Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30000261
Length (bp)1793
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30000261) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30000261) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30000261) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30000261) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000261

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30000261SMESG000044415.1 dd_Smed_v4_8619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30000261SMESG000044415.1 dd_Smed_v4_8619_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRFN4 (leucine rich repeat and fibronectin type III domain containing 4 [Source:HGNC Symbol;Acc:HGNC:28456])

HSP 1 Score: 84.3445 bits (207), Expect = 1.068e-16
Identity = 96/369 (26.02%), Postives = 162/369 (43.90%), Query Frame = 3
Query:  168 CPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPV---NMTGIIT-TLK-----------------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKL----SLKVLSIKNSRLSILDYSVFMQL-DISRFQFFYLTNNNFRTI--------DRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSH--DESSLKKSEKIASIKINKSNSGE-NVYRCVAENKIGQSYIVVNL 1145
            CP  C VC  L+++L  +C + G    P      T  + L  ++  +  L P    NMTG++  TL                  LR L + G  + +L   +  G  +L+ L LS NQ+  I   AF+   +++L+  D+    L +  ++ +    +L  L++ ++ +  L    F QL  +SR     LT+N   T+         R+ E+    L ++  +G+PL CNC LLWL+RLA   +  +       C SP  L  +    + E EF CEPP I+    ++  L    A L C+A      T    + W+  +      SS  ++    +++I  + +G+   Y C+A N  G++   V L
Sbjct:   17 CPLPC-VCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQA--LGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPVNLQHLILSGNQLGRIAPGAFDDF-LESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNLIDALPPGAFAQLGQLSRLD---LTSNRLATLAPDPLFSRGRDAEASPAPL-VLSFSGNPLHCNCELLWLRRLARPDDLET-------CASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATLRCRALGDPAPT----MHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNPAGEATARVEL 366          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRFN4 (leucine rich repeat and fibronectin type III domain containing 4 [Source:HGNC Symbol;Acc:HGNC:28456])

HSP 1 Score: 84.7297 bits (208), Expect = 1.642e-16
Identity = 96/369 (26.02%), Postives = 161/369 (43.63%), Query Frame = 3
Query:  168 CPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPV---NMTGIIT-TLK-----------------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKL----SLKVLSIKNSRLSILDYSVFMQLD-ISRFQFFYLTNNNFRTI--------DRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSH--DESSLKKSEKIASIKINKSNSGE-NVYRCVAENKIGQSYIVVNL 1145
            CP  C VC  L+++L  +C + G    P      T  + L  ++  +  L P    NMTG++  TL                  LR L + G  + +L   +  G  +L+ L LS NQ+  I   AF+   +++L+  D+    L +  ++ +    +L  L++ ++ +  L    F QL  +SR     LT+N   T+         R+ E+    L ++  +G+PL CNC LLWL+RLA   +          C SP  L  +    + E EF CEPP I+    ++  L    A L C+A      T    + W+  +      SS  ++    +++I  + +G+   Y C+A N  G++   V L
Sbjct:   17 CPLPC-VCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQA--LGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPVNLQHLILSGNQLGRIAPGAFDDF-LESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNLIDALPPGAFAQLGQLSRLD---LTSNRLATLAPDPLFSRGRDAEASPAPL-VLSFSGNPLHCNCELLWLRRLARPDD-------LETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATLRCRALGDPAPT----MHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNPAGEATARVEL 366          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRFN2 (leucine rich repeat and fibronectin type III domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21226])

HSP 1 Score: 76.2554 bits (186), Expect = 8.919e-14
Identity = 82/306 (26.80%), Postives = 131/306 (42.81%), Query Frame = 3
Query:  156 VYNECPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHY-------------------FTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEH--LTIDTLKLNDIGKLKLHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTID------RNFESIIRNLKL-----IDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKA 956
            V + CPK C VC  L+++L  +C + G    P      T  + L G++                    + NT+S +     +    LR L +    +  L  +T  GL +L+ L ++ NQ+  I D AFE   LT++ L L+      L  +S  ++ +L  LS+ ++ L  +    F   D+ +     LT+N  + +       R+  S +              G+PL CNC LLWL+RL    +  +       C SP  L+ +    + E EF CEPP I++   K+  L    A L CKA
Sbjct:   17 VVDACPKYC-VCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLGGNFIIHISRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTLRGLVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSLDHNLLDHIAEGTFA--DLQKLARLDLTSNRLQKLPPDPIFARSQASALTATPFAPPLSFSFGGNPLHCNCELLWLRRLERDDDLET-------CGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLVLEGQAATLKCKA 312          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4B (leucine rich repeat containing 4B [Source:HGNC Symbol;Acc:HGNC:25042])

HSP 1 Score: 74.7146 bits (182), Expect = 2.203e-13
Identity = 66/252 (26.19%), Postives = 113/252 (44.84%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAFE------HLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ +    F+ +  LR LDL E + L  I + AFE      +L +    L DI  L                  +   SF  L SL+ L + +++++ ++ + F   D+   +   L++NN  ++  +  + +  L+ + L  +P  CNC +LWL   L  T+ SN+      +C +P  L+ + + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  159 KLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFD--DLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNT--TCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWLTPNG 401          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4B (leucine rich repeat containing 4B [Source:HGNC Symbol;Acc:HGNC:25042])

HSP 1 Score: 74.7146 bits (182), Expect = 2.203e-13
Identity = 66/252 (26.19%), Postives = 113/252 (44.84%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAFE------HLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ +    F+ +  LR LDL E + L  I + AFE      +L +    L DI  L                  +   SF  L SL+ L + +++++ ++ + F   D+   +   L++NN  ++  +  + +  L+ + L  +P  CNC +LWL   L  T+ SN+      +C +P  L+ + + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  159 KLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFD--DLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNT--TCCARCHAPAGLKGRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWLTPNG 401          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: pxn-2 (PeroXidasiN (Drosophila peroxidase) homolog [Source:UniProtKB/TrEMBL;Acc:G5EG78])

HSP 1 Score: 68.9366 bits (167), Expect = 7.007e-12
Identity = 60/250 (24.00%), Postives = 108/250 (43.20%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNF--ESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVF--PKCVSPTNLRSKMLSEIDETEFKCEPPRISE 905
            CP  C  C    + CE    T  P      T N+     YF++N L+ ++ +       L+YL +   SI+D+          L+ LDLS N+I  +           +   N +  L L  N  S+L   ++S          +S +MQ        F +  N  +++  +F    ++  LK + +AG+P  C+C ++ +K+ A ++ ++S + +F   KC  P  LR+ +   +     +CE P  S+
Sbjct:   17 CPSECR-CAGLDVHCEGKNLTAIPGHIPIATTNL-----YFSNNLLNSLSKSNFQALPNLQYLDLSNNSIRDIEETLLDSFPGLKYLDLSWNKIRYVPKL--------STAPNALVSLNLVHNEISRLDNDLVS----------HSPYMQT-------FLIQRNRIQSLPHDFFNSRMVPTLKTVKMAGNPWSCDCRMVNVKQFADSLFAHSNQNIFIVGKCFFPKGLRNYVFRNLSIENLECEKPEYSK 235          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: pan-1 (P-granule-associated novel protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3A0])

HSP 1 Score: 61.2326 bits (147), Expect = 1.399e-9
Identity = 52/167 (31.14%), Postives = 87/167 (52.10%), Query Frame = 3
Query:  300 TLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHL-TIDTLKLNDIGKLKLHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSN 794
            TL P +   +  + +L  L++R   I+ L +  F+GLK L+ LDL+ N+I  I   AFE L  ++ L LN+     L   +F  + +LK L+++N  L I+    F  L+    +   L+NNN   ID    S ++NL+++DL GS  + N  +    +L   + +N
Sbjct:  116 TLQPNSFQSLGGSAEL--LSLRENRIKKLEKGLFTGLKSLKTLDLAMNKIQEIDVGAFEELKKVEELLLNENDIRVLKTGTFDGMKNLKKLTLQNCNLEIIQKGAFRGLN--SLEQLILSNNNLENIDWTIFSALKNLRVLDL-GSNKISNVEMKSFPKLEKLVLNN 277          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 53.1434 bits (126), Expect = 6.430e-7
Identity = 60/256 (23.44%), Postives = 97/256 (37.89%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNS--------------RLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKR--LASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCE 887
            CP  C+ C   T+ C + G T  PT     T  I L  +  +S                             +  ++F  LK+L  LDLS+N I  I   AF       L L+++  L L+ N+ + L         S              R    D+       + +     L +N+ ++I       + +L  + LA +PL+C+C+L WL +  L   I ++  R     C  P  LR K  + +   +FKC+
Sbjct:  260 CPLPCT-CTGTTVDCRDSGLTYVPTNLPPSTTEIRLEQNQISS-----------------------------IPSHSFKNLKNLTRLDLSKNIITEIQPKAF-------LGLHNLHTLVLYGNNITDLKSDTFEGLGSLQLLLLNANQLTCIRRGTFDH-------VPKLSMLSLYDNDIKSISEVTFQNLTSLSTLHLAKNPLICDCNLQWLAQINLQKNIETSGAR-----CEQPKRLRKKKFATLPPNKFKCK 466          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330734)

HSP 1 Score: 90.1225 bits (222), Expect = 2.865e-18
Identity = 67/251 (26.69%), Postives = 117/251 (46.61%), Query Frame = 3
Query:  141 SAVGYVYN-ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNI-HDFAFEHLTIDTLKLNDIGKLKLHRNSF-SKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
              VG +    CP++CS C    + C + G T  P K  ++ E + L G     N L+ +  T      KLR L +    I  + RN+F  L  L  L L+ N++  I  +F     ++  L +++     + R  F    SL+ L + N++++ LD   F  L     +   L NNN  ++  N    +  L+ + L+ +P  C+C L WL R    + S +    + +C SP+ L+ + ++++ + EFKC
Sbjct:   63 GGVGVITEARCPRVCS-CTGLNVDCSHRGLTSVPRKISADVERLELQG-----NNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGL--VELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRF---LRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 54.6842 bits (130), Expect = 2.729e-7
Identity = 53/196 (27.04%), Postives = 85/196 (43.37%), Query Frame = 3
Query:  309 PVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNI-HDF--AFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNS-RLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            PV +    T L+L    I      +L   +FS  + LR +DLS N I  I HD     + LT   L  N I  L      F  L    L + N+  +S +    F  L        Y  +NN +++       ++++K + LA +P +C+C+L W   LA  ++ N       +C SP  +  + +  + E +FKC
Sbjct:  341 PVTLPDDTTELRLEQNFI-----TELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLP--SGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLY--DNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRW---LADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKC 524          

HSP 3 Score: 52.373 bits (124), Expect = 1.356e-6
Identity = 57/241 (23.65%), Postives = 92/241 (38.17%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLK-LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            CP  C+ C    + C      E P    +ET  +     Y  SN +            ++ Y  IR              L+ L  LDLS NQI  + ++ F +LT  +  +    KL+ L R++ S L +L+VLS+  +R+S+L    F  L                          ++L  I L  +PL C+C L W    +  I  +       +C  P  ++ K++     + F C
Sbjct:  739 CPPSCT-CTGTVVRCSRNQLKEIPRGIPAETSEL-----YLESNEIE-----------QIHYERIRH-------------LRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDL--------------------------KSLTHIALGSNPLYCDCGLKW---FSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 920          

HSP 4 Score: 52.373 bits (124), Expect = 1.427e-6
Identity = 54/242 (22.31%), Postives = 92/242 (38.02%), Query Frame = 3
Query:  162 NECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLK-LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            ++CP +C  C   T+ C   G  E P      T  + L       N L  ++  G+   L  L  L ++   +  +  N F G   ++ L L EN+I  I +  F               L LH+       LK L++ ++++S +    F  L+                          +L  ++LA +P  CNC L W    A  +   S      +C +P+ +R   + ++  +EFKC
Sbjct:  541 SDCPAMCH-CEGTTVDCTGRGLKEIPRDIPLHTTELLL-----NDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMF---------------LGLHQ-------LKTLNLYDNQISCVMPGSFEHLN--------------------------SLTSLNLASNPFNCNCHLAW---FAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKC 725          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330733)

HSP 1 Score: 89.3521 bits (220), Expect = 5.155e-18
Identity = 67/251 (26.69%), Postives = 117/251 (46.61%), Query Frame = 3
Query:  141 SAVGYVYN-ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNI-HDFAFEHLTIDTLKLNDIGKLKLHRNSF-SKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
              VG +    CP++CS C    + C + G T  P K  ++ E + L G     N L+ +  T      KLR L +    I  + RN+F  L  L  L L+ N++  I  +F     ++  L +++     + R  F    SL+ L + N++++ LD   F  L     +   L NNN  ++  N    +  L+ + L+ +P  C+C L WL R    + S +    + +C SP+ L+ + ++++ + EFKC
Sbjct:   63 GGVGVITEARCPRVCS-CTGLNVDCSHRGLTSVPRKISADVERLELQG-----NNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGL--VELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRF---LRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 54.299 bits (129), Expect = 3.306e-7
Identity = 48/174 (27.59%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  375 IQDLLRNTFSGLKDLRILDLSENQILNI-HDF--AFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNS-RLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            I +L   +FS  + LR +DLS N I  I HD     + LT   L  N I  L      F  L    L + N+  +S +    F  L        Y  +NN +++       ++++K + LA +P +C+C+L W   LA  ++ N       +C SP  +  + +  + E +FKC
Sbjct:  358 ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLP--SGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLY--DNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRW---LADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKC 524          

HSP 3 Score: 51.6026 bits (122), Expect = 2.356e-6
Identity = 57/241 (23.65%), Postives = 92/241 (38.17%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLK-LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            CP  C+ C    + C      E P    +ET  +     Y  SN +            ++ Y  IR              L+ L  LDLS NQI  + ++ F +LT  +  +    KL+ L R++ S L +L+VLS+  +R+S+L    F  L                          ++L  I L  +PL C+C L W    +  I  +       +C  P  ++ K++     + F C
Sbjct:  739 CPPSCT-CTGTVVRCSRNQLKEIPRGIPAETSEL-----YLESNEIE-----------QIHYERIRH-------------LRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDL--------------------------KSLTHIALGSNPLYCDCGLKW---FSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 920          

HSP 4 Score: 51.2174 bits (121), Expect = 2.678e-6
Identity = 54/241 (22.41%), Postives = 91/241 (37.76%), Query Frame = 3
Query:  165 ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLK-LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            +CP +C  C   T+ C   G  E P      T  + L       N L  ++  G+   L  L  L ++   +  +  N F G   ++ L L EN+I  I +  F               L LH+       LK L++ ++++S +    F  L+                          +L  ++LA +P  CNC L W    A  +   S      +C +P+ +R   + ++  +EFKC
Sbjct:  542 DCPAMCH-CEGTTVDCTGRGLKEIPRDIPLHTTELLL-----NDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMF---------------LGLHQ-------LKTLNLYDNQISCVMPGSFEHLN--------------------------SLTSLNLASNPFNCNCHLAW---FAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKC 725          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330731)

HSP 1 Score: 89.3521 bits (220), Expect = 5.155e-18
Identity = 67/251 (26.69%), Postives = 117/251 (46.61%), Query Frame = 3
Query:  141 SAVGYVYN-ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNI-HDFAFEHLTIDTLKLNDIGKLKLHRNSF-SKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
              VG +    CP++CS C    + C + G T  P K  ++ E + L G     N L+ +  T      KLR L +    I  + RN+F  L  L  L L+ N++  I  +F     ++  L +++     + R  F    SL+ L + N++++ LD   F  L     +   L NNN  ++  N    +  L+ + L+ +P  C+C L WL R    + S +    + +C SP+ L+ + ++++ + EFKC
Sbjct:   63 GGVGVITEARCPRVCS-CTGLNVDCSHRGLTSVPRKISADVERLELQG-----NNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGL--VELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRF---LRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 54.299 bits (129), Expect = 3.306e-7
Identity = 48/174 (27.59%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  375 IQDLLRNTFSGLKDLRILDLSENQILNI-HDF--AFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNS-RLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            I +L   +FS  + LR +DLS N I  I HD     + LT   L  N I  L      F  L    L + N+  +S +    F  L        Y  +NN +++       ++++K + LA +P +C+C+L W   LA  ++ N       +C SP  +  + +  + E +FKC
Sbjct:  358 ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLP--SGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLY--DNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRW---LADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKC 524          

HSP 3 Score: 51.6026 bits (122), Expect = 2.356e-6
Identity = 57/241 (23.65%), Postives = 92/241 (38.17%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLK-LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            CP  C+ C    + C      E P    +ET  +     Y  SN +            ++ Y  IR              L+ L  LDLS NQI  + ++ F +LT  +  +    KL+ L R++ S L +L+VLS+  +R+S+L    F  L                          ++L  I L  +PL C+C L W    +  I  +       +C  P  ++ K++     + F C
Sbjct:  739 CPPSCT-CTGTVVRCSRNQLKEIPRGIPAETSEL-----YLESNEIE-----------QIHYERIRH-------------LRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDL--------------------------KSLTHIALGSNPLYCDCGLKW---FSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 920          

HSP 4 Score: 51.2174 bits (121), Expect = 2.678e-6
Identity = 54/241 (22.41%), Postives = 91/241 (37.76%), Query Frame = 3
Query:  165 ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLK-LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            +CP +C  C   T+ C   G  E P      T  + L       N L  ++  G+   L  L  L ++   +  +  N F G   ++ L L EN+I  I +  F               L LH+       LK L++ ++++S +    F  L+                          +L  ++LA +P  CNC L W    A  +   S      +C +P+ +R   + ++  +EFKC
Sbjct:  542 DCPAMCH-CEGTTVDCTGRGLKEIPRDIPLHTTELLL-----NDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMF---------------LGLHQ-------LKTLNLYDNQISCVMPGSFEHLN--------------------------SLTSLNLASNPFNCNCHLAW---FAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKC 725          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330729)

HSP 1 Score: 88.9669 bits (219), Expect = 5.643e-18
Identity = 65/249 (26.10%), Postives = 108/249 (43.37%), Query Frame = 3
Query:  141 SAVGYVYN-ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
              VG +    CP++CS C    + C + G T  P K  ++ E + L G     N L+ +  T      KLR L +    I  + RN+F  L  L  LD+S N I  +    F+                         SL+ L + N++++ LD   F  L     +   L NNN  ++  N    +  L+ + L+ +P  C+C L WL R    + S +    + +C SP+ L+ + ++++ + EFKC
Sbjct:   63 GGVGVITEARCPRVCS-CTGLNVDCSHRGLTSVPRKISADVERLELQG-----NNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFK----------------------GAQSLRSLQLDNNQITCLDEHAFKGL--VELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRF---LRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 54.299 bits (129), Expect = 3.027e-7
Identity = 48/174 (27.59%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  375 IQDLLRNTFSGLKDLRILDLSENQILNI-HDF--AFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNS-RLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            I +L   +FS  + LR +DLS N I  I HD     + LT   L  N I  L      F  L    L + N+  +S +    F  L        Y  +NN +++       ++++K + LA +P +C+C+L W   LA  ++ N       +C SP  +  + +  + E +FKC
Sbjct:  334 ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLP--SGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLY--DNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRW---LADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKC 500          

HSP 3 Score: 51.6026 bits (122), Expect = 2.016e-6
Identity = 57/241 (23.65%), Postives = 92/241 (38.17%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLK-LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            CP  C+ C    + C      E P    +ET  +     Y  SN +            ++ Y  IR              L+ L  LDLS NQI  + ++ F +LT  +  +    KL+ L R++ S L +L+VLS+  +R+S+L    F  L                          ++L  I L  +PL C+C L W    +  I  +       +C  P  ++ K++     + F C
Sbjct:  715 CPPSCT-CTGTVVRCSRNQLKEIPRGIPAETSEL-----YLESNEIE-----------QIHYERIRH-------------LRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDL--------------------------KSLTHIALGSNPLYCDCGLKW---FSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 896          

HSP 4 Score: 51.6026 bits (122), Expect = 2.538e-6
Identity = 54/241 (22.41%), Postives = 91/241 (37.76%), Query Frame = 3
Query:  165 ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLK-LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            +CP +C  C   T+ C   G  E P      T  + L       N L  ++  G+   L  L  L ++   +  +  N F G   ++ L L EN+I  I +  F               L LH+       LK L++ ++++S +    F  L+                          +L  ++LA +P  CNC L W    A  +   S      +C +P+ +R   + ++  +EFKC
Sbjct:  518 DCPAMCH-CEGTTVDCTGRGLKEIPRDIPLHTTELLL-----NDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMF---------------LGLHQ-------LKTLNLYDNQISCVMPGSFEHLN--------------------------SLTSLNLASNPFNCNCHLAW---FAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKC 701          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330732)

HSP 1 Score: 88.9669 bits (219), Expect = 5.643e-18
Identity = 65/249 (26.10%), Postives = 108/249 (43.37%), Query Frame = 3
Query:  141 SAVGYVYN-ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
              VG +    CP++CS C    + C + G T  P K  ++ E + L G     N L+ +  T      KLR L +    I  + RN+F  L  L  LD+S N I  +    F+                         SL+ L + N++++ LD   F  L     +   L NNN  ++  N    +  L+ + L+ +P  C+C L WL R    + S +    + +C SP+ L+ + ++++ + EFKC
Sbjct:   63 GGVGVITEARCPRVCS-CTGLNVDCSHRGLTSVPRKISADVERLELQG-----NNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFK----------------------GAQSLRSLQLDNNQITCLDEHAFKGL--VELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRF---LRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 54.299 bits (129), Expect = 3.027e-7
Identity = 48/174 (27.59%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  375 IQDLLRNTFSGLKDLRILDLSENQILNI-HDF--AFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNS-RLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            I +L   +FS  + LR +DLS N I  I HD     + LT   L  N I  L      F  L    L + N+  +S +    F  L        Y  +NN +++       ++++K + LA +P +C+C+L W   LA  ++ N       +C SP  +  + +  + E +FKC
Sbjct:  334 ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLP--SGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLY--DNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRW---LADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKC 500          

HSP 3 Score: 51.6026 bits (122), Expect = 2.016e-6
Identity = 57/241 (23.65%), Postives = 92/241 (38.17%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLK-LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            CP  C+ C    + C      E P    +ET  +     Y  SN +            ++ Y  IR              L+ L  LDLS NQI  + ++ F +LT  +  +    KL+ L R++ S L +L+VLS+  +R+S+L    F  L                          ++L  I L  +PL C+C L W    +  I  +       +C  P  ++ K++     + F C
Sbjct:  715 CPPSCT-CTGTVVRCSRNQLKEIPRGIPAETSEL-----YLESNEIE-----------QIHYERIRH-------------LRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDL--------------------------KSLTHIALGSNPLYCDCGLKW---FSDWIKLDYVEPGIARCAEPEQMKDKLILSTPSSSFVC 896          

HSP 4 Score: 51.6026 bits (122), Expect = 2.538e-6
Identity = 54/241 (22.41%), Postives = 91/241 (37.76%), Query Frame = 3
Query:  165 ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLK-LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            +CP +C  C   T+ C   G  E P      T  + L       N L  ++  G+   L  L  L ++   +  +  N F G   ++ L L EN+I  I +  F               L LH+       LK L++ ++++S +    F  L+                          +L  ++LA +P  CNC L W    A  +   S      +C +P+ +R   + ++  +EFKC
Sbjct:  518 DCPAMCH-CEGTTVDCTGRGLKEIPRDIPLHTTELLL-----NDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMF---------------LGLHQ-------LKTLNLYDNQISCVMPGSFEHLN--------------------------SLTSLNLASNPFNCNCHLAW---FAEWLRKKSLNGGAARCGAPSKVRDVQIKDLPHSEFKC 701          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 80.1073 bits (196), Expect = 3.259e-15
Identity = 70/252 (27.78%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAF------EHLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ L    F  +  LR LDL E + L+ I D AF       +L +    L DI  L                  +   SF  L SL+ L + +S++S+++ + F   D+   +   L++N+  ++  +  + ++ L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  142 KLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFD--DLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWITPNG 384          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 79.337 bits (194), Expect = 4.631e-15
Identity = 70/252 (27.78%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAF------EHLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ L    F  +  LR LDL E + L+ I D AF       +L +    L DI  L                  +   SF  L SL+ L + +S++S+++ + F   D+   +   L++N+  ++  +  + ++ L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  142 KLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFD--DLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWITPNG 384          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 79.337 bits (194), Expect = 5.143e-15
Identity = 70/252 (27.78%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAF------EHLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ L    F  +  LR LDL E + L+ I D AF       +L +    L DI  L                  +   SF  L SL+ L + +S++S+++ + F   D+   +   L++N+  ++  +  + ++ L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  149 KLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFD--DLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWITPNG 391          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 79.337 bits (194), Expect = 5.143e-15
Identity = 70/252 (27.78%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAF------EHLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ L    F  +  LR LDL E + L+ I D AF       +L +    L DI  L                  +   SF  L SL+ L + +S++S+++ + F   D+   +   L++N+  ++  +  + ++ L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  149 KLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFD--DLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWITPNG 391          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 79.337 bits (194), Expect = 5.272e-15
Identity = 70/252 (27.78%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAF------EHLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ L    F  +  LR LDL E + L+ I D AF       +L +    L DI  L                  +   SF  L SL+ L + +S++S+++ + F   D+   +   L++N+  ++  +  + ++ L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  142 KLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFD--DLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWITPNG 384          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: rrn3 (RRN3 homolog, RNA polymerase I transcription factor [Source:Xenbase;Acc:XB-GENE-990491])

HSP 1 Score: 78.5666 bits (192), Expect = 1.679e-14
Identity = 80/319 (25.08%), Postives = 135/319 (42.32%), Query Frame = 3
Query:  144 AVGYVYNECPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTS-NTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAF------EHLTIDTLKLNDIGKLKLHRNSFSKL--SLKVLSIKNSRLSILDYSV------FMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKL---------------------------IDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEI--KINFLNHFTAELFCKA 956
             +  + N CPK C VC  L+++L  +C   G    P      T  + L G++  S N     NMTG++       L +   +I  +   +F  L+ LR L L  N++ N+ D  F      +HL ++  +LN I +     ++F  L  +L+ L +  + L  + +          QL +     +Y+T   F+ +++     + + +L                           +   G+PL CNC LLWL+RL    +  +       C SP+ L+ +    + E EF CEPP I++   ++  L   TA L CKA
Sbjct:   12 GMAVMVNSCPKYC-VCQNLSESLGTLCPTKGLLFVPMDIDRRTVELRLGGNFIISINRQDFANMTGLVD------LTLSRNTISYIQPYSFIDLESLRSLHLDSNRLTNLGDDVFRGLINLQHLIMNNNQLNSIAE-----DAFEDLLQTLEDLDLSYNNLKTVPWDAVRRMVNLHQLSLDHNLIYYITEGTFQDLNKLARLDLTSNRLQKLPPDPIFARSQISMTSATPFSPPLSLSFGGNPLHCNCELLWLRRLDREDDMET-------CASPSALKGRYFWYVREEEFVCEPPLITQYTQRLLVLEGQTASLKCKA 311          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: oaz1 (ornithine decarboxylase antizyme 1 [Source:Xenbase;Acc:XB-GENE-490737])

HSP 1 Score: 75.8702 bits (185), Expect = 1.052e-13
Identity = 90/376 (23.94%), Postives = 151/376 (40.16%), Query Frame = 3
Query:  168 CPKICS---VCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTS-------------------NTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGK---LKLHRNSFSKLS-LKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTI--DRNFESIIRNLK---------LIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNN-----------SHDESSLKKSEKIASIKINKSNSGENVYRCVAENKIGQSYIVVNL 1145
            CPK CS   V  + T++C   G    P      T  + L+ ++ T+                   NT+S +     +    L  L +    +  +      GL +LR L LS NQ+  I   +F+   +DTL+  D+     + +   +  +LS +  + + ++ +  +   +F  L   +     +T+N  + I  D  F  I    K         ++   G+PL CNC L+WL+RL    +          C SP  L  K    I E EF CEPP I+    K+  +   +A L C    KS+     +V W++ +           S+D  +L   + I +I  ++ N     + C+A N  G+S   V L
Sbjct:   20 CPKRCSCQNVSPSITILCTKTGLLFVPPTIDRRTAELRLMDNFITTLRRRDFANMTDLIHLTLSRNTISQIMPYAFVDLKGLHALHLDSNRLTSVSEEHLRGLINLRHLILSNNQLHYIAPGSFDDF-VDTLEDLDLSYNNLVDIPWETIGRLSSVNTVGLDHNLIDYVPEGIFSNL--HKLARLDMTSNKLKKIPPDPLFSRIPVYAKSKGSPLTSLVLSFGGNPLHCNCELMWLRRLTREDD-------LETCASPAELMGKYFWSIKEEEFVCEPPMITHRTSKLVIMEGQSASLKC----KSVGDPDPYVRWISPDGKLVSNTSRTMSYDNGTL---DIITTIYADRGN-----FTCIASNAAGESTANVEL 373          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lrrc4b (leucine rich repeat containing 4B [Source:NCBI gene;Acc:100124949])

HSP 1 Score: 75.0998 bits (183), Expect = 1.404e-13
Identity = 69/252 (27.38%), Postives = 117/252 (46.43%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAFE------HLTIDTLKLNDI----------------GKLKLHR-NSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ +    F+ +  LR LDL E + L  I + AFE      +L +    L DI                 +L++ R  SF  L SL+ L + ++ ++I++ + F   D+   +   L++NN  ++  +  + +  L+ + L  +P  CNC +LWL   L  T+ +N+      +C SP NL+ + + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  144 KLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKKLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNRLEMIRPGSFQGLTSLRKLWLMHAHVTIIERNAFD--DLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPNNT--TCCARCHSPPNLKMRYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWLTPNG 386          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 73.9442 bits (180), Expect = 4.917e-13
Identity = 65/253 (25.69%), Postives = 110/253 (43.48%), Query Frame = 3
Query:  162 NECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEH-LTIDTLKLNDIGKLKLHRNSFSKLS-LKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK---RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC----EPP 893
            N CP +C+ C   T+ C        P      TE + L G     N ++ +N        +LR L +    I ++ R  F  +K+L  L L+ NQ+  + +  F++   +  L L++     + R +F   + LK L +  +++S ++   F  L     +   L NNN   I  +  + +  L+   L  + L C+C L WL    R   TI       +F +C  P+ LR   ++EI + EF C    +PP
Sbjct:   32 NGCPALCT-CSGTTVDCHGLALKGVPKNIPRSTERLELYG-----NNITRINKNDFSGLKQLRVLQLMENQISNVERGAFDDMKELERLRLNRNQLHTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQISCIEDGAFRAL--RGLEVLTLNNNNITAIPVSSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTIG------LFTQCTGPSPLRGLNVAEIQKHEFSCSGQSDPP 270          

HSP 2 Score: 64.6994 bits (156), Expect = 4.320e-10
Identity = 65/254 (25.59%), Postives = 101/254 (39.76%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFE--------HLTIDTLKLNDIGKLKLHRNSFSKLS-LKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWL-----KRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCE 887
            CP  C  C +  + C N   T+ P +    T  + L      +N ++ +  TG+                       F  L  L+ ++LS N+I  I D AFE        HLT + L+        +    F  L  L+ L ++N+R+S +    F  L   R    Y  +N   TI       +++L  ++L  +P  CNC L WL     KR   T N        P+C +P  LR   L ++   +F+CE
Sbjct:  509 CPPKCR-CESNVVDCSNLKLTKIPDRIPQSTAELRL-----NNNEIATLEATGL-----------------------FRKLPHLKKINLSNNKISEIEDAAFEGAASVSELHLTANHLE-------SVRSGMFRGLEGLRTLMLRNNRVSCVHNDSFTGLRNVRLLSLY--DNQISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGN--------PRCQNPDFLRQIPLQDVAFPDFRCE 716          

HSP 3 Score: 64.3142 bits (155), Expect = 4.666e-10
Identity = 50/204 (24.51%), Postives = 89/204 (43.63%), Query Frame = 3
Query:  300 TLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLS---------IKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            T  P N+   +T ++L    I+           FS  K LR +DLS NQI  I   AF+        L  +  L L+ N  + L   V S         +  ++++ +    F   D+       L +N  +++ +   + +R ++ + LA +P +C+C+L W   LA  + +N       +C SP  L +K + +I   +F+C
Sbjct:  301 TAIPANLPETMTEIRLELNGIKSVP-----PGAFSPYKKLRRIDLSNNQISEIAPDAFQ-------GLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKINCIRADTFQ--DLQNLSLLSLYDNKIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKW---LADFLRTNPIETSGARCASPRRLANKRIGQIKSKKFRC 487          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: LRRC4C (leucine rich repeat containing 4C [Source:NCBI gene;Acc:100188921])

HSP 1 Score: 73.559 bits (179), Expect = 5.119e-13
Identity = 77/306 (25.16%), Postives = 129/306 (42.16%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAFE------HLTIDTLKLNDIGKLK-----------------LHRNSFSKLS-LKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLL----WLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIK------INKSNSGENVYRCVAENKIGQSYIVVNLD 1148
            KL+ L +R   I+ +    F+ +  LR LDL E + L+ I + AFE      +L +    L DI  L                  L   SF  L+ L+ L I +S++ +++ + F   D+       L +NN   +  +  + + NL+ I L  +P  CNC +L    WLK + +T ++   R     C +P +L+   ++E+D   F C  P I E    +N      AEL C+A      T   +VSW+  N    +      +I+ +        N +     +Y C+  N  G +     L+
Sbjct:  149 KLKELWLRNNPIESIPSYAFNRIPSLRRLDLGEMKRLSYISEGAFEGLSNLKYLNLGMCNLRDIPNLTPLVKLDELDLSGNHLSVLRPGSFQGLTHLQKLWIMHSQIQVIERNAFD--DLQSLVELNLAHNNLTLLPHDLFTPLHNLQRIQLHHNPWNCNCDILWLSWWLKEIVTTGSTCCAR-----CSTPPSLKGTHIAELDHNYFTCYAPVIVEPPADLNVTEGMAAELKCRA-----STSLTYVSWITPNGTIMTHGSYKVRISVLNDGTLNFTNVTVRDTGLYTCIVSNSAGNTTASATLN 442          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrfn4 (leucine rich repeat and fibronectin type III domain containing 4 [Source:MGI Symbol;Acc:MGI:2385612])

HSP 1 Score: 89.3521 bits (220), Expect = 3.577e-18
Identity = 97/368 (26.36%), Postives = 162/368 (44.02%), Query Frame = 3
Query:  168 CPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPV---NMTGIIT-TLK-----------------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKL----SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTI--------DRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSH--DESSLKKSEKIASIKINKSNSGE-NVYRCVAENKIGQSYIVVNL 1145
            CP  C VC  L+++L  +C + G    P      T  + L  ++  +  L P    NMTG++  TL                  LR L + G  + +L  ++  G  +L+ L LS NQ+  I   AF+   +D+L+  D+    L +  ++ +    +L  L++ ++ +  L   VF QL  S+     LT+N   T+         R+ E+    L ++  +G+PL CNC LLWL+RLA   +          C SP  L  +    + E EF CEPP I+    ++  L    A L C+A    + T    + W+  +      SS   +    +++I  + +G+   Y C+A N  G++   V L
Sbjct:   17 CPLPC-VCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQA--LGPPDFRNMTGLVDLTLSRNAITRIGARSFGDLESLRSLHLDGNRLVELGSSSLRGPVNLQHLILSGNQLGRIAPGAFDDF-LDSLEDLDVSYNNLRQVPWAGIGSMPALHTLNLDHNLIDALPPGVFAQL--SQLSRLDLTSNRLATLAPDPLFSRGRDAEASPSPL-VLSFSGNPLHCNCELLWLRRLARPDD-------LETCASPPTLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATLRCRALGDPVPT----MHWVGPDDRLVGNSSRAWAFPNGTLEIGVTGAGDAGAYTCIATNPAGEATARVEL 366          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrfn4 (leucine rich repeat and fibronectin type III domain containing 4 [Source:MGI Symbol;Acc:MGI:2385612])

HSP 1 Score: 89.3521 bits (220), Expect = 3.577e-18
Identity = 97/368 (26.36%), Postives = 162/368 (44.02%), Query Frame = 3
Query:  168 CPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPV---NMTGIIT-TLK-----------------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKL----SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTI--------DRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSH--DESSLKKSEKIASIKINKSNSGE-NVYRCVAENKIGQSYIVVNL 1145
            CP  C VC  L+++L  +C + G    P      T  + L  ++  +  L P    NMTG++  TL                  LR L + G  + +L  ++  G  +L+ L LS NQ+  I   AF+   +D+L+  D+    L +  ++ +    +L  L++ ++ +  L   VF QL  S+     LT+N   T+         R+ E+    L ++  +G+PL CNC LLWL+RLA   +          C SP  L  +    + E EF CEPP I+    ++  L    A L C+A    + T    + W+  +      SS   +    +++I  + +G+   Y C+A N  G++   V L
Sbjct:   17 CPLPC-VCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQA--LGPPDFRNMTGLVDLTLSRNAITRIGARSFGDLESLRSLHLDGNRLVELGSSSLRGPVNLQHLILSGNQLGRIAPGAFDDF-LDSLEDLDVSYNNLRQVPWAGIGSMPALHTLNLDHNLIDALPPGVFAQL--SQLSRLDLTSNRLATLAPDPLFSRGRDAEASPSPL-VLSFSGNPLHCNCELLWLRRLARPDD-------LETCASPPTLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATLRCRALGDPVPT----MHWVGPDDRLVGNSSRAWAFPNGTLEIGVTGAGDAGAYTCIATNPAGEATARVEL 366          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 77.411 bits (189), Expect = 8.305e-15
Identity = 65/244 (26.64%), Postives = 103/244 (42.21%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHL-TIDTLKLNDIGKLKLHRNSFSKLS-LKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK---RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            CP +C+ C   T+ C   G    P      TE + L G+  T                              + +N F+GLK LR+L L ENQI  +   AF+ +  ++ L L++     + R +F   + LK L +  +R+S ++   F  L     +   L NNN  TI  +  + +  L+   L  + L C+C L WL    R   TI       +F +C  P +LR   ++E+ + EF C
Sbjct:   34 CPALCT-CTGTTVDCHGTGLQAIPKNIPRNTERLELNGNNITR-----------------------------IHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLDLSENFLQAVPRKAFRGATDLKNLQLDKNRISCIEEGAFRAL--RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIG------LFTQCSGPASLRGLNVAEVQKGEFSC 239          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Lrfn2 (leucine rich repeat and fibronectin type III domain containing 2 [Source:MGI Symbol;Acc:MGI:1917780])

HSP 1 Score: 77.7962 bits (190), Expect = 2.239e-14
Identity = 83/306 (27.12%), Postives = 133/306 (43.46%), Query Frame = 3
Query:  156 VYNECPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHY-------------------FTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEH--LTIDTLKLNDIGKLKLHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTID------RNFESIIRNLKL-----IDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKA 956
            V + CPK C VC  L+++L  +C + G    P      T  + L G++                    + NT+S +     +    LR L +    +  L  +T  GL +L+ L ++ NQ+  I D AFE   LT++ L L+      L  +S  ++ +L  LS+ ++ L  +    F   D+ +     LT+N  + +       R+  S++              G+PL CNC LLWL+RL    +  +       C SP +L+ +    I E EF CEPP I++   K+  L    A L CKA
Sbjct:   17 VVDACPKYC-VCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLGGNFIIHIGRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTLRGLVNLQHLIVNNNQLGGIADDAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSLDHNLLDHIAEGTFA--DLQKLARLDLTSNRLQKLPPDPIFARSQASLLTATPFAPPLSFSFGGNPLHCNCELLWLRRLERDDDLET-------CGSPGSLKGRYFWHIREEEFVCEPPLITQHTHKLLVLEGQAATLKCKA 312          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 75.8702 bits (185), Expect = 1.170e-13
Identity = 63/244 (25.82%), Postives = 107/244 (43.85%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEH-LTIDTLKLNDIGKLKLHRNSFSKLS-LKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK---RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            CP +C+ C   T+ C   G    P      TE + L G     N ++ ++        +LR L +    I  + R  F  +K+L  L L+ NQ+  + +  F++   +  L L++     + R +F   + LK L +  +R+S ++   F  L     +   L NNN  TI  +  + +  L+   L  + L C+C L WL    R   TI       +F +C  P +LR   ++E+ + EF C
Sbjct:   34 CPALCT-CTGTTVDCHGTGLQAIPKNIPRNTERLELNG-----NNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQVLPELLFQNNQALSRLDLSENFLQAVPRKAFRGATDLKNLQLDKNRISCIEEGAFRAL--RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIG------LFTQCSGPASLRGLNVAEVQKGEFSC 263          

HSP 2 Score: 68.9366 bits (167), Expect = 1.375e-11
Identity = 60/241 (24.90%), Postives = 101/241 (41.91%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHL-TIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNS-RLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            CP +CS C +  + C   G T  P                       P  MT I   L           I+ +    FS  + LR +DLS NQI  I   AF+ L ++++L L       L R  F  L    L + N+ +++ +    F   D+       L +N  +++ +   + +R ++ + LA +P +C+C+L W   LA  + +N       +C SP  L +K + +I   +F+C
Sbjct:  282 CPAMCS-CSSGIVDCRGKGLTAIPANL--------------------PETMTEIRLELN---------GIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQ--DLQNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKW---LADFLRTNPIETTGARCASPRRLANKRIGQIKSKKFRC 487          

HSP 3 Score: 63.929 bits (154), Expect = 4.989e-10
Identity = 59/246 (23.98%), Postives = 98/246 (39.84%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLK-LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWL-----KRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCE 887
            CP  C  C A  + C +   ++ P +    T  + L      +N +S +  TG+   L  L+ + +    + ++   TF G   +  L L+ NQ+ +I    F  L                        L+ L ++N+R+S +    F  L   R    Y  +N+  TI       ++ L  ++L  +P  CNC L WL     KR   T N        P+C +P  LR   L ++   +F+CE
Sbjct:  513 CPHKCR-CEASVVECSSLKLSKIPERIPQSTTELRL-----NNNEISILEATGLFKKLSHLKKINLSNNKVSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLD----------------------GLRTLMLRNNRISCIHNDSFTGLRNVRLLSLY--DNHITTISPGAFDTLQALSTLNLLANPFNCNCHLSWLGDWLRKRKIVTGN--------PRCQNPDFLRQIPLQDVAFPDFRCE 720          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|D4ABX8|LRFN4_RAT (Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrfn4 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.081e-17
Identity = 97/368 (26.36%), Postives = 162/368 (44.02%), Query Frame = 3
Query:  168 CPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPV---NMTGIIT-TLK-----------------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKL----SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTI--------DRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSH--DESSLKKSEKIASIKINKSNSGE-NVYRCVAENKIGQSYIVVNL 1145
            CP  C VC  L+++L  +C + G    P      T  + L  ++  +  L P    NMTG++  TL                  LR L + G  + +L  ++  G  +L+ L LS NQ+  I   AF+   +D+L+  D+    L +  ++ +    +L  L++ ++ +  L   VF QL  S+     LT+N   T+         R+ E+    L ++  +G+PL CNC LLWL+RLA   +          C SP  L  +    + E EF CEPP I+    ++  L    A L C+A    + T    + W+  +      SS   +    +++I  + +G+   Y C+A N  G++   V L
Sbjct:   17 CPLPC-VCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQA--LGPPDFRNMTGLVDLTLSRNAITRIGARSFGDLESLRSLHLDGNRLVELGSSSLRGPVNLQHLILSGNQLGRIAPGAFDDF-LDSLEDLDVSYNNLRQVPWAGIGSMPALHTLNLDHNLIDALPPGVFAQL--SQLSRLDLTSNRLATLAPDPLFSRGRDAEASPSPL-VLSFSGNPLHCNCELLWLRRLARPDD-------LETCASPPTLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATLRCRALGDPVPT----MHWVGPDDRLVGNSSRAWAFPNGTLEIGVTGAGDAGAYTCIATNPAGEATARVEL 366          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80XU8|LRFN4_MOUSE (Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Mus musculus OX=10090 GN=Lrfn4 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.502e-17
Identity = 97/368 (26.36%), Postives = 162/368 (44.02%), Query Frame = 3
Query:  168 CPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPV---NMTGIIT-TLK-----------------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKL----SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTI--------DRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSH--DESSLKKSEKIASIKINKSNSGE-NVYRCVAENKIGQSYIVVNL 1145
            CP  C VC  L+++L  +C + G    P      T  + L  ++  +  L P    NMTG++  TL                  LR L + G  + +L  ++  G  +L+ L LS NQ+  I   AF+   +D+L+  D+    L +  ++ +    +L  L++ ++ +  L   VF QL  S+     LT+N   T+         R+ E+    L ++  +G+PL CNC LLWL+RLA   +          C SP  L  +    + E EF CEPP I+    ++  L    A L C+A    + T    + W+  +      SS   +    +++I  + +G+   Y C+A N  G++   V L
Sbjct:   17 CPLPC-VCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQA--LGPPDFRNMTGLVDLTLSRNAITRIGARSFGDLESLRSLHLDGNRLVELGSSSLRGPVNLQHLILSGNQLGRIAPGAFDDF-LDSLEDLDVSYNNLRQVPWAGIGSMPALHTLNLDHNLIDALPPGVFAQL--SQLSRLDLTSNRLATLAPDPLFSRGRDAEASPSPL-VLSFSGNPLHCNCELLWLRRLARPDD-------LETCASPPTLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATLRCRALGDPVPT----MHWVGPDDRLVGNSSRAWAFPNGTLEIGVTGAGDAGAYTCIATNPAGEATARVEL 366          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P24014|SLIT_DROME (Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2)

HSP 1 Score: 89.3521 bits (220), Expect = 5.168e-17
Identity = 67/251 (26.69%), Postives = 117/251 (46.61%), Query Frame = 3
Query:  141 SAVGYVYN-ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNI-HDFAFEHLTIDTLKLNDIGKLKLHRNSF-SKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
              VG +    CP++CS C    + C + G T  P K  ++ E + L G     N L+ +  T      KLR L +    I  + RN+F  L  L  L L+ N++  I  +F     ++  L +++     + R  F    SL+ L + N++++ LD   F  L     +   L NNN  ++  N    +  L+ + L+ +P  C+C L WL R    + S +    + +C SP+ L+ + ++++ + EFKC
Sbjct:   63 GGVGVITEARCPRVCS-CTGLNVDCSHRGLTSVPRKISADVERLELQG-----NNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGL--VELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSRF---LRSATRLAPYTRCQSPSQLKGQNVADLHDQEFKC 302          

HSP 2 Score: 54.299 bits (129), Expect = 3.314e-6
Identity = 48/174 (27.59%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  375 IQDLLRNTFSGLKDLRILDLSENQILNI-HDF--AFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNS-RLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            I +L   +FS  + LR +DLS N I  I HD     + LT   L  N I  L      F  L    L + N+  +S +    F  L        Y  +NN +++       ++++K + LA +P +C+C+L W   LA  ++ N       +C SP  +  + +  + E +FKC
Sbjct:  358 ITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLP--SGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLY--DNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLRW---LADYLHKNPIETSGARCESPKRMHRRRIESLREEKFKC 524          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PJG9|LRFN4_HUMAN (Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRFN4 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.886e-16
Identity = 96/369 (26.02%), Postives = 161/369 (43.63%), Query Frame = 3
Query:  168 CPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPV---NMTGIIT-TLK-----------------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKL----SLKVLSIKNSRLSILDYSVFMQLD-ISRFQFFYLTNNNFRTI--------DRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSH--DESSLKKSEKIASIKINKSNSGE-NVYRCVAENKIGQSYIVVNL 1145
            CP  C VC  L+++L  +C + G    P      T  + L  ++  +  L P    NMTG++  TL                  LR L + G  + +L   +  G  +L+ L LS NQ+  I   AF+   +++L+  D+    L +  ++ +    +L  L++ ++ +  L    F QL  +SR     LT+N   T+         R+ E+    L ++  +G+PL CNC LLWL+RLA   +          C SP  L  +    + E EF CEPP I+    ++  L    A L C+A      T    + W+  +      SS  ++    +++I  + +G+   Y C+A N  G++   V L
Sbjct:   17 CPLPC-VCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQA--LGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLVELGTGSLRGPVNLQHLILSGNQLGRIAPGAFDDF-LESLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNLIDALPPGAFAQLGQLSRLD---LTSNRLATLAPDPLFSRGRDAEASPAPL-VLSFSGNPLHCNCELLWLRRLARPDD-------LETCASPPGLAGRYFWAVPEGEFSCEPPLIARHTQRLWVLEGQRATLRCRALGDPAPT----MHWVGPDDRLVGNSSRARAFPNGTLEIGVTGAGDAGGYTCIATNPAGEATARVEL 366          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80TG9|LRFN2_MOUSE (Leucine-rich repeat and fibronectin type-III domain-containing protein 2 OS=Mus musculus OX=10090 GN=Lrfn2 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 1.566e-13
Identity = 83/306 (27.12%), Postives = 133/306 (43.46%), Query Frame = 3
Query:  156 VYNECPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHY-------------------FTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEH--LTIDTLKLNDIGKLKLHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTID------RNFESIIRNLKL-----IDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKA 956
            V + CPK C VC  L+++L  +C + G    P      T  + L G++                    + NT+S +     +    LR L +    +  L  +T  GL +L+ L ++ NQ+  I D AFE   LT++ L L+      L  +S  ++ +L  LS+ ++ L  +    F   D+ +     LT+N  + +       R+  S++              G+PL CNC LLWL+RL    +  +       C SP +L+ +    I E EF CEPP I++   K+  L    A L CKA
Sbjct:   17 VVDACPKYC-VCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLGGNFIIHIGRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTLRGLVNLQHLIVNNNQLGGIADDAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSLDHNLLDHIAEGTFA--DLQKLARLDLTSNRLQKLPPDPIFARSQASLLTATPFAPPLSFSFGGNPLHCNCELLWLRRLERDDDLET-------CGSPGSLKGRYFWHIREEEFVCEPPLITQHTHKLLVLEGQAATLKCKA 312          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5P8I4L0 (PXDN-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 6.723e-42
Identity = 140/505 (27.72%), Postives = 235/505 (46.53%), Query Frame = 3
Query:  159 YNECPKICS--VCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGI-ITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRL----ASTIN-SNSFRIV-FPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWPTK----WSLYRNNLSI-PIDFTHQLDNYP---WATTFYFKKRYTLVELIVAVISTFITTIVMFVIAYKICTQSSGCIGLSGKPYISHQKLMTHQKGFCNGYPPFRFNTADNGLHTTESNSQTYDCISINNALY-PHQLSNTL--PGPFIDYKTHERVYSPNIVV 1613
            +N CP +C    C    L C +GG  + P     +T  I +    F+S  L+  N +       K+  +A++ C +  +  N FS L DLR+LDLS N +  I    F+ L +  L+L+D   ++ HR SF  L++  LS+ +  L+ LD+ VF ++   R +   LTNN    ID+ F  +  NL  + +  +P  C C+L WL  +       IN S+S RI    +C  P  ++ K ++++D  +F C+ PR+  I +   +  +A+L C +E K+  +  +   WM  + +      +S + AS+ + +  S  + Y+CV +N      +V+++ WP K     S   N L + P D    L N        + +++K++TL+E+I  V+ TF  T+++F+  Y+                  H  +   +      Y    + TA        S+SQTYD  +    LY P QL      P  ++DY +H    SPN V 
Sbjct:   23 FNPCPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEIS-ERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLSSSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVI--WMTEHKNTYVPEIQSIEKASLSVLRK-SRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANSTLHVRSVFYEKQFTLLEMIGGVVGTFTITMILFLCIYR------------------HLAMTMKRNDKKKWY--LSYETA------IGSDSQTYDIPNNTAGLYFPGQLLTNPYSPARYLDYNSHTPQSSPNKVA 497          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0X3NXX2 (Protein slit OS=Schistocephalus solidus OX=70667 GN=SLIT PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 4.056e-32
Identity = 117/468 (25.00%), Postives = 209/468 (44.66%), Query Frame = 3
Query:  147 VGYVYNECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIIT-----TLKLRYLAIRGCSIQDLLRNTFSGLK-DLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSK-LSLKVLSIKNSRLSILDYSVFMQLDISRF-QFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVF----PKCVSPTNLRSKMLSEI--DETEFKCEP--------------PRISEIKINFLNHFTAELFCKAEIKSI---KTGQIFVSWMNN-------NSHDESSLKKSEKI--------------------ASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWP---TKWSLYRNNLSI-PID----------FTHQLDNYPWATTFYFKKRYTLVELIVAVISTFITTIVMFVIAYK 1334
             G     CP +C  C++  + C+  G  E P    S+ E + +    F S+ L+ + +    +      ++L+ L IR C+I  L R  F  L   L  LDLS N +  I  F F  L + +L LN++ + K+   +FS  L L  LS++NSRL+ L Y   ++L  S F +  +L  N    I+ +FE I R L+  +L G+P  C+C+L WL ++     +N  +I      P C  P +  +    ++  +++E   EP              PR+  ++++ L  F A+      I       T ++ +SW +        N   +++L  S  +                    +S+ +++ N+  +VY C   N +G     + + WP      ++ +    + P+D            HQL   P+       KR++L+++I AV+ TF+ T+++FV+AY+
Sbjct:   42 TGAERPRCPDVCQ-CVSTMMDCKQSGLRELPHPPSSKLEMVVISNQTFRSSVLNSLALKPYWSREFGGEVRLKLLKIRYCNIASLARGAFGKLGLQLEELDLSGNPLKTIDAFVFSGLKLKSLFLNNLPRPKIDEEAFSGVLELNSLSLQNSRLTRLSYHALLELTQSNFLKHLFLHGNQLSHIESSFEHIFRTLQSFELTGNPWHCDCNLRWLIQIYRLSRANGAQIPRVHQQPSCSGPNDFANFSFDQVALNDSELYAEPYFTATPRPLLICEVPRLEHLEVD-LRQFVADTKTNQAILGCLIRGTPEVHISWTHQIATGQTRNVTSQAALSASPTVSSERQGFDFSRGRAPVSRWSSSLTVSRFNA-SDVYSCTGTNLLGNVSATIRVLWPKGVNAPAIAKGEKDLEPVDALTTRRSSLGLDHQL---PYDQYNILAKRFSLMDVIGAVVGTFLVTMLLFVVAYR 503          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: I1ZIL5 (Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.146e-30
Identity = 129/512 (25.20%), Postives = 227/512 (44.34%), Query Frame = 3
Query:  162 NECPKICS--VCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITT-LKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWL--------KRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS---HDESSLKKSEKIASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWPTKWSLY-----------------RNNLSIPIDFTHQLD----NYPWATTFYFKKRYTLVELIVAVISTFITTIVMFVIAYKICTQSSGCIGLSGKPYISHQKLMTHQKGFCNGYPPFRFNTADNGLHTTESNSQTYDCISINNALYPHQLSNTLPGPFIDYKTHERV 1592
            +ECP++C+   C    L+CE  G  + P       + + L    F    L+  N++   +  + L+ L I  CS+  +    FS L  L+ LDLS N++L I+   F+ L++ TL L+    L+L ++SF  L ++ LS+K+  L IL +    Q+         L +N    +  +F+ + R L  ++L  +   C+C L WL        KR  ++   +  R+  P C  P NL+   +  +    F+C+ P++  I I   +  TAE+ C ++   +   Q+   +  N S   +           ASI ++K  S  + Y C+  N+ G + + + + WPT    Y                 RNN++       + D    NY W       K+YT +E+++A+  TFI T+V F++ Y +               I++++  +  K    GY        + G++   S SQTYD   ++    P+  SNT  G  +D+KT + +
Sbjct:   33 SECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQIS-GYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNLFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISD--DMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKK-SEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWI------KQYTFIEMVLAICGTFIITLVTFILLYVV---------------INYRRKNSRSKNILKGY--------EVGVY---SESQTYDVPQMS----PYHESNT--GRLLDFKTQQEI 502          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: W6U6F3 (Immunoglobulin superfamily member OS=Echinococcus granulosus OX=6210 GN=EGR_08348 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.363e-30
Identity = 120/448 (26.79%), Postives = 204/448 (45.54%), Query Frame = 3
Query:  162 NECPKICSVCLAKTLICENGGFTE-FPTKFLSETENITLIGHYFTSNTLSPVNMTG-IITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISR-FQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWL------KRLAST------INSNSFRIV----FPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINF--LNHFTAELFCKAEIKSIK-----TGQIFVSWMNNNSHDESSLKKS--EKIAS--IKINKSNS------------GENVYRCVAENKIGQSYIVVNLDWPTKWSLY----------RNNLSIPIDFTHQLDN------YPWATTFYFKKRYTLVELIVAVISTFITTIVMFVIAY 1331
            +E  +IC  C   ++ C+        P    +  E + ++   F S  LS  N++   +  + +  L I  C ++ +   TFSGL  L  LDLS+N +  I    F  L +D L+L+D   L L   +F  L++  LS++N  L  L Y VF  L  SR      LT+N+  T+D  FE   RNL  + LA +P VC+C L+WL      KR A +      +N +   IV     P C SP  LR K +  +   +F C PP++  ++++F  L    +E F    +  IK     + ++ ++W   +   +  ++     ++AS  ++++ S+S               ++ C+  +  G +   ++L WP    L           RN +      +  L+N            F+F K++T++ELI AV+ TF  TI++F++ Y
Sbjct:   29 DEVCRICEGCTYGSISCQEADLLHMLPNDLPNGIEKVIIVSQRFDSQFLSRQNISSYTLPGVNIHELTIMHCGLRAIEAGTFSGLSSLTKLDLSKNSLSRIQGHTFSGLRLDLLRLDDNQGLTLDSEAFENLTVSSLSMQNCGLRSLSYEVFQPLVQSRSLTTLRLTSNSLTTLDARFEPFFRNLSFLSLARNPFVCDCKLVWLSQTLQRKRRADSDDAFRRLNDDRLLIVPDDDHPVCESPNRLRGKQIVSLSTRDFFCGPPQMRTLEVDFSDLRVGQSETFNMTGVVLIKCAAQGSPEMQLAWFRRDGRGDEPIRLPGLRQVASGVVEVSISHSLLAKNSNSETEDAGQLFTCLGVDTYGNTSADLSLRWPALPLLSPLPSSPTSNNRNPMEPSSGDSKYLNNDKGYFQSDHLDEFFFMKKFTILELIGAVVGTFTATILLFLMGY 476          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0R3SAT8 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1502 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 6.133e-30
Identity = 116/453 (25.61%), Postives = 204/453 (45.03%), Query Frame = 3
Query:  162 NECPKICSVCLAKTLICENGG-FTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGI-ITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQ-LDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLAS----TINSNSFRIV------------FPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLN---------HFTAELFCKAEIKSIKTGQIFVSWMNNNSHDE-----SSLKK-SEKIASIKINKS-----------NSGENVYRCVAENKIGQSYIVVNLDWPTKWSLYRNNLSIP------------------IDFTHQLDNYPWATTFYFKKRYTLVELIVAVISTFITTIVMFVIAY 1331
            +E  +IC  C+  ++ C+  G     P    S    + ++   F S  LS  N++   +   +++ L I  C ++ +   TFSGL  L  LDLS+N +  I    F  L +D L+L+D   L L   +F  L++  LS++N  L  L + VF   L         LT+N+  T+D  FE   RNL  + LA +P VC+C L+WL R+        N ++F ++             P C SP  LR K +  +  ++F C PP++  ++++F +         + TA +  K   +   + ++ ++W   +         S L++ S  +  + +++S           +SGE ++ C+  +  G +   + L WPT   L  N+   P                  ++   Q         F+F K++T++ELI AV+ TF  TI++F++ Y
Sbjct:   29 DEVCQICDGCIYGSISCQEAGRLHMLPNDLPSGIRKVIIVSQRFDSQFLSRPNISSYSLPGSEIQELTIMDCGLRAIESRTFSGLNSLTKLDLSKNSLSRIQGNTFSGLRLDLLRLDDNQGLTLDAEAFENLTVSSLSMQNCGLRSLSFEVFRPLLQSGTLTTLRLTSNSLTTLDARFEPFFRNLSFLSLAKNPFVCDCKLMWLSRILQRKRRADNDDAFPMINDDRLLIEPDDDHPICESPGRLRGKQIVSLASSDFYCGPPQMRALEVDFTSLRVGGSEAVNTTAGILIKCAAQG--SPEMQLTWFRRDRWGAGLIPLSGLRQISPGVVEVSVSRSLLAKNSTSDSEDSGE-LFTCMGIDTYGNTSADLFLKWPT---LPTNSAVKPQSPDKRSSLESSSSDTFYLEGEQQRFQTDRLDEFFFMKKFTILELIGAVVGTFTATIMLFLMGY 475          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 78.9518 bits (193), Expect = 6.110e-15
Identity = 69/252 (27.38%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAF------EHLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ L    F  +  LR LDL E + L+ I D AF       +L +    L DI  L                  +   SF  L SL+ L + +S++++++ + F   D+   +   L++N+  ++  +  + ++ L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  142 KLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIERNAFD--DLKSLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWITPNG 384          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 78.9518 bits (193), Expect = 6.110e-15
Identity = 69/252 (27.38%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAF------EHLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ L    F  +  LR LDL E + L+ I D AF       +L +    L DI  L                  +   SF  L SL+ L + +S++++++ + F   D+   +   L++N+  ++  +  + ++ L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  142 KLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIERNAFD--DLKSLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWITPNG 384          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 78.5666 bits (192), Expect = 7.570e-15
Identity = 69/252 (27.38%), Postives = 115/252 (45.63%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAF------EHLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ L    F  +  LR LDL E + L+ I D AF       +L +    L DI  L                  +   SF  L SL+ L + +S++++++ + F   D+   +   L++N+  ++  +  + ++ L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  129 KLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIERNAFD--DLKSLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWITPNG 371          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrfn4b (leucine rich repeat and fibronectin type III domain containing 4b [Source:ZFIN;Acc:ZDB-GENE-070705-473])

HSP 1 Score: 77.411 bits (189), Expect = 1.920e-14
Identity = 98/379 (25.86%), Postives = 158/379 (41.69%), Query Frame = 3
Query:  156 VYNECPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTS-NTLSPVNMTGIIT-TLK-----------------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSI-LDYSVFMQLDISRFQFFY------LTNNNFRTID------RNFESIIR-----NLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIK------INKSNSGENVYRCVAENKIGQSYIVVNL 1145
            V + CP  C VC  L+++L  +C + G    P      T  + L  ++          NMTG++  TL                  LR L + G  +  L      G+ +L+ L L+ NQ++NI   AF+      L L D   L L  N+  K     +    S  ++ LD+++  Q+    F   Y      +T+N  +T+       R+   +I      ++  ++  G+PL CNC LLWL+RL   I S+        C +P +L  +    I E EF CEPP I+    K+  L    A L C+A    I   +  V W+   S D+  +  S +  S +      +      +  Y C+A N  G++  V++L
Sbjct:  112 VVSACPFHC-VCRNLSESLSTLCADKGLLFVPPNIDRRTVELRLADNFIREVGGADFANMTGLVDLTLSRNTINFIKPMAFGDLESLRSLHLDGNRLMSLGPRDLMGMLNLQHLILNNNQLINISSDAFDDFL---LTLED---LDLSYNNLRKAPWDAIQNMASLHTLNLDHNLIDQIAEGSFSELYKLARLDMTSNRLQTLPPDPLFARSQTGVISPTPYNSVVSLNFGGNPLHCNCELLWLRRL---IRSDDMET----CATPIHLAGRYFWSIPEEEFICEPPLITRHTHKLWVLEGQRATLKCRA----IGDPEPVVHWV---SPDDRIIANSSRTTSFRNGTLELLVTVARDDGAYTCIAINAAGEATAVIDL 469          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lingo2a (leucine rich repeat and Ig domain containing 2 [Source:NCBI gene;Acc:103042373])

HSP 1 Score: 76.2554 bits (186), Expect = 4.141e-14
Identity = 92/366 (25.14%), Postives = 155/366 (42.35%), Query Frame = 3
Query:  198 KTLICENGGFTEFPTKFLSETEN-ITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLL-RNTFSGLKDLRILDLSENQILNIHDFAFEHL--------------TIDTLKLNDIGKLKLHRNSFSKL-SLKVLSIKNSR-LSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFK----CEPPRISEIKINFLN---HFTAELFCKAEIKSIKTGQIFVSW-------MNNNSHDESSLKKSEKIASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWPTKWSLYRNNLSIPID 1199
            ++L  E    T  PT+ LS   N ++L   Y + +TL P +   +    +LR+L I      D+   NT  GL +L  L ++   + +    A  H+              T++   L D+ +L+  R S ++L S++  + +  R L +LD S                +N   T++R        L+L+ +  +PLVC+C L+WL +   +I   SF    P+C +P  +R +   E  ET       C  P+I E +   ++     +A L C AE     T +  +SW       + N SH    +  +  +    +   + G  VY CVA N  G   ++V+L   +  SLY N     +D
Sbjct:  223 ESLTLERCNLTVVPTEALSHLHNLVSLHMRYLSISTLHPYSFKKL---FRLRHLEIDNWPSLDVFPANTLHGL-NLTTLSVTNTNLSSFPYQALRHMPYLTHLNLSHSRIRTVEGGLLQDLVRLRELRLSGAQLVSVEPYAFQGLRWLKVLDVS----------------HNKLDTLERGVFHAPEALELLLINDNPLVCDCRLMWLLQKRHSI---SFGEEQPECNTPEGIRGRPFKEFKETLLSYYVTCTKPKIRENRTQLVSVDEGQSARLQCSAE----GTPRPMISWITPRRRHLTNRSHGRVMVHNNGSLDIKSVEVQDGG--VYVCVASNTAGNDTLMVSLAVKSLGSLYANRTQYYVD 559          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 73.559 bits (179), Expect = 7.928e-14
Identity = 61/258 (23.64%), Postives = 117/258 (45.35%), Query Frame = 3
Query:  375 IQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIK--INFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKI-----ASIKINKS-NSGENVYRCVAENKIGQ 1124
            I+ + R  F  L+ L+ L L +N+I +I   AF+ L                      +SL+ L I  + + +L+ + F  +D+ + +  +L NN    I     + + +L+ + L  + LVC+C L+WL  L      +   +    C  P  L+ + +S I   EF CE PRI+     ++     T  L C+AE       +  + W++N+  +E ++ + E+       ++ I  + ++ +  Y+C+A N  G+
Sbjct:   35 IKRIPRRAFEDLESLKYLYLYKNEIQSIDRHAFKGL----------------------VSLEQLYIHFNHIEVLEPNTF--VDLPKLERLFLHNNRLSRIATGTFTQLSSLRRLRLDSNRLVCDCELVWLAELLRAFAGSGGTLAAATCEHPRRLQGRSVSSITAQEFHCESPRITSEPHDVDVTPGNTVYLRCRAE----GNPKPAIIWLHNS--NEIAMAEDERRNLLQDGTLMIRDTRHTDQGTYQCMARNVAGE 262          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrfn5a (leucine rich repeat and fibronectin type III domain containing 5a [Source:ZFIN;Acc:ZDB-GENE-080327-17])

HSP 1 Score: 72.0182 bits (175), Expect = 1.708e-13
Identity = 72/274 (26.28%), Postives = 122/274 (44.53%), Query Frame = 3
Query:  396 TFSGLKDLRILDLSENQILNIHDFAFEH--LTIDTLKLNDIGKLKLHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKL-------------IDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKI-----ASIKINKSNSGEN-VYRCVAENKIGQSYIVVNL 1145
            +F GL +LR L +S NQ+ +I   AF+   ++++ L L      K+   +  K+ SL  LS+ ++ +  ++   F  L   +     +T+N  + +    + +   L+L             ++  G+PL CNC LLWL+RL    +          C SP  L  K    I E EF CEPP I+    ++  L    A L CKA    I     +V W+   S DE  +  + +       +++I  + + ++  + C+A N  G+S   V L
Sbjct:  118 SFKGLSNLRHLIISNNQLSDISVGAFDDFLMSLEDLDLAYNNLEKVPWEAIQKMTSLHTLSLDHNMIDYIEAGTFSHL--HKLARLDMTSNKLQKLPP--DPLFTRLQLFANKGIHHTPPLVLNFGGNPLHCNCELLWLRRLTREDD-------LETCASPQALVGKYFWSIPEEEFVCEPPLITRHTHRLLVLEGQRATLKCKA----IGDPDPWVHWI---SPDEKVISNTTRTVVHDNGTLEILVTTTKDDGTFTCIASNPAGESTTFVEL 373          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 70.0922 bits (170), Expect = 6.424e-13
Identity = 71/303 (23.43%), Postives = 130/303 (42.90%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSE-NQILNIHDFAFE------HLTIDTLKLNDIGKLK-----------------LHRNSFSKLS-LKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPP--RISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIK------INKSNSGENVYRCVAENKIGQSYIVVNLD 1148
            KLR L +R   I+D+   TF+ +  L+ LDL E  ++  I + AFE      +L +    L ++ KL                  L   SF  L+ L+ L I +S + +++ + F +L     +   L +N+  ++  +  S ++ L+ + L  +P  C+C +LWL   L   + +N+      +C  P + ++  L E+D + F C PP   +    +N      AEL C+A   +       V+W+  N    +      +I+ +        N +     +Y C+  N +G S     L+
Sbjct:  104 KLRDLWLRNNPIEDISAYTFTRIPSLQRLDLGELTKLQFISNEAFEGLSNLRYLNLGMCNLREVPKLSPLVRLEELELSGNRIEILRPGSFQGLANLRKLWIMHSEVRLVERNAFDELQ--SLKELNLAHNSLMSLPHDLFSPLQKLERVHLHHNPWTCDCDILWLSWWLRENVPNNA--TCCARCALPADRKAINLWELDSSRFTCYPPLIEVPPSDVNISEGMAAELRCRAPSSASS-----VTWITPNGTSMTHGSYKIRISVLHDGTLNFTNVTVQDTGIYTCLVANSVGNSTASATLN 397          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrrn1 (leucine rich repeat neuronal 1 [Source:ZFIN;Acc:ZDB-GENE-071126-1])

HSP 1 Score: 61.2326 bits (147), Expect = 2.894e-10
Identity = 65/284 (22.89%), Postives = 116/284 (40.85%), Query Frame = 3
Query:  345 LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHL-TIDTLKLNDIGKLKLHRNSFSK-LSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFP---KCVSPTNLRSKMLSEI--DETEFKCEPPRIS---EIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNN--------SHDESSLKKSE-------KIASIKINKSNSGENVYRCVAENKIG 1121
            LR L + G  +  +      GL+ L  L L +N +  +   A  HL  +  L LN     ++    F   L+LK L   N +L+ +    F +L   R +   L ++    + R     +R+L+ I L G+PL C+C   W+       N  + R + P   +C +P  L  + + ++   ET   C P   +     ++N  +     L C+A    I   +  + W+           S  ++ L K +       ++A+I + ++     +Y CVA N  G
Sbjct:  192 LRSLVLAGTGLAHVPGEALLGLEKLESLSLYDNLLEAVPRAALRHLPALKFLDLNKNPVRQIRDGDFRDMLNLKELGTNNPKLAFVHRDAFDRL--PRLESLMLNDDGLGALHRATVRSLRSLREISLHGNPLRCDCVNRWM----GAGNRGAVRFLEPESMRCAAPPELEGRRVRDVAFAETADSCLPLIAAGTFPARLNVPSGARVRLACRA----IAEPEADIYWVTPRGDKVAPAASRSDAPLVKYQLGPEGTLEVAAIAVEEA----GLYTCVAHNSEG 461          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21207])

HSP 1 Score: 61.2326 bits (147), Expect = 4.655e-10
Identity = 67/292 (22.95%), Postives = 116/292 (39.73%), Query Frame = 3
Query:  276 IGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFK----CEPPRISEIKINFLNHFTAE---LFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIA-----SIKINKSN-SGENVYRCVAEN 1112
            I H+    TL      G  ++L L  L++   +I  + R     L  LR LDLS N I ++   AF  LT                       L+ L ++ + L +++        + +     L+ N  RT++         L+++ L G+PL C+C LLW+  L +     SF    P C +P ++     +++ E   K    C  PRIS  +   L     +   L C+A+          V+W+       +  + + ++A     ++ I ++  S    Y CVA N
Sbjct:  249 IDHWPLLETLG----AGSFSSLNLTSLSVTNTNITRVPRLALQTLVHLRTLDLSFNAIASVEAGAFATLT----------------------RLRELRMERTGLLVVEPRALQ--GVEQLGLLNLSGNGLRTLEEGALDSPGLLEVLRLDGNPLACDCRLLWVVAL-NRRGGLSFDGREPSCDAPESVSGAEFADLPEPLPKGYLACRRPRISPRRTQQLTAVEGQAVHLMCRADGDPAPD----VAWLAPWKQRVTPRRSTGRLAVLHDGTLLIRRAQVSDGGPYVCVASN 507          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO31669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXA1])

HSP 1 Score: 56.6102 bits (135), Expect = 2.344e-8
Identity = 72/316 (22.78%), Postives = 132/316 (41.77%), Query Frame = 3
Query:  345 LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRT------IDRNFESIIRNLK--LIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEP--PRISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIKINKSNSGENV--YRCVAENKIG------QSYIVVNLDWPT-KWSLYRNNLSIPIDFTHQLDNYPWAT 1235
            LR L++    +  L R+ FSGLK LR L L  NQI +I  + F         L  +  L L  N  + +         SR ++L  +    + +   +  Y+  + F+       I  +  ++ R  +    ++ G+ L C+C+ LW +     I+    R V   C +P  L+  +L  +++++ KC+P    +S  K       + EL+C     ++ TG ++   +N ++     L     + +++I   +   +V  Y C+A N  G      + YI V   + T    +  +    P+ F    D YP  T
Sbjct:  169 LRLLSLVDNRLTGLTRSMFSGLKSLRELYLQRNQIQDIEPWTF-------TSLKSLASLYLDSNQLTVI---------SRDTLLGLTNVKDIHVYFNKLRYVARDAFKPNPQLTRIVWDVPALFRRTRPEFANMVGNMLHCDCNALWFRDWL--ISHAYTRDV--TCQTPPRLKGVLLGNLNDSDIKCDPVVVTVSPKKKLVREWESVELYC-----NVNTGAVYTWTVNGSAVVLDDLHTINPLGTLQIASVSKLRDVGEYVCIARNAAGFGAASLELYIGVRPKFKTLPVPVEADEPGKPVLFKCSADGYPNPT 459          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO27257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9R6])

HSP 1 Score: 53.1434 bits (126), Expect = 3.627e-8
Identity = 47/186 (25.27%), Postives = 87/186 (46.77%), Query Frame = 3
Query:  345 LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTI-DTLKLNDIGKLKLHRNSFSKLS-LKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSL----LWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            LR L +    ++ + + TF  L  L  LD+S N+I +  + +   L + + L +N+     +  ++  K+  LK L +  + +S +  + F   + S+ Q   L NN  R I  +  S ++ L+ + L G+P  C+C L     WL+     +N N        C++P  L  + L E+  ++ KC
Sbjct:   12 LRKLHVSATGMKKITQGTFGSLMSLEFLDVSFNEIRHFDEESLACLPLLEVLHINNNSLTTVPLHALRKVKFLKELDLSANLISYVSSTAFA--NNSKLQKLLLHNNTIRLIHEDAFSQLKGLRALFLRGNPFQCDCQLNGFHAWLRNNQYLVNFNGHMY----CMTPDKLTGRDLLELSSSDLKC 191          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 54.299 bits (129), Expect = 1.077e-7
Identity = 50/202 (24.75%), Postives = 94/202 (46.53%), Query Frame = 3
Query:  288 FTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPK---CVSPTNLRSKMLSEIDETEFKC 884
            F + TL  ++ T  +T L+LR   +R  +I+           ++ +LDL +N +      AF+ L++  L+L D  KL     +F+K+   +  +  S   + + +    LD+   +   L  NN   I       ++ L+ I L+G+PL C+C L+WLK +  +   +   +  P+   C SP +++ +    +D   F C
Sbjct:  183 FKTETLRGLSST--LTELRLRSNILRRVAIKRRF--------NITLLDLGDNLLEVFEVDAFDGLSLRKLRL-DGNKLDEIPEAFAKVGHFLQELDMSGNYLHEITSDQLLDLHAIERLDLNENNISKIRIGALRGMKKLRQISLSGNPLSCDCRLVWLKHVLDS-RQDQLHLSSPQSTTCASPASVKGQTFLGLDARSFLC 372          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ8])

HSP 1 Score: 50.0618 bits (118), Expect = 9.721e-7
Identity = 59/228 (25.88%), Postives = 97/228 (42.54%), Query Frame = 3
Query:  300 TLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN--IHDFAFEHL-TIDTLKLNDIGKLKLHRNSFSKLS----LKVLSIKNSRLSILDYSVFM------QLDIS----------------RFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSL----LWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKC 884
            T+S     G+++   L  L +R   ++ L R  F  LK LR L L +N+ +   I + AF  L  +  L ++  G  K+ + +F  L     L VL I N+ L+ +            +LD+S                + Q   L NN  R I  +  S ++ L+ + L G+P  C+C L     WL+     +N N        C++P  L  + L E+  ++ KC
Sbjct:   56 TVSASMFKGLVS---LEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVLHINNNSLTTVPLHALRKVKFLKELDLSANLISYVSSTAFANNSKLQKLLLHNNTIRLIHEDAFSQLKGLRALFLRGNPFQCDCQLNGFHAWLRNNQYLVNFNGHMY----CMTPDKLTGRDLLELSSSDLKC 276          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc4ba (leucine rich repeat containing 4B [Source:NCBI gene;Acc:101164310])

HSP 1 Score: 82.8037 bits (203), Expect = 3.616e-16
Identity = 71/252 (28.17%), Postives = 117/252 (46.43%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAF------EHLTIDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+DL    F+ +  LR LDL E + L+ I D AF       +L +    L DI KL                  +   SF  L +L+ L + +S++S+++ + F   D+   +   L++N+  ++  +  + +  L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W+  N 
Sbjct:  142 KLRELWLRNNPIEDLPGYAFNRVPSLRRLDLGELKKLDFISDAAFVGLVNLRYLNLGMCGLKDIPKLTALERLEELELSGNRLEIIRPGSFQGLGALRKLWLMHSQVSVIERNAFD--DLKNLEELNLSHNSLHSLPHDLFTPLHQLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPILKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-----STSTTSVNWITPNG 384          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrfn4b (leucine-rich repeat and fibronectin type-III domain-containing protein 4 [Source:NCBI gene;Acc:105356388])

HSP 1 Score: 80.8777 bits (198), Expect = 9.113e-16
Identity = 96/371 (25.88%), Postives = 162/371 (43.67%), Query Frame = 3
Query:  156 VYNECPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTSNTLSP-VNMTGIIT-TLK-----------------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEH--LTIDTLKLNDIGKLKLHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTI--DRNFESIIRNLKL-----IDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIKINKSN------SGENVYRCVAENKIGQSYIVVNL 1145
            V + CP  C VC  L+++L  +C + G    P      T  + L  ++ T    +  VNM+G++  TL                  LR L + G  +  +     +GL +L+ L ++ NQ++ +   AF+   LT++ L L+     K+   S   + SL  L++ ++ +  +   VF +L   +     +T+N  RT+  D  F   I          ++  G+PL CNC LLWL+RLA   +  +       C +P +L ++    I E EF CEPP I+    K+  L    A L C+A    I   +  V W+   S D+  +  S + +S      +        +  Y C+A N  G++   V+L
Sbjct:   10 VVSACPFHC-VCRNLSESLSTLCADKGLLFVPPHVDRRTVELRLADNFITEVGGNDFVNMSGLVDLTLSRNTIHLIRPMAFADLESLRSLHLDGNRLTTIGPRDLAGLVNLQHLIINNNQLVKVSTQAFDDFLLTLEDLDLSYNNLRKVPWESIQNMASLHTLNLDHNLIDNIAEGVFGEL--YKLARLDMTSNRLRTLPPDPLFTGAISPTPYNAVISLNFGGNPLHCNCELLWLRRLARGDDMET-------CATPAHLAARYFWTIPEEEFTCEPPLITRHTHKLWVLEGQRATLKCRA----IGDPEPVVHWV---SPDDRIVANSSRTSSFSNGTLDMLVTVARDDGAYTCIAINAAGEATATVDL 363          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc4bb (leucine-rich repeat-containing protein 4B [Source:NCBI gene;Acc:101159140])

HSP 1 Score: 78.9518 bits (193), Expect = 6.079e-15
Identity = 71/252 (28.17%), Postives = 113/252 (44.84%), Query Frame = 3
Query:  342 KLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILN-IHDFAFEHLT------IDTLKLNDIGKLK-----------------LHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLK-RLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNS 1013
            KLR L +R   I+ L    F  +  LR LDL E + L+ I + AFE L       +    L DI  L                  +   SF  L SL+ L + +SR+S+++ + F +L     +   L++N+  ++  +  + +  L+ + L  +P VCNC +LWL   L  T+ SN+      +C +P  L+ K + E+D++ F C  P I E    +N      AEL C+       T    V+W   N 
Sbjct:  141 KLRELWLRNNPIETLGAFAFHRVPSLRRLDLGELRKLDFISEAAFEGLVNLRFLNLGMCGLKDIPNLTPLVKLEELELSGNQLGIVRPGSFQGLVSLRKLWLMHSRVSVIERNAFDEL--KSLEELNLSHNSLHSLPHDLFTPLHQLERVHLNHNPWVCNCDVLWLSWWLKETVPSNT--TCCARCHAPPGLKGKYIGELDQSHFPCYAPVIVEPPTDLNVTEGMAAELKCRT-----GTSMTSVNWFTPNG 383          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrfn2b (leucine-rich repeat and fibronectin type-III domain-containing protein 2 [Source:NCBI gene;Acc:101157661])

HSP 1 Score: 78.1814 bits (191), Expect = 1.287e-14
Identity = 95/376 (25.27%), Postives = 161/376 (42.82%), Query Frame = 3
Query:  144 AVGYVYNECPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHY-------------------FTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHL--TIDTLKLNDIGKLKLHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDI--------SRFQFFYLTNNNFRTIDRNFESIIRNLKL-IDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEI--KINFLNHFTAELFCKAEIKSIKTGQ--IFVSWMNNNS--HDESSLKKSEKIASIKINKSNSGEN-VYRCVAENKIGQSYIVVNL 1145
            A   + + CPK C VC  L+++L  +C + G    P+     T  + L G+Y                    + NT+S +          LR L +    +  +  + F GL +L+ L L+ NQ+  IHD AFE     ++ L L+    + L  NS  ++ +L  LS  ++ L  +    F  L++        +R Q         R  D    S     +L + L G+PL CNC +LWL+RL      N        C SP  L+ +   ++ E EF C+PP   +   K+  L   TA L C+A      TG     + W++ +      SS  +  +  +++I  ++S ++ ++ C+A N  G++   V +
Sbjct:   13 ATVMIVHACPKYC-VCQNLSESLGTLCPSKGLLFVPSDIDRSTVELRLGGNYILHITQQDFANMSDLVDLTLSRNTISYIQPFSFSDLETLRSLHLDNNRLTKIGSDDFRGLVNLQHLVLNNNQLGRIHDKAFEDPMGALEDLDLSYNNLVSLPWNSVRQMVNLHQLSADHNLLEFIPEGTFADLEMLERVDLASNRLQKLPPDPIFARAQDLPTLSTPETAQLSLSLGGNPLHCNCEMLWLRRLD---RENDLET----CASPPPLKGRHFWDVKEEEFVCQPPLFIQQTHKVVVLEGQTATLRCEA------TGDPSPAIHWISPDDLLLGNSSRTQVYRNGTMRIPITSSKDHGIFTCIAANVAGETTASVEV 374          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: LRFN2 (leucine-rich repeat and fibronectin type-III domain-containing protein 2 [Source:NCBI gene;Acc:101169650])

HSP 1 Score: 77.7962 bits (190), Expect = 1.575e-14
Identity = 98/380 (25.79%), Postives = 166/380 (43.68%), Query Frame = 3
Query:  147 VGYVYNECPKICSVC--LAKTL--ICENGGFTEFPTKFLSETENITLIGHYFTSNTLSP-VNMTGI---------ITTLK---------LRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKL----NDIGKLKLHRNSFSKL-SLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTID------RNFESIIRNLKL-----IDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISE--IKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKI-----ASIKINKSNSGE-NVYRCVAENKIGQSYIVVNL 1145
               V + CPK C VC  L+++L  +C   G    P      T  + L G++    T     NMTG+         I+T++         LR L +    + +L  +   GL +L+ L L+ NQ+  I   AF+ L +    L    N++  +     +  K+ +L  +S+ ++ +S +    F   D+ +     LT+N  + +       R+  S+I +        + L G+PL CNC +LWL+RL    +  +       C SPTNL+ +    + E EF CEPP I++   K+  L   TA L CKA    + T    V W+   + D+  +  S +       ++ I  + S +   + C+A N  G+S   + L
Sbjct:   14 AAVVVHACPKYC-VCQNLSESLGTLCPAKGLLFVPPDIDRRTVELRLGGNFILKITTQDFANMTGLVDLTLSRNTISTIQPFSFIDLETLRSLHLDSNRLTELGPDDLRGLINLQHLILNNNQLGRISKTAFDDLLLTLEDLDLSYNNLRSVPWE--AVRKMVNLHQMSLDHNLISFIAEGTFT--DLEKLARLDLTSNRLQKLPPDPIFARSQSSMIMSTPYAPPLSLSLGGNPLHCNCEVLWLRRLDREDDMET-------CASPTNLKGRYFWSVREEEFVCEPPLITQHTHKLLVLEGQTASLRCKAIGDPMPT----VHWV---APDDRLISNSSRATVYDNGTLDITVTTSKDYGTFTCIAANAAGESTASIEL 374          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000044415.1 (SMESG000044415.1)

HSP 1 Score: 1009.21 bits (2608), Expect = 0.000e+0
Identity = 491/492 (99.80%), Postives = 491/492 (99.80%), Query Frame = 3
Query:  141 SAVGYVYNECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWPTKWSLYRNNLSIPIDFTHQLDNYPWATTFYFKKRYTLVELIVAVISTFITTIVMFVIAYKICTQSSGCIGLSGKPYISHQKLMTHQKGFCNGYPPFRFNTADNGLHTTESNSQTYDCISINNALYPHQLSNTLPGPFIDYKTHERVYSPNIVVE 1616
            SAVGYVYNECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSI NSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWPTKWSLYRNNLSIPIDFTHQLDNYPWATTFYFKKRYTLVELIVAVISTFITTIVMFVIAYKICTQSSGCIGLSGKPYISHQKLMTHQKGFCNGYPPFRFNTADNGLHTTESNSQTYDCISINNALYPHQLSNTLPGPFIDYKTHERVYSPNIVVE
Sbjct:    9 SAVGYVYNECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSITNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTINSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWPTKWSLYRNNLSIPIDFTHQLDNYPWATTFYFKKRYTLVELIVAVISTFITTIVMFVIAYKICTQSSGCIGLSGKPYISHQKLMTHQKGFCNGYPPFRFNTADNGLHTTESNSQTYDCISINNALYPHQLSNTLPGPFIDYKTHERVYSPNIVVE 500          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000001555.1 (SMESG000001555.1)

HSP 1 Score: 254.988 bits (650), Expect = 5.796e-77
Identity = 185/534 (34.64%), Postives = 277/534 (51.87%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGII-TTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWL-KRLASTI--------------NSNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTAELFC--KAEIKSIK-------------TGQIF--VSWMNNNSHDESSLKKSEKIAS----IKINKS-NSGENVYRCVAENKIGQSYIVVNLDWP----TKWSLYRNNLSIPIDFTHQLDNYPWAT----TFYFKKRYTLVELIVAVISTFITTIVMFVIAYKICTQSSGCIGLSGKPYISHQ---KLMTHQKGFCNGY--PPFRFNTADNGLHTTESNSQTYDCISINNALYPHQ-------LSNTLPGPFIDYKTHERVY 1595
            CP  CS+CL   + C  G  T  P +   +TE ITL G       LS  N T +     ++  L+IR CSI +L  +TFS L  L+ILDLSENQ L I   +F  L +  LKL+DIGKL L  +SFS LS + LS+K SRL  L++++F  +  S  +   + NN  + +D++FE +   L+ ++L  +  +C C LLWL K L S +              +SNS    FPKCV PT LR + L  I E+EF C+ P+I++I+I+ L+ F   + C  K E K  K              G++F  V   + N+ D  SL ++  IA     IK +   N  +  + CVAENK G+S + V + WP    +  S   N+ +   +     D+Y W T    +++F K+YTL+E+  A+  TF+ T+V+F++ YK   +       SGKP + +    +L +  K     +  P   +   +  +H ++ NSQTYD I  +NA+YP Q       +SN+    FIDYKTH+ +Y
Sbjct:   28 CPMHCSICLPSHISCTTGSLTSIPNQLQPKTETITLSGQLQFHPVLSSANFTDLAYPKYQIHTLSIRSCSIYELSSHTFSQLVMLKILDLSENQRLTIMSSSFSGLHLKVLKLDDIGKLMLSPDSFSDLSTESLSMKASRLQSLNFNIFQPISHS-LKHLNIENNQIKILDQSFEPLFYRLESVNLKDNTFICYCDLLWLSKALRSKLSFYKSQNRFSDGKADSNSDVNNFPKCVGPTYLRDRQLQTISESEFNCQVPQIAQIEIDLLSVFGGMMSCSIKPEEKGHKIPTKVFWEKQHPQNGKVFQRVYEKSQNAVDGFSLLENNGIAEFSSKIKFDSDRNKNQENFNCVAENKAGRSLVSVQISWPKFNNSLDSSQPNSPTTESEKKQPTDHYQWNTPNQKSYFFTKQYTLLEMTAAIAGTFMITVVIFLVFYKFYFRKRNGYK-SGKPSMKYSIAAELPSSNKRSLMAFHGPRGGYTVYETSMHYSD-NSQTYDSIP-HNAVYPQQQQPLFSTISNSPSAHFIDYKTHKNLY 557          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000079433.1 (SMESG000079433.1)

HSP 1 Score: 216.083 bits (549), Expect = 6.350e-63
Identity = 158/506 (31.23%), Postives = 258/506 (50.99%), Query Frame = 3
Query:  165 ECPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIIT-TLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWL-----KRLASTIN---SNSFRIV-FPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNN---SHDESSLKKS---EKIASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWPTKWSLYRNNLSIPIDFTHQLDNYPW--------ATTFYFKKRYTLVELIVAVISTFITTIVMFVIAYKICTQSSGCIGLSGKPYISHQKLMTHQKGFCNGYPPFRFNTADNGLHTTESNSQTYDCISINN------ALYPHQLSNTLPGPFIDYKTHERV 1592
            +CPK+C +C    L C  GG    PT     T  ITLIGH F S++LS  N +G       +  L+IR  +I+ + ++TF  L  L  LDLSEN+ + I + AF +L +  LKL+ I  L L R +F  L++  LS+KNS L  L + +   +  +  +  +L+NN+   +D+ FE +I  L  +DL G+P  C C L+WL     KR+   +    SNS + V FP C  P +++ K +  I E EF CEPP +  I I F N    +L C A++   K   I V W   +   S  +S L+K+   E   ++ + + +S  N+Y+C+A++  G + I V ++WP        N + P++      N  W           F+F++++TL+E++ AV+ TF  T+ +F++ Y+ C +++  +          +K  + +K   + Y P  +           S+SQTYD +  NN      AL  + LS+  P  ++DY+T +R+
Sbjct:   24 KCPKVCIICFNDHLSCTTGGLLSIPTNIHESTTKITLIGHEFLSSSLSKSNFSGFFKPKYSIEQLSIRQSNIKVIEKDTFYDLSGLDNLDLSENKAIIIRNKAFNNLKLKHLKLDQIQGLVLERGAFDGLAVTSLSMKNSSLKTLSFDLMRPIS-NNLRSLFLSNNHISELDQKFEPLITQLSHLDLTGNPFQCTCKLVWLSRALEKRMGLGLELEFSNSGQYVNFPLCAGPAHVKDKYIHNITEAEFSCEPPSLDVIDIQFENLDIVKLKCSAKL-PFKAAPIQVYWQEISDPFSLKDSQLEKNPNDETNLAVTVIRKSSSVNLYQCLAKSSSGNATIRVTINWPPVI-----NRTKPLENNTPNSNNNWFGQSNKQTEKNFFFREQFTLLEMLGAVMGTFTVTLTIFLLLYRFCVKATSKV----------KKANSLKKSGYSIYEPAIY-----------SDSQTYD-VPQNNYQIQSPALINNTLSSNTPSHYLDYRTQQRI 500          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000021154.1 (SMESG000021154.1)

HSP 1 Score: 196.052 bits (497), Expect = 1.584e-55
Identity = 138/409 (33.74%), Postives = 218/409 (53.30%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGII-TTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWL------KRLASTINSNSF-RIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNNNSHDE-----SSLKKSEKIASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWPTKWSL-YRNNLSIPIDFTHQLDNYPWATTFY-----FKKRYTLVELIVAVISTFITTIVMFVIAYKI 1337
            CP +C+ CL   + CENGG    PT+   ET  + L+GH F+   LS  N +        +  L+IR  +IQ +   TF  +  L  LD SEN  L I + AF++L +  LKL+ IG L+   ++F  L +  L+I  S L  L Y +   L     +  +L+NN   ++   FES+ R L ++DL G+P +C+C++LWL      ++     N+NSF    FPKC  P  L ++ L EI ETEF C PP++  I++ F +  +A L C A ++S K   + +SW+  +S +       S K +E  A I+I + +  +  Y C   +  G + + VN +WPT  ++  R N SI   F  +     W T +Y     F+++YTL+EL+ +++ TFI TI++F++ YK 
Sbjct:   35 CPNVCTPCLEHAITCENGGLDGIPTELYEETTRVILVGHKFSQTFLSRQNFSKFTKPKYSIEQLSIRRSNIQIIRSQTFYDVSGLDFLDFSENLKLYIENRAFDNLKLKHLKLDFIGNLEFSEDAFQGLLVASLTIAKSHLQALPYRLIEPLS-RELRSLFLSNNKLTSLSSKFESLFRQLTILDLHGNPFICSCNMLWLGVTLKWRQNYYRSNTNSFSEPQFPKCDKPYYLLNQYLYEIPETEFNCRPPKLDRIEVQFKSQQSAVLKCAASLES-KRAPMKISWLYLSSKEYVPNLLPSSKSNE--AEIEITQKHYIDQ-YFCSVSSAAGNASVKVNFNWPTVTNIRQRPNNSIDEYFVTKPT---WKTNYYQENYFFREQYTLLELLGSILGTFIITILIFILIYKF 435          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000018621.1 (SMESG000018621.1)

HSP 1 Score: 171.014 bits (432), Expect = 2.699e-46
Identity = 139/504 (27.58%), Postives = 240/504 (47.62%), Query Frame = 3
Query:  168 CPKICSVCLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGI-ITTLKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTIDTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQFFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWL------KRLASTINSNSFR---IVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTAELFCKAEIKSIKTGQIFVSWMNN-------------NSHDESSLKKSEKIASIKINKSNSGENVYRCVAENKIGQSYIVVNLDWPTKWSLYRNNLSIPIDFTHQLDNYPWAT--TFYFKKRYTLVELIVAVISTFITTIVMFVIAYKICTQSSGCIGLSGKPYISHQKLMTHQKGFCNGYPPFRFNTADNGLHTTESNSQTYDCIS---INNALYPHQLSNTLPGPFIDYKTHERVY 1595
            C K C  C+  ++ C   GF E P +    T+   LI   FT+N LS  N+T I    + L YL IR  +I+ +   TFS L  LR LDL+ N  L I   +F  L +  LKL++   LK   N+F  L+++ L +  S +  L Y +   + +   +  ++ NNN  ++D  F+   +NL+ + L G+   C+CS+ WL      +      N  +F      FP C  P  +  K + EI  + F C+PP ++++KI+F +    EL C A ++ +    + V+W  +             NS    +  ++  + ++ I K+NS ++ ++C+A+N  G +  +V + WP        N ++   +   +D++  +    ++F+KR+TL+E+  AV  TF  T+++F + YK               +I+     T +K      PP  + T +  ++   S+SQTYD        + L P    ++ P  FID+KT +R Y
Sbjct:   25 CGKFCDACVEDSISCTKPGFKEMPQQMSKTTKRFILISQQFTNNFLSRENLTKISPPNVFLEYLTIRKSNIKLIKPMTFSDLTVLRALDLTYNNNLFIDSGSFSGLKLKLLKLDNNDNLKFSINAFVDLTVESLHMSQSSIFDLPYDLLKPI-LPFLKKLFINNNNLISLDPRFQIPFKNLQTLYLQGNSFDCSCSMKWLTAVYVYRTTNGKYNKGTFTDEIQSFPTCKEPKYMEGKHMHEIPLSLFNCDPPNLTQLKIDFQSATETELSCSA-VQKVDQAPMTVNWFTDIINGIGEKMFSILNSKSNPTTDRNVHVETVLIQKNNSTDS-FQCIAKNLNGNATAIVRISWPPSEKFPNPNRNV---YQSTIDSWQKSEEDNYFFQKRFTLLEMFGAVFGTFAITLILFFMIYKFV-------------FINRS---TDRKAIL---PPNGYTTYEAAVY---SDSQTYDIPGNSYPQSVLLPMPHLSSTPDHFIDFKTQKRFY 500          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRFN41.068e-1626.02leucine rich repeat and fibronectin type III domai... [more]
LRFN41.642e-1626.02leucine rich repeat and fibronectin type III domai... [more]
LRFN28.919e-1426.80leucine rich repeat and fibronectin type III domai... [more]
LRRC4B2.203e-1326.19leucine rich repeat containing 4B [Source:HGNC Sym... [more]
LRRC4B2.203e-1326.19leucine rich repeat containing 4B [Source:HGNC Sym... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pxn-27.007e-1224.00PeroXidasiN (Drosophila peroxidase) homolog [Sour... [more]
pan-11.399e-931.14P-granule-associated novel protein 1 [Source:UniP... [more]
slt-16.430e-723.44Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sli2.865e-1826.69gene:FBgn0264089 transcript:FBtr0330734[more]
sli5.155e-1826.69gene:FBgn0264089 transcript:FBtr0330733[more]
sli5.155e-1826.69gene:FBgn0264089 transcript:FBtr0330731[more]
sli5.643e-1826.10gene:FBgn0264089 transcript:FBtr0330729[more]
sli5.643e-1826.10gene:FBgn0264089 transcript:FBtr0330732[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4ba3.259e-1527.78leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba4.631e-1527.78leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba5.143e-1527.78leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba5.143e-1527.78leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba5.272e-1527.78leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rrn31.679e-1425.08RRN3 homolog, RNA polymerase I transcription facto... [more]
oaz11.052e-1323.94ornithine decarboxylase antizyme 1 [Source:Xenbase... [more]
lrrc4b1.404e-1327.38leucine rich repeat containing 4B [Source:NCBI gen... [more]
slit14.917e-1325.69slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
LRRC4C5.119e-1325.16leucine rich repeat containing 4C [Source:NCBI gen... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrfn43.577e-1826.36leucine rich repeat and fibronectin type III domai... [more]
Lrfn43.577e-1826.36leucine rich repeat and fibronectin type III domai... [more]
Slit18.305e-1526.64slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
Lrfn22.239e-1427.12leucine rich repeat and fibronectin type III domai... [more]
Slit11.170e-1325.82slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D4ABX8|LRFN4_RAT2.081e-1726.36Leucine-rich repeat and fibronectin type-III domai... [more]
sp|Q80XU8|LRFN4_MOUSE2.502e-1726.36Leucine-rich repeat and fibronectin type-III domai... [more]
sp|P24014|SLIT_DROME5.168e-1726.69Protein slit OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q6PJG9|LRFN4_HUMAN7.886e-1626.02Leucine-rich repeat and fibronectin type-III domai... [more]
sp|Q80TG9|LRFN2_MOUSE1.566e-1327.12Leucine-rich repeat and fibronectin type-III domai... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5P8I4L06.723e-4227.72PXDN-like protein OS=Schmidtea mediterranea OX=793... [more]
A0A0X3NXX24.056e-3225.00Protein slit OS=Schistocephalus solidus OX=70667 G... [more]
I1ZIL51.146e-3025.20Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
W6U6F31.363e-3026.79Immunoglobulin superfamily member OS=Echinococcus ... [more]
A0A0R3SAT86.133e-3025.61Ig-like domain-containing protein OS=Hymenolepis d... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4ba6.110e-1527.38leucine-rich repeat-containing protein 4B-like [So... [more]
lrrc4ba6.110e-1527.38leucine-rich repeat-containing protein 4B-like [So... [more]
lrrc4ba7.570e-1527.38leucine-rich repeat-containing protein 4B-like [So... [more]
lrfn4b1.920e-1425.86leucine rich repeat and fibronectin type III domai... [more]
lingo2a4.141e-1425.14leucine rich repeat and Ig domain containing 2 [So... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pxdn7.928e-1423.64peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
lrfn5a1.708e-1326.28leucine rich repeat and fibronectin type III domai... [more]
lrrc4ba6.424e-1323.43leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrn12.894e-1022.89leucine rich repeat neuronal 1 [Source:ZFIN;Acc:ZD... [more]
LINGO24.655e-1022.95leucine rich repeat and Ig domain containing 2 [So... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO316692.344e-822.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272573.627e-825.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471091.077e-724.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354079.721e-725.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4ba3.616e-1628.17leucine rich repeat containing 4B [Source:NCBI gen... [more]
lrfn4b9.113e-1625.88leucine-rich repeat and fibronectin type-III domai... [more]
lrrc4bb6.079e-1528.17leucine-rich repeat-containing protein 4B [Source:... [more]
lrfn2b1.287e-1425.27leucine-rich repeat and fibronectin type-III domai... [more]
LRFN21.575e-1425.79leucine-rich repeat and fibronectin type-III domai... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044415.10.000e+099.80SMESG000044415.1[more]
SMESG000001555.15.796e-7734.64SMESG000001555.1[more]
SMESG000079433.16.350e-6331.23SMESG000079433.1[more]
SMESG000021154.11.584e-5533.74SMESG000021154.1[more]
SMESG000018621.12.699e-4627.58SMESG000018621.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000261 ID=SMED30000261|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1793bp
TGAAGTTTCAAGATTGTTTAAAATATTGATTTTCAAAAATGAAGATTTCA
TTTCTCATACTGCGCTGCCCGGGCTGTTTACTTATCAAGATCAACAGCAT
TTCCGATCTATTGAACATGCTGTTCATGCTTTTATTGTTTTCTGCTGTCG
GGTATGTTTACAATGAGTGCCCAAAAATTTGCAGTGTCTGCTTAGCTAAA
ACATTAATCTGTGAAAATGGAGGTTTCACGGAATTTCCAACGAAGTTTCT
CTCGGAAACAGAAAACATAACCTTGATTGGACATTATTTCACTAGCAACA
CCTTATCCCCAGTCAACATGACGGGCATTATAACAACTCTAAAACTGAGA
TATTTAGCAATTCGCGGTTGCAGCATTCAAGATTTATTACGAAACACATT
TTCCGGTTTGAAGGATTTGAGGATTCTCGATTTGTCGGAAAATCAGATTT
TAAACATCCACGATTTTGCCTTTGAACATCTGACAATTGACACCCTGAAA
CTGAATGACATTGGTAAACTGAAACTCCACAGAAATTCGTTTTCGAAATT
GTCATTGAAAGTTTTGTCTATAAAAAATTCTCGGTTGAGCATTTTAGATT
ATTCGGTTTTCATGCAGCTCGACATCAGCCGGTTTCAGTTTTTCTACTTG
ACCAACAACAACTTTCGCACAATTGATCGGAATTTCGAGTCGATCATCAG
AAACCTGAAACTGATTGATCTGGCTGGCAGTCCTTTGGTGTGCAATTGTT
CTCTGTTGTGGCTGAAAAGATTGGCTTCAACGATCAATTCGAACTCTTTT
CGGATAGTCTTTCCGAAATGTGTCAGTCCGACAAATCTCCGTTCGAAAAT
GCTGTCAGAAATCGACGAAACCGAATTCAAGTGCGAGCCGCCGAGAATTT
CGGAAATCAAAATCAACTTTCTCAATCATTTCACTGCTGAATTGTTTTGC
AAAGCGGAAATCAAATCCATCAAAACCGGACAGATCTTTGTTTCGTGGAT
GAATAATAATTCCCACGATGAAAGTTCGCTGAAAAAGTCGGAGAAAATCG
CTTCAATAAAAATAAACAAATCGAATTCCGGGGAAAATGTTTACCGATGC
GTTGCGGAAAACAAAATCGGCCAATCGTATATTGTTGTCAACTTAGATTG
GCCGACAAAATGGAGTCTTTATCGGAACAATCTCTCAATACCGATAGATT
TCACTCATCAATTGGACAATTACCCATGGGCGACTACGTTTTACTTCAAA
AAAAGATACACATTAGTTGAGCTTATCGTGGCGGTCATCAGCACATTCAT
AACGACAATTGTTATGTTCGTTATCGCTTATAAGATTTGTACACAAAGCT
CCGGATGTATCGGACTGTCCGGAAAACCTTATATCAGTCATCAAAAGTTG
ATGACACATCAGAAAGGATTTTGCAATGGATATCCGCCATTCCGATTCAA
TACGGCAGACAACGGATTGCATACCACAGAATCCAACAGTCAGACCTACG
ACTGCATTTCTATCAACAATGCCTTGTATCCTCACCAATTATCAAATACA
CTTCCCGGCCCATTCATTGACTATAAAACCCATGAACGGGTTTATTCTCC
GAATATCGTTGTTGAATAAATTCTTTTATCGTAATTTTTTTTATGTTGTT
CACTTTTGAAAGTTTTATCTGTTATTGGACTGTACATAGAGGCTACATTC
GGATAAATCATGAATACAATATTGTAATAACTGTACATTATAATAGATTT
TTAATGCGTTGTTGACAGAGACTATATTACATTTATCATAAAA
back to top

protein sequence of SMED30000261-orf-1

>SMED30000261-orf-1 ID=SMED30000261-orf-1|Name=SMED30000261-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=527bp
MKISFLILRCPGCLLIKINSISDLLNMLFMLLLFSAVGYVYNECPKICSV
CLAKTLICENGGFTEFPTKFLSETENITLIGHYFTSNTLSPVNMTGIITT
LKLRYLAIRGCSIQDLLRNTFSGLKDLRILDLSENQILNIHDFAFEHLTI
DTLKLNDIGKLKLHRNSFSKLSLKVLSIKNSRLSILDYSVFMQLDISRFQ
FFYLTNNNFRTIDRNFESIIRNLKLIDLAGSPLVCNCSLLWLKRLASTIN
SNSFRIVFPKCVSPTNLRSKMLSEIDETEFKCEPPRISEIKINFLNHFTA
ELFCKAEIKSIKTGQIFVSWMNNNSHDESSLKKSEKIASIKINKSNSGEN
VYRCVAENKIGQSYIVVNLDWPTKWSLYRNNLSIPIDFTHQLDNYPWATT
FYFKKRYTLVELIVAVISTFITTIVMFVIAYKICTQSSGCIGLSGKPYIS
HQKLMTHQKGFCNGYPPFRFNTADNGLHTTESNSQTYDCISINNALYPHQ
LSNTLPGPFIDYKTHERVYSPNIVVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0005578proteinaceous extracellular matrix
GO:0005615extracellular space
GO:0005886plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007409axonogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 102..155
e-value: 1.8E-7
score: 30.8
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 126..147
score: 8.035
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 44..160
e-value: 1.4E-12
score: 49.1
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 161..284
e-value: 3.7E-17
score: 64.2
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 26..496
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 53..287
NoneNo IPR availableTMHMMTMhelixcoord: 409..431
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 285..370
score: 7.758