, family 3B.1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
h3f3b.12.622e-9499.26H3 histone, family 3B.1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Histone H3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wfikkn13.737e-9499.26WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
snapc13.737e-9499.26small nuclear RNA activating complex polypeptide 1... [more]
polr3k3.737e-9499.26polymerase (RNA) III (DNA directed) polypeptide K,... [more]
lamtor22.648e-9297.79late endosomal/lysosomal adaptor, MAPK and MTOR ac... [more]
hist2h3c2.648e-9297.79histone H3 [Source:NCBI gene;Acc:100493100][more]
back to top
BLAST of Histone H3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H3f3a2.830e-9499.26H3.3 histone A [Source:MGI Symbol;Acc:MGI:1097686][more]
H3f3a2.830e-9499.26H3.3 histone A [Source:MGI Symbol;Acc:MGI:1097686][more]
H3f3b2.830e-9499.26H3.3 histone B [Source:MGI Symbol;Acc:MGI:1101768][more]
H3f3b2.830e-9499.26H3.3 histone B [Source:MGI Symbol;Acc:MGI:1101768][more]
H3c132.005e-9297.79H3 clustered histone 13 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Histone H3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P823|H33_XENTR1.980e-9399.26Histone H3.3 OS=Xenopus tropicalis OX=8364 GN=TGas... [more]
sp|Q6PI79|H33_XENLA1.980e-9399.26Histone H3.3 OS=Xenopus laevis OX=8355 PE=1 SV=3[more]
sp|P84248|H33_SPISO1.980e-9399.26Histone H3.3 OS=Spisula solidissima OX=6584 PE=2 S... [more]
sp|P84245|H33_RAT1.980e-9399.26Histone H3.3 OS=Rattus norvegicus OX=10116 GN=H3-3... [more]
sp|P84246|H33_RABIT1.980e-9399.26Histone H3.3 OS=Oryctolagus cuniculus OX=9986 GN=H... [more]
back to top
BLAST of Histone H3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1CLU52.414e-9397.86Histone H3 OS=Fasciola hepatica OX=6192 GN=D915_04... [more]
A0A4E0RCN45.648e-9397.86Histone H3 OS=Fasciola hepatica OX=6192 GN=D915_00... [more]
A0A3Q3K8E71.674e-9298.56Histone H3 OS=Monopterus albus OX=43700 PE=3 SV=1[more]
A0A3P8UG441.126e-9197.84Histone H3 OS=Amphiprion percula OX=161767 PE=3 SV... [more]
T2MEU01.370e-9196.40Histone H3 (Fragment) OS=Hydra vulgaris OX=6087 GN... [more]
back to top
BLAST of Histone H3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000056477.12.223e-9499.26histone H3.3 [Source:NCBI gene;Acc:103046944][more]
si:ch1073-429i10.32.223e-9499.26histone H3.3 [Source:NCBI gene;Acc:103046944][more]
h3f3d2.223e-9499.26histone H3.3 [Source:NCBI gene;Acc:103046944][more]
ENSAMXT00000051731.12.223e-9499.26histone H3.3 [Source:NCBI gene;Acc:103046944][more]
si:dkey-23a13.215.848e-8491.97si:dkey-23a13.21 [Source:ZFIN;Acc:ZDB-GENE-160113-... [more]
back to top
BLAST of Histone H3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005970.14.508e-9599.26pep scaffold:Pmarinus_7.0:GL479001:12719:15748:1 g... [more]
ENSPMAT00000006727.14.508e-9599.26pep scaffold:Pmarinus_7.0:GL480101:14396:18168:1 g... [more]
ENSPMAT00000011162.12.171e-9297.06pep scaffold:Pmarinus_7.0:GL476820:703693:704103:-... [more]
ENSPMAT00000011073.12.171e-9297.06pep scaffold:Pmarinus_7.0:GL476925:255214:255624:-... [more]
ENSPMAT00000011065.12.171e-9297.06pep scaffold:Pmarinus_7.0:GL476925:237524:237934:-... [more]
back to top
BLAST of Histone H3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HHT12.801e-8689.71Histone H3; core histone protein required for chro... [more]
HHT22.801e-8689.71Histone H3; core histone protein required for chro... [more]
CSE48.939e-4065.98Histone H3-like centromere protein; associated wit... [more]
back to top
BLAST of Histone H3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO316663.191e-9498.53Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7SX94][more]
EDO405542.010e-9372.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277685.749e-9397.79Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1][more]
EDO266595.749e-9397.79Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1][more]
EDO267045.749e-9397.79Histone H3 [Source:UniProtKB/TrEMBL;Acc:A7RJL1][more]
back to top
BLAST of Histone H3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000030026.12.209e-9499.26histone H3.3 [Source:NCBI gene;Acc:101175183][more]
ENSORLT00000046325.12.209e-9499.26pep primary_assembly:ASM223467v1:13:17992240:17994... [more]
ENSORLT00000029477.12.209e-9499.26pep primary_assembly:ASM223467v1:13:17996287:18000... [more]
h3f3d2.209e-9499.26histone H3.3 [Source:NCBI gene;Acc:101163693][more]
H3-3B4.140e-9497.83histone H3.3 [Source:NCBI gene;Acc:101160039][more]
back to top
BLAST of Histone H3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049109.18.934e-95100.00SMESG000049109.1[more]
SMESG000049112.15.326e-9499.26SMESG000049112.1[more]
SMESG000074937.14.362e-9397.79SMESG000074937.1[more]
SMESG000074574.14.362e-9397.79SMESG000074574.1[more]
SMESG000074479.14.362e-9397.79SMESG000074479.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000270 ID=SMED30000270|Name=Histone H3|organism=Schmidtea mediterranea sexual|type=transcript|length=712bp
TGTTTTTGTTTTAATAGACAATAAATTTATCTTTGTTTACATAATTATCT
TAAACATTTAGCCTAATTAATATTGTAATGGCACGTACAAAACAGACAGC
AAGAAAATCAACTGGTGGAAAAGCTCCACGTAAACAATTGGCTACCAAAG
CCGCAAGAAAATCCGCACCATCAACCGGAGGTGTCAAGAAACCACATAGA
TATCGTCCTGGAACTGTTGCTCTTAGAGAAATTAGAAGATATCAAAAGAG
CACAGAATTACTCATTAGAAAACTTCCATTCCAGCGATTAGTTCGTGAAA
TCGCTCAAGATTTCAAAACTGATCTGCGATTTCAAAGTGCCGCAGTTGGA
GCACTGCAAGAAGCTAGCGAAGCATATTTGGTTGGATTATTCGAAGACAC
CAATCTCTGTGCCATTCATGCAAAGCGAGTAACTATCATGCCAAAAGACA
TTCAATTGGCAAGAAGAATTCGTGGTGAAAGAGCATAAGTTAACTTATTT
TTGAACTTATAGTAGAATATTTGTAATAAATGTAGTTAATGTTGATCATA
TTTAACTGTTATTAATATAATTTAATGTGACTTTGTTAATAATATTATTT
CTATGTTTAGAAGTTTTAATGCAATTTTCAATGAAGGGTTGAAGTATGCT
TATAATTTCTTGAAATAAAAGCTAGTCAGCAATGAAATTTGTTTTAATAA
ATTGTTTGTCGC
back to top

protein sequence of SMED30000270-orf-1

>SMED30000270-orf-1 ID=SMED30000270-orf-1|Name=SMED30000270-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=137bp
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALR
EIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAVGALQEASEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002020chromatoid body
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000164Histone_H3/CENP-A
IPR009072Histone-fold
IPR007125Histone_H2A/H2B/H3
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0005694chromosome
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000164Histone H3/CENP-APRINTSPR00622HISTONEH3coord: 34..55
score: 93.58
coord: 114..135
score: 94.86
coord: 98..114
score: 96.93
coord: 3..17
score: 97.1
coord: 17..31
score: 92.32
coord: 58..75
score: 97.46
coord: 80..98
score: 84.1
IPR000164Histone H3/CENP-ASMARTSM00428h35coord: 34..136
e-value: 9.5E-74
score: 261.0
IPR000164Histone H3/CENP-APANTHERPTHR11426HISTONE H3coord: 1..136
IPR000164Histone H3/CENP-APROSITEPS00959HISTONE_H3_2coord: 67..75
IPR000164Histone H3/CENP-APROSITEPS00322HISTONE_H3_1coord: 15..21
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 1..132
e-value: 8.3E-54
score: 181.5
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 2..136
e-value: 2.9E-79
score: 265.6
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 2..133
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..43
NoneNo IPR availablePANTHERPTHR11426:SF224coord: 1..136