Ras-related protein Rab-11A

Overview
NameRas-related protein Rab-11A
Smed IDSMED30000248
Length (bp)864
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-11A (SMED30000248) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-11A (SMED30000248) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-11A (SMED30000248) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-11A (SMED30000248) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000248

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000248SMESG000057130.1 Contig2392GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000248SMESG000016036.1 Contig2392GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30000248SMESG000016036.1 dd_Smed_v4_4964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000248SMESG000016036.1 dd_Smed_v4_4964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30000248SMESG000016036.1 dd_Smed_v4_4964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000248SMESG000016036.1 dd_Smed_v4_4964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30000248SMESG000016036.1 dd_Smed_v4_4964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000248SMESG000016036.1 dd_Smed_v4_4964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000248SMESG000016036.1 dd_Smed_v4_4964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30000248SMESG000016036.1 dd_Smed_v4_4964_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000248SMESG000016036.1 dd_Smed_v4_4964_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB11A (RAB11A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9760])

HSP 1 Score: 207.223 bits (526), Expect = 3.315e-66
Identity = 90/175 (51.43%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++NG+ ++ETSA +S NVE AF  ++ E+Y++ S
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB11B (RAB11B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9761])

HSP 1 Score: 205.297 bits (521), Expect = 2.634e-65
Identity = 89/175 (50.86%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF  ++ E+Y++ S
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB11B (RAB11B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9761])

HSP 1 Score: 196.823 bits (499), Expect = 1.407e-62
Identity = 86/163 (52.76%), Postives = 131/163 (80.37%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAF 613
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAF 165          
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB25 (RAB25, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:18238])

HSP 1 Score: 193.741 bits (491), Expect = 6.191e-61
Identity = 90/210 (42.86%), Postives = 144/210 (68.57%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNS---SFTDKISNCC 754
            + Y+++FK+V++GESGVGKTNL+SRFT+N+F+ D+ +TIGVEF+++ V +    +KAQ+WDTAG ERY+A+ +AYYR  +G LLVFDL K  ++  + RWLK + D+     V+ L+GNK+DLS  REV +EEA+++A+ NG+ ++ETSA +S NVE AF  ++ E++   S       +  N+++ + ++L +  +       +   CC
Sbjct:    7 EDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVS------KQRQNSIRTNAITLGSAQAGQEPGPGEKRACC 210          
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Match: RAB14 (RAB14, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16524])

HSP 1 Score: 179.489 bits (454), Expect = 9.089e-56
Identity = 79/167 (47.31%), Postives = 122/167 (73.05%), Query Frame = 2
Query:  143 YDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            Y Y+FK +++G+ GVGK+ L+ +FT+ +F +D   TIGVEF ++I+EV G+ IK Q+WDTAGQER++AV  +YYR   G L+V+D+ +RS++ +L+ WL + ++   P   +ILIGNK DL  +R+V+ EEAK +A+ENG+ ++E SA   ENVE AF+E   ++Y+
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQ 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: rab-11.1 (Ras-related protein rab-11.1 [Source:UniProtKB/Swiss-Prot;Acc:O01803])

HSP 1 Score: 209.149 bits (531), Expect = 2.382e-67
Identity = 92/172 (53.49%), Postives = 136/172 (79.07%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            S+ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ + VEGK +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+  +  VI L+GNK+DL + R V ++EAK+YA+ N + ++ETSA +S NVE AF  ++ E+YK
Sbjct:    3 SRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSISVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHVTYENVERWLKELRDHADQNIVIMLVGNKSDLRHLRAVPTDEAKIYAERNQLSFIETSALDSTNVEAAFTNILTEIYK 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: rab-11.1 (Ras-related protein rab-11.1 [Source:UniProtKB/Swiss-Prot;Acc:O01803])

HSP 1 Score: 209.149 bits (531), Expect = 2.382e-67
Identity = 92/172 (53.49%), Postives = 136/172 (79.07%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            S+ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ + VEGK +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+  +  VI L+GNK+DL + R V ++EAK+YA+ N + ++ETSA +S NVE AF  ++ E+YK
Sbjct:    3 SRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSISVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHVTYENVERWLKELRDHADQNIVIMLVGNKSDLRHLRAVPTDEAKIYAERNQLSFIETSALDSTNVEAAFTNILTEIYK 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: rab-11.2 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q1ZXR4])

HSP 1 Score: 183.726 bits (465), Expect = 1.108e-57
Identity = 92/207 (44.44%), Postives = 139/207 (67.15%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            + Y Y+FKIV++G  GVGK+NL+SRFT+N+F   +  TIGVEF +KI+ VEGK +K Q+WDTAG ER++  A++YYR  +G LLV+D++K  ++ ++ +WLK ++D+  +  VI L+GNK+DLS+   V ++EAK+YA+ N + ++ETSA ++ NVE AF  +V E+YKL S     +   + T+   T S   KN         CC
Sbjct:    3 NEYYYLFKIVLIGNPGVGKSNLLSRFTRNEFNLKSKPTIGVEFATKIISVEGKAVKVQIWDTAGMERFRCGASSYYRGALGALLVYDISKHKTYESVEQWLKVLRDHANEDIVITLVGNKSDLSHA--VPTDEAKIYAERNHISFIETSALDNTNVEAAFTNIVTEIYKLVSEK---YKDHSGTIIPSTASNTPKN--------QCC 196          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 179.104 bits (453), Expect = 1.133e-55
Identity = 77/168 (45.83%), Postives = 120/168 (71.43%), Query Frame = 2
Query:  140 SYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            +Y Y+FK +++G+ GVGK+ L+ +FT+ +F +D   TIGVEF ++I+EV G+ IK Q+WDTAGQER++AV  +YYR   G L+V+D+ +RS++ +L+ WL + +    P   + LIGNK DL ++R+V  EEAK +A+ENG+ ++E SA    NVE AF+E   ++Y+
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKTGSNVEDAFLETAKQIYQ 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 179.104 bits (453), Expect = 1.133e-55
Identity = 77/168 (45.83%), Postives = 120/168 (71.43%), Query Frame = 2
Query:  140 SYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            +Y Y+FK +++G+ GVGK+ L+ +FT+ +F +D   TIGVEF ++I+EV G+ IK Q+WDTAGQER++AV  +YYR   G L+V+D+ +RS++ +L+ WL + +    P   + LIGNK DL ++R+V  EEAK +A+ENG+ ++E SA    NVE AF+E   ++Y+
Sbjct:    7 NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKTGSNVEDAFLETAKQIYQ 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab11 (gene:FBgn0015790 transcript:FBtr0084011)

HSP 1 Score: 213.772 bits (543), Expect = 4.167e-69
Identity = 97/211 (45.97%), Postives = 151/211 (71.56%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTV-SLNNKNSSFTDKISNCC 754
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ +EV+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWL+ ++D+  +  VI L+GNK+DL + R V ++EAKL+A+ NG+ ++ETSA +S NVE AF  ++ E+Y++ S          + ++   V  ++ K +   D    CC
Sbjct:    3 AREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPIDVKPTVTADVRKQCC 213          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab11 (gene:FBgn0015790 transcript:FBtr0084010)

HSP 1 Score: 213.772 bits (543), Expect = 4.167e-69
Identity = 97/211 (45.97%), Postives = 151/211 (71.56%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTV-SLNNKNSSFTDKISNCC 754
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ +EV+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWL+ ++D+  +  VI L+GNK+DL + R V ++EAKL+A+ NG+ ++ETSA +S NVE AF  ++ E+Y++ S          + ++   V  ++ K +   D    CC
Sbjct:    3 AREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKLFAERNGLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPIDVKPTVTADVRKQCC 213          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0343678)

HSP 1 Score: 180.259 bits (456), Expect = 5.265e-56
Identity = 78/167 (46.71%), Postives = 124/167 (74.25%), Query Frame = 2
Query:  143 YDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            Y+Y+FK +++G+ GVGK+ L+ +FT+ +F ++   TIGVEF ++I+EV+ K IK Q+WDTAGQER++AV  +YYR   G L+V+D+ +RS++ +L+ WL + ++   P   + LIGNK+DL + REV+ EEAK +ADENG+ ++E SA   +NVE+AF+E   ++Y+
Sbjct:    8 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQ 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0080626)

HSP 1 Score: 180.259 bits (456), Expect = 5.265e-56
Identity = 78/167 (46.71%), Postives = 124/167 (74.25%), Query Frame = 2
Query:  143 YDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            Y+Y+FK +++G+ GVGK+ L+ +FT+ +F ++   TIGVEF ++I+EV+ K IK Q+WDTAGQER++AV  +YYR   G L+V+D+ +RS++ +L+ WL + ++   P   + LIGNK+DL + REV+ EEAK +ADENG+ ++E SA   +NVE+AF+E   ++Y+
Sbjct:    8 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQ 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0080627)

HSP 1 Score: 180.644 bits (457), Expect = 1.009e-55
Identity = 78/167 (46.71%), Postives = 124/167 (74.25%), Query Frame = 2
Query:  143 YDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            Y+Y+FK +++G+ GVGK+ L+ +FT+ +F ++   TIGVEF ++I+EV+ K IK Q+WDTAGQER++AV  +YYR   G L+V+D+ +RS++ +L+ WL + ++   P   + LIGNK+DL + REV+ EEAK +ADENG+ ++E SA   +NVE+AF+E   ++Y+
Sbjct:   32 YNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMTGQNVEEAFLETARKIYQ 198          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11a (RAB11a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-041114-53])

HSP 1 Score: 206.838 bits (525), Expect = 2.769e-66
Identity = 96/216 (44.44%), Postives = 150/216 (69.44%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGT------FNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++NG+ ++ETSA +S NVE AF  ++ E+Y++ S    +       + +NN V +      NK          CC
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRIVSQKQMSDRRDNDMSPSNNVVSIQVQPTENKPK------MQCC 212          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11a (RAB11a, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-041114-53])

HSP 1 Score: 206.838 bits (525), Expect = 2.769e-66
Identity = 96/216 (44.44%), Postives = 150/216 (69.44%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGT------FNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++NG+ ++ETSA +S NVE AF  ++ E+Y++ S    +       + +NN V +      NK          CC
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRIVSQKQMSDRRDNDMSPSNNVVSIQVQPTENKPK------MQCC 212          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11al (RAB11a, member RAS oncogene family, like [Source:ZFIN;Acc:ZDB-GENE-031118-188])

HSP 1 Score: 205.682 bits (522), Expect = 8.377e-66
Identity = 100/215 (46.51%), Postives = 149/215 (69.30%), Query Frame = 2
Query:  131 KYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS----SSIGT--FNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            + D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ + VEGK +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N  RWLK +QD+     VI L+GNK+DL + R V  +EAK +A+++G+ ++ETSA +S NVE AF  ++ E+Y++ S    S  G   F+ ++  V +      N     + K S CC
Sbjct:    4 REDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIHVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWLKELQDHADSNIVIMLVGNKSDLRHLRAVPMDEAKAFAEKHGLSFLETSALDSSNVELAFQTILTEIYRIVSQRQMSGRGDDGFSPSSKVVPITVQPTQN-----SGKQSACC 213          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11ba (RAB11B, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-040426-2860])

HSP 1 Score: 204.527 bits (519), Expect = 3.357e-65
Identity = 89/175 (50.86%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF  ++ E+Y++ S
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Match: rab11bb (RAB11B, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-040718-293])

HSP 1 Score: 203.756 bits (517), Expect = 5.654e-65
Identity = 88/172 (51.16%), Postives = 137/172 (79.65%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            D YD++FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF  ++ E+Y++ S
Sbjct:    6 DEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: rab11a (RAB11A, member RAS oncogene family [Source:NCBI gene;Acc:549235])

HSP 1 Score: 208.764 bits (530), Expect = 8.615e-67
Identity = 93/211 (44.08%), Postives = 154/211 (72.99%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMP-KAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANN-TVKLDTVSLNNKNSSFTDKISNCC 754
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+   K  ++L+GNK+DL + R V ++EA+ +A++NG+ ++ETSA +S NVE AF  ++ E+Y++ S +  +  + N+ +   + V ++   ++       CC
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNKIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQTQMSDRRENDMSPSNNVVPIHVPPTTENKPKMQCC 213          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: lrrc8a (leucine rich repeat containing 8 VRAC subunit A [Source:Xenbase;Acc:XB-GENE-1012024])

HSP 1 Score: 204.912 bits (520), Expect = 2.467e-65
Identity = 89/175 (50.86%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF  ++ E+Y++ S
Sbjct:    3 ARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: hivep3 (HIVEP zinc finger 3 [Source:Xenbase;Acc:XB-GENE-482557])

HSP 1 Score: 203.756 bits (517), Expect = 7.798e-65
Identity = 88/175 (50.29%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE++F  ++ E+Y++ S
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEESFKNILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: hivep3 (HIVEP zinc finger 3 [Source:Xenbase;Acc:XB-GENE-482557])

HSP 1 Score: 195.667 bits (496), Expect = 2.917e-62
Identity = 85/163 (52.15%), Postives = 131/163 (80.37%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAF 613
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE++F
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEESF 165          
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Match: crebbp (CREB binding protein [Source:Xenbase;Acc:XB-GENE-6258723])

HSP 1 Score: 194.512 bits (493), Expect = 3.624e-61
Identity = 91/217 (41.94%), Postives = 151/217 (69.59%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNK-REVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSS------FTDKISNCC 754
            S+ + ++++FK+V++GESGVGKTNL+SRFT+N+F  D+ +TIGVEF+++ + ++G L+K+Q+WDTAG ERY+A+ +AYYR  +G LLV+D+ K  S+ +++RWLK + D+   + V+ L+GNK DL ++ +EV SEEAK YA+ NG+ ++ETSA ++ NVE AF  ++ ++Y      +        T +  T++L+ + S        T++  +CC
Sbjct:    3 SEEEEFNFVFKVVLIGESGVGKTNLLSRFTRNEFNHDSRTTIGVEFSTRTLTIDGHLVKSQIWDTAGLERYRAITSAYYRGAVGALLVYDITKHQSYESVDRWLKELYDHADASIVVMLVGNKCDLKDEAQEVPSEEAKAYAERNGLLFIETSALDATNVELAFESILRDIY------MRVLKSKGETQQPSTINLSKEASPTQSITLVTEQKRSCC 213          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab11a (RAB11A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1858202])

HSP 1 Score: 207.223 bits (526), Expect = 2.276e-66
Identity = 90/175 (51.43%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++NG+ ++ETSA +S NVE AF  ++ E+Y++ S
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab11b (RAB11B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:99425])

HSP 1 Score: 205.297 bits (521), Expect = 1.553e-65
Identity = 89/175 (50.86%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF  ++ E+Y++ S
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab25 (RAB25, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1858203])

HSP 1 Score: 192.586 bits (488), Expect = 1.092e-60
Identity = 89/197 (45.18%), Postives = 138/197 (70.05%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNS 724
            + Y+++FK+V++GESGVGKTNL+SRFT+N+F+ D+ +TIGVEF+++ V +    +KAQ+WDTAG ERY+A+ +AYYR  +G LLVFDL K  ++  + RWLK + D+     V+ L+GNK+DLS  REV +EEA ++A+ NG+ ++ETSA +S NVE AF  ++ E++   S       +  N+ +   ++L N  +
Sbjct:    7 EDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEACMFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVS------KQKQNSTRTSAITLGNAQA 197          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab14 (RAB14, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1915615])

HSP 1 Score: 180.259 bits (456), Expect = 8.591e-56
Identity = 79/167 (47.31%), Postives = 122/167 (73.05%), Query Frame = 2
Query:  143 YDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            Y Y+FK +++G+ GVGK+ L+ +FT+ +F +D   TIGVEF ++I+EV G+ IK Q+WDTAGQER++AV  +YYR   G L+V+D+ +RS++ +L+ WL + ++   P   +ILIGNK DL  +R+V+ EEAK +A+ENG+ ++E SA   ENVE AF+E   ++Y+
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQ 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Match: Rab11a (RAB11A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1858202])

HSP 1 Score: 176.022 bits (445), Expect = 6.165e-55
Identity = 76/144 (52.78%), Postives = 116/144 (80.56%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADEN 556
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKN 146          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|Q39572|YPTC6_CHLRE (Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii OX=3055 GN=YPTC6 PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.717e-66
Identity = 96/212 (45.28%), Postives = 150/212 (70.75%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKL----DTVSLNNKNSSFTDKISNCCS 757
            D YDY+FK+V++G+SGVGK+NL+SRFT+N+F+ ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+ K  +F N+ RWLK ++D+     VI L+GNK+DL + R+V +E A+ + +  G+ ++ETSA  S NVE+AF +++ E+Y + S  +   +  +N  K+    D + ++N +     K   CCS
Sbjct:    7 DDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKSVTFENVERWLKELRDHADSNIVIMLVGNKSDLKHLRDVQTEVAQAFCEREGLSFIETSALESTNVEKAFQQILTEIYHIVSKKV--LDSEDNRPKIGEGRDVIVIDNAHDDGGKKKGGCCS 216          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|O01803|RB11A_CAEEL (Ras-related protein rab-11.1 OS=Caenorhabditis elegans OX=6239 GN=rab-11.1 PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 3.030e-66
Identity = 92/172 (53.49%), Postives = 136/172 (79.07%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            S+ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ + VEGK +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+  +  VI L+GNK+DL + R V ++EAK+YA+ N + ++ETSA +S NVE AF  ++ E+YK
Sbjct:    3 SRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSISVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHVTYENVERWLKELRDHADQNIVIMLVGNKSDLRHLRAVPTDEAKIYAERNQLSFIETSALDSTNVEAAFTNILTEIYK 174          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|O49513|RAA1E_ARATH (Ras-related protein RABA1e OS=Arabidopsis thaliana OX=3702 GN=RABA1E PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 3.292e-66
Identity = 97/209 (46.41%), Postives = 148/209 (70.81%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSS-SIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCCS 757
            D YDY+FK+V++G+SGVGK+NL+SRFT+N+F+ ++ STIGVEF ++ V V+ K+IKAQLWDTAGQERY+A+ +AYYR  +G LLV+D+ +  +F N+ RWLK ++D+     VI L+GNK DL + R V +EEA+ +++   M ++ETSA ++ NVEQAF  ++ ++Y++ S  ++       +  K  T+ + NK+     K S CCS
Sbjct:    8 DDYDYLFKLVLIGDSGVGKSNLLSRFTRNEFSIESKSTIGVEFATRSVHVDEKIIKAQLWDTAGQERYRAITSAYYRGAVGALLVYDITRHITFENVERWLKELRDHTDANVVIMLVGNKADLRHLRAVPTEEARSFSERENMFFMETSALDATNVEQAFTHVLTQIYRVMSRKALDGTGDPMSLPKGQTIDIGNKDDVTAVKSSGCCS 216          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|O04486|RAA2A_ARATH (Ras-related protein RABA2a OS=Arabidopsis thaliana OX=3702 GN=RABA2A PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.088e-65
Identity = 97/209 (46.41%), Postives = 154/209 (73.68%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS-SSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCCS 757
            + YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++VEG+ +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+ K ++F N++RWLK ++D+     VI LIGNKTDL + R V++E+A+ YA++ G+ ++ETSA  + NVE+AF  +++EVY++ S  SI +     N    +  +++   +S ++    CCS
Sbjct:    7 EEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPTTFENVSRWLKELRDHADSNIVIMLIGNKTDLKHLRAVATEDAQSYAEKEGLSFIETSALEALNVEKAFQTILSEVYRIISKKSISSDQTTANANIKEGQTIDVAATSESNAKKPCCS 215          
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Match: sp|P62494|RB11A_RAT (Ras-related protein Rab-11A OS=Rattus norvegicus OX=10116 GN=Rab11a PE=1 SV=3)

HSP 1 Score: 207.223 bits (526), Expect = 1.592e-65
Identity = 90/175 (51.43%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++NG+ ++ETSA +S NVE AF  ++ E+Y++ S
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: A0A1Y2CUH2 (Ras-domain-containing protein OS=Rhizoclosmatium globosum OX=329046 GN=BCR33DRAFT_757333 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.953e-71
Identity = 106/214 (49.53%), Postives = 160/214 (74.77%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLD---TVSLNNKNSSFTDKISNCC 754
            MSK D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  D+ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK SS+ N+NRWLK ++D+     +++L+GNK+DL + R VS+EEAK +A ENG+ ++ETSA +S NVE AF +++ E+Y++ S++     ++    K++   T++LNN   +       CC
Sbjct:    1 MSKDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLDSKSTIGVEFATRTIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKVSSYENVNRWLKELRDHADSNIQIMLVGNKSDLKHLRAVSTEEAKNFAAENGLTFIETSALDSSNVEPAFQKILTEIYRVVSNNALKAGESAGAPKVNAGTTITLNNAVDTSKKPSGGCC 214          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: A0A0L0T2N1 (Small GTP-binding protein domain OS=Allomyces macrogynus (strain ATCC 38327) OX=578462 GN=AMAG_13551 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 1.235e-69
Identity = 103/211 (48.82%), Postives = 151/211 (71.56%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            MSK D YD++FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK +++ N+NRWLK ++D+     VI L+GNK+DL + R V ++EAK +A +NG+ ++ETSA +S NVE AF  ++ E+YK+ S      N AN     DT+S+             CC
Sbjct:    1 MSKDDEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHATYENVNRWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEAKQFAADNGLSFIETSALDSSNVELAFQRILTEIYKIVSKRALEENAANIAPTRDTISITPTPGEEVKAPGGCC 211          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: A0A507FF91 (Uncharacterized protein OS=Chytriomyces confervae OX=246404 GN=CcCBS67573_g03700 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 6.490e-68
Identity = 95/176 (53.98%), Postives = 143/176 (81.25%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            MSK D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  D+ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+ K SS+ N+NRWLK ++D+     +++L+GNK+DL + R V++EE+K +A +NG+ ++ETSA +S NVE AF +++ E+Y++ S
Sbjct:    1 MSKDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLDSKSTIGVEFATRTIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKMSSYENVNRWLKELRDHADSNIQIMLVGNKSDLKHARAVATEESKTFAADNGLTFIETSALDSSNVEPAFQKILTEIYRVVS 176          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: A0A167KXR0 (GTPase OS=Calocera viscosa (strain TUFC12733) OX=1330018 GN=CALVIDRAFT_538274 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 8.149e-68
Identity = 98/212 (46.23%), Postives = 158/212 (74.53%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSS-SIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            M++  +YDY+FK+V++G+SGVGK+NL+SRFT+N+F  D+ STIGVEF ++ ++V+GK++KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D++K+ +F N+ RWLK ++D+   + VI L+GNK+DL + R V +EEAK +A ENG+ ++ETSA ++ NVE AF +++ ++Y++ SS S+   ++     +  TVS+  +      + + CC
Sbjct:    1 MAEGSNYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNPDSKSTIGVEFATRSLDVDGKIVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDISKQPTFANVTRWLKELRDHADSSIVIMLVGNKSDLKHLRAVLTEEAKQFAMENGLSFIETSALDASNVESAFQQILTDIYRIVSSKSLEAADEPIQPSRGATVSVGPRAEQKAQQGNGCC 212          
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Match: A0A0V1M4Y0 (Ras-related protein Rab-11A (Fragment) OS=Trichinella papuae OX=268474 GN=Rab11a PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 2.129e-67
Identity = 103/219 (47.03%), Postives = 157/219 (71.69%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSS-------IGTFNKANNTVKLDTVSLNNKNSSFTDKISNCCS 757
            ++K D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ +TIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+  +  VI L+GNK+DL + R V S+EAK Y ++N + ++ETSA +S NVE AF  ++ E+YK+ SS         G+   ++NTV +         +SF D+  +CCS
Sbjct:   31 VTKDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKTTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHVTYENVERWLKELRDHADQNIVIMLVGNKSDLRHLRAVPSDEAKAYTEQNCLSFIETSALDSTNVEAAFTNILTEIYKMVSSKQLSEGRLSGSIMPSSNTVSI------QPTTSFGDRQRSCCS 243          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: rab11a (RAB11A, member RAS oncogene family [Source:NCBI gene;Acc:103028965])

HSP 1 Score: 205.297 bits (521), Expect = 9.735e-66
Identity = 89/175 (50.86%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++NG+ ++ETSA +S NVE AF  ++ E+Y++ S
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: ENSAMXT00000055778.1 (ras-related protein Rab-11B [Source:NCBI gene;Acc:103047600])

HSP 1 Score: 205.297 bits (521), Expect = 1.331e-65
Identity = 98/218 (44.95%), Postives = 151/218 (69.27%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSS------SIGTFNKANNTVKLDTVSLNN--KNSSFTDKISNCC 754
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF  ++ E+Y++ S       S    +  NN V +      +  K S F      CC
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNSLSFIETSALDSTNVEEAFKNILTEIYRIVSQKQIADRSAHDESPGNNVVDISVPPTTDGLKGSKF-----QCC 215          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: rab11bb (ras-related protein Rab-11B [Source:NCBI gene;Acc:111194513])

HSP 1 Score: 203.371 bits (516), Expect = 8.156e-65
Identity = 88/172 (51.16%), Postives = 137/172 (79.65%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            D YD++FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF  ++ E+Y++ S
Sbjct:    6 DEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: rab25b (RAB25, member RAS oncogene family [Source:NCBI gene;Acc:103042360])

HSP 1 Score: 191.815 bits (486), Expect = 2.003e-60
Identity = 95/214 (44.39%), Postives = 147/214 (68.69%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISN---CC 754
            M   ++Y+++FK+V++GESGVGK+NL+SRFTKN+F  D+ +TIGVEF+++ V++    IKAQ+WDTAG ERY+A+ +AYYR  +G LLV+D++K  ++ +  RWLK + D+  P   V+L+GNK+DL++ R V +E+AK +A++NG+ ++ETSA  S NVE AF  ++ E++K  SS   T    N       VSL++   + +D       CC
Sbjct:    1 MGSDEAYNFVFKVVLIGESGVGKSNLLSRFTKNEFNHDSRTTIGVEFSTRTVQLNSLTIKAQIWDTAGLERYRAITSAYYRGAVGALLVYDISKHLTYESAERWLKELYDHADPHIVVMLVGNKSDLASIRSVPTEDAKDFAEKNGLLFMETSALESTNVEIAFNSVLEEIHKKVSSKEVTRGSIN------AVSLSSPQPAQSDAQEEKKACC 208          
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Match: rab25b (RAB25, member RAS oncogene family [Source:NCBI gene;Acc:103042360])

HSP 1 Score: 191.815 bits (486), Expect = 2.003e-60
Identity = 95/214 (44.39%), Postives = 147/214 (68.69%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISN---CC 754
            M   ++Y+++FK+V++GESGVGK+NL+SRFTKN+F  D+ +TIGVEF+++ V++    IKAQ+WDTAG ERY+A+ +AYYR  +G LLV+D++K  ++ +  RWLK + D+  P   V+L+GNK+DL++ R V +E+AK +A++NG+ ++ETSA  S NVE AF  ++ E++K  SS   T    N       VSL++   + +D       CC
Sbjct:    1 MGSDEAYNFVFKVVLIGESGVGKSNLLSRFTKNEFNHDSRTTIGVEFSTRTVQLNSLTIKAQIWDTAGLERYRAITSAYYRGAVGALLVYDISKHLTYESAERWLKELYDHADPHIVVMLVGNKSDLASIRSVPTEDAKDFAEKNGLLFMETSALESTNVEIAFNSVLEEIHKKVSSKEVTRGSIN------AVSLSSPQPAQSDAQEEKKACC 208          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: rab11ba (RAB11B, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-040426-2860])

HSP 1 Score: 191.43 bits (485), Expect = 4.699e-61
Identity = 84/161 (52.17%), Postives = 128/161 (79.50%), Query Frame = 2
Query:  161 IVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            +V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR   G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V+++EAK +A+ +G+ ++ETSA +S NVE AFI ++ E+Y+
Sbjct:    1 VVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAYGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVTTDEAKAFAENHGLSFIETSALDSTNVESAFITILTEIYR 161          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002219.1 (pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene:ENSPMAG00000002006.1 transcript:ENSPMAT00000002219.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.563 bits (449), Expect = 1.401e-55
Identity = 76/167 (45.51%), Postives = 122/167 (73.05%), Query Frame = 2
Query:  143 YDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            Y Y+FK +++G+ GVGK+ L+ +FT+ +F +D   TIGVEF ++I+EV G+ +K Q+WDTAGQER++AV  +YYR   G L+V+D+ +RS++ +L+ WL + ++   P   + LIGNK DL  +R+V+ EEAK +A+ENG+ ++E SA   +NVE+AF+E   ++Y+
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGDNVEEAFLETAKKIYQ 174          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 165.622 bits (418), Expect = 7.580e-51
Identity = 80/213 (37.56%), Postives = 129/213 (60.56%), Query Frame = 2
Query:  140 SYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLN-------NKNSSFTDKISNCC 754
            SY Y+FK +++G++GVGK+ L+ +FT  +F      TIGVEF ++++ + GK +K Q+WDTAGQE ++++  +YYR   G LLV+D+ +R +F +L  WL++ + +     VI LIGNK+DL ++REV  EE + +A E+G+ ++ETSA  + NVE+AFI    E+Y+     +   N   N +K+    L         + +  T     CC
Sbjct:    7 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDARQHSNSNMVIMLIGNKSDLESRREVKCEEGEAFAREHGLVFMETSAKTAANVEEAFINTAREIYEKIQEGVFDVNNEANGIKIGPQQLGATPSAGQGRPAGSTGGSDGCC 219          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 164.851 bits (416), Expect = 1.268e-50
Identity = 76/186 (40.86%), Postives = 124/186 (66.67%), Query Frame = 2
Query:  140 SYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKL 694
            SY Y+FK +++G++GVGK+ L+ +FT  +F      TIGVEF ++++ ++GK +K Q+WDTAGQE ++++  +YYR   G LLV+D+ +R +F +L  WL++ + +     VI LIGNK+DL ++REV  EE + +A E+G+ ++ETSA  + NVE+AFI    E+Y+     +   N   N +K+
Sbjct:    2 SYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNKSDLESRREVKREEGEAFAREHGLVFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKI 187          
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 164.081 bits (414), Expect = 2.132e-50
Identity = 78/199 (39.20%), Postives = 132/199 (66.33%), Query Frame = 2
Query:  140 SYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEV-YKLHSSSIGTFNKANNTVKLDTVSLNNKNSSF 730
            +YDY+FK++++G+SGVGKT ++ RF+++ F S   STIG++F  + ++++GK IK Q+WDTAGQER++ + TAYYR  +G +LV+D+    SF N+  W++N++++     + +++GNK D++ +R+V+ E  +  A E G+K++ETSA  S NVE+AF  L  ++  K+     G     +N V++   S   K S F
Sbjct:    4 TYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKLEGNNTPDSNAVRITAPSQGKKTSFF 202          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 203.371 bits (516), Expect = 1.008e-65
Identity = 94/170 (55.29%), Postives = 133/170 (78.24%), Query Frame = 2
Query:  134 YDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            YD YD +FKIV++G+SGVGK+NL+SRFTKN+F  D+ STIGVEF ++ +E++GK IKAQ+WDTAGQERY+A+ +AYYR  +G L+V+D++K SS+ N N WL  +++       V LIGNK+DL++ R V +EE+K +A EN + + ETSA NSENV++AF EL+N +Y+
Sbjct:    8 YD-YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQ 176          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 199.134 bits (505), Expect = 5.015e-64
Identity = 106/216 (49.07%), Postives = 149/216 (68.98%), Query Frame = 2
Query:  134 YDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPK-AKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS------SSIGTFN-KANNTVKLDTVSLNN-KNSSFTDKISNCC 754
            YD YDY+FKIV++G+SGVGK+NL+SRFT ++F  ++ STIGVEF ++ +EVE K IKAQ+WDTAGQERY+A+ +AYYR  +G L+V+D++K SS+ N N WL  +++       V LIGNK+DL++ R V ++EAK +A EN M + ETSA NS+NV++AF EL+  ++++ S      S  GT N  +N   K  T+SL          K SNCC
Sbjct:    8 YD-YDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKGPTISLTPAPKEDKKKKSSNCC 222          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 163.696 bits (413), Expect = 1.659e-50
Identity = 84/205 (40.98%), Postives = 130/205 (63.41%), Query Frame = 2
Query:  143 YDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKV-ILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            YDY+FK++++G SGVGK+ L+ RF+ + +T+D  STIGV+F  K VE++GK +K Q+WDTAGQER++ + ++YYR   G ++V+D+  + SF  +  WL+ +  Y     + +L+GNK DL +KR V  + AK +AD N M ++ETSA +S NVE AF+ +  ++    S S    N+     K D  ++N K  S T+    CC
Sbjct:    5 YDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIK--ESMSQQNLNETTQK-KEDKGNVNLKGQSLTNTGGGCC 206          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 147.902 bits (372), Expect = 3.878e-44
Identity = 66/162 (40.74%), Postives = 113/162 (69.75%), Query Frame = 2
Query:  140 SYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIEL 622
            SYD + KI+++G+SGVGK+ L+ RF +++F     +TIG++F  K V++ GK +K QLWDTAGQER++ + TAYYR  +G +LV+D+    +F N+ +W K + ++   +A+++L+GNK+D+   R V++++ +  A E G+ ++E+SA N +NV + F  L
Sbjct:   16 SYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMET-RVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTL 176          
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 127.872 bits (320), Expect = 2.003e-36
Identity = 66/178 (37.08%), Postives = 114/178 (64.04%), Query Frame = 2
Query:  155 FKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVIL--IGNKTDLSNKREVSSEEAKLYADENGMK-YVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKAN 679
            +KIV +GE GVGKT+LI+RF  + F     +TIG++F SK + ++ K I+ QLWDTAGQER++++  +Y R+    ++V+D+ KR SF  +++W++++++      VIL  +GNK+DLS++R++S+EE +  A   G K ++ETS     NV+  F ++   + +  +S     +  N
Sbjct:   11 YKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDSEN 188          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO33171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST02])

HSP 1 Score: 209.92 bits (533), Expect = 6.728e-68
Identity = 99/216 (45.83%), Postives = 151/216 (69.91%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVY------KLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            +K D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EAK +A++NG+ ++ETSA +S NVE AF  ++ E+Y      ++H S     +  +N V+  T+ +         K   CC
Sbjct:    3 TKDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEAKAFAEKNGLSFIETSALDSTNVEVAFHNILTEIYHIVSQKQIHDSPSSDGSHPSNNVQ--TIHVAPTTDDDRKKRVQCC 216          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO33074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST94])

HSP 1 Score: 209.149 bits (531), Expect = 1.362e-67
Identity = 98/216 (45.37%), Postives = 153/216 (70.83%), Query Frame = 2
Query:  131 KYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNK---ANNTVKLDTVSLNNKNSSFTDKIS---NCCS 757
            +YD YDY++KIV++G+SGVGK++L+SRFT+N+F  ++ STIGVEF ++ ++VEGK+IKAQ+WDTAGQERY+A+ +AYYR  +G +LV+DL K+ +F ++ RWL  ++++  P   V+L+GNK DL + R V+S++AK Y DE+G+ ++E SA ++ NVE+AF + +    KLH   +    K     +T +  T +   +NS   +K S   NCC+
Sbjct:    5 RYDHYDYLYKIVLIGDSGVGKSSLLSRFTRNEFDIESKSTIGVEFATRSIQVEGKIIKAQVWDTAGQERYRAITSAYYRGAVGAVLVYDLTKQKTFQDVERWLLEVREHADPTIVVMLVGNKCDLKHLRAVASDDAKKYGDEHGLAFIEASALDATNVEEAFQQTIT---KLHHVQLAKMKKELDGKDTREGQTAASKQQNSVDLNKPSQGKNCCT 217          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO49117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU7])

HSP 1 Score: 188.734 bits (478), Expect = 1.858e-59
Identity = 92/219 (42.01%), Postives = 147/219 (67.12%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMP-KAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVY-KLHSSSIGTFNKANN-------TVKLDTVSL----NNKNSSFTDKISNCC 754
            D+YDY+FKIV++G+SGVGK+NL+SR+TKN+F   + +TIGVE   + VE+EGK ++AQ+WDTAGQERY+A+ +AYYR  +G +LV+D+AK +SF+NLN+W++ ++ +      +ILIGNK+DL + R + +   K +A E+GM ++ETSA +S NV +AF  +   ++ K+  + +    +A+         +K +   L    N K  + T +  +CC
Sbjct:   13 DNYDYLFKIVLIGDSGVGKSNLLSRYTKNEFHLGSKATIGVELAHRNVEIEGKTVRAQIWDTAGQERYRAITSAYYRGAMGAVLVYDIAKGTSFMNLNKWVEELRQHASDDLSIILIGNKSDLKHLRMIENRRGKQFAAEHGMLFMETSALDSTNVAEAFEFIFAHIFDKVRQNELEKSGQAHEKPNGESIVIKAELAELPATPNGKEHARTRQSKSCC 231          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO43319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ04])

HSP 1 Score: 182.185 bits (461), Expect = 4.298e-57
Identity = 85/203 (41.87%), Postives = 135/203 (66.50%), Query Frame = 2
Query:  143 YDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISN 748
            Y Y+FK +++G+ GVGK+ L+ +FT+ +F +D   TIGVEF ++I+EV G+ IK Q+WDTAGQER++AV  +YYR   G L+V+D+ +RS++ +L+ WL + ++   P   + LIGNK+DL  +R+V+ EEAK +A+ENG+ + E SA   ENVE AF+E   ++Y+         N A + V+   ++   +N+  TD+  N
Sbjct:    9 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKSDLDAQRDVTYEEAKQFAEENGLLFCEASAKTGENVEDAFLETAKKIYQNIQDGSLDLNAAESGVQHKPLTGRPQNALNTDQQPN 211          
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 164.851 bits (416), Expect = 1.414e-50
Identity = 71/168 (42.26%), Postives = 122/168 (72.62%), Query Frame = 2
Query:  140 SYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK 640
            SYDY+FK++++G+SGVGKT ++ RF+ + F +   STIG++F  K +E++GK IK Q+WDTAGQER+  + T+YYR  +G +LV+D+ +  +F N+++WL+N++++     + +++GNK D+ ++R VS E  +  A E+G++++ETSA  + N+EQAF  L  ++ K
Sbjct:    5 SYDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHANEDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQDILK 172          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: RAB11A (RAB11A, member RAS oncogene family [Source:NCBI gene;Acc:101157275])

HSP 1 Score: 207.608 bits (527), Expect = 1.527e-66
Identity = 96/216 (44.44%), Postives = 150/216 (69.44%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGT------FNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++NG+ ++ETSA +S NVE AF  ++ E+Y++ S    +       + +NN V +      NK          CC
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFLETSALDSTNVETAFQTILTEIYRIVSQKQMSERQESDMSPSNNVVNIQVPPTENKPK------MQCC 212          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: rab11ba (ras-related protein Rab-11B [Source:NCBI gene;Acc:101160399])

HSP 1 Score: 204.912 bits (520), Expect = 1.523e-65
Identity = 89/175 (50.86%), Postives = 139/175 (79.43%), Query Frame = 2
Query:  128 SKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            ++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF  ++ E+Y++ S
Sbjct:    3 TRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: rab11al (ras-related protein Rab-11A [Source:NCBI gene;Acc:101171030])

HSP 1 Score: 204.912 bits (520), Expect = 1.593e-65
Identity = 95/215 (44.19%), Postives = 148/215 (68.84%), Query Frame = 2
Query:  131 KYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVY------KLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            + D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++VEGK +KAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N  RWLK +QD+     VI L+GNK+DL + R V ++EA+ +A+++G+ ++ETSA +S NVE AF  ++  +Y      ++   +   F+ A+N V +        +S       +CC
Sbjct:    4 REDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENAERWLKELQDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKHGLSFLETSALDSSNVELAFQTILTAIYNIVSQRQMSGRTDSDFSPASNVVPISVEPTQTSSSK-----GSCC 213          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: rab25a (ras-related protein Rab-25-like [Source:NCBI gene;Acc:101158957])

HSP 1 Score: 203.371 bits (516), Expect = 5.057e-65
Identity = 95/211 (45.02%), Postives = 148/211 (70.14%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCC 754
            M   DSY+++FK+V++GESGVGK+NL+SRFTKN+F  D+ +TIGVEF+++ V++E  +IKAQ+WDTAG ERY+A+ +AYYR  +G LLV+D++K  ++ +  RWLK + D+  P   V+L+GNK+DL ++R V +EEA+ +ADE G+ ++ETSA +S NVE AF E++  ++K  +S   T    +       + LN++     ++   CC
Sbjct:    1 MGSEDSYNFVFKVVLIGESGVGKSNLLSRFTKNEFRHDSRTTIGVEFSTRTVQLENFIIKAQIWDTAGLERYRAITSAYYRGAVGALLVYDISKHLTYESAERWLKELYDHADPHIVVMLVGNKSDLQSQRTVPTEEAQHFADEKGLMFMETSALDSTNVESAFHEVLTAIHKKVASREVTRGSISAVTLSGPIGLNSEQQ---EERKGCC 208          
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Match: rab11bb (ras-related protein Rab-11B [Source:NCBI gene;Acc:101156358])

HSP 1 Score: 202.986 bits (515), Expect = 8.284e-65
Identity = 88/172 (51.16%), Postives = 137/172 (79.65%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHS 649
            D YD++FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ ++V+GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+AK  ++ N+ RWLK ++D+     VI L+GNK+DL + R V ++EA+ +A++N + ++ETSA +S NVE+AF  ++ E+Y++ S
Sbjct:    6 DEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADNNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSFIETSALDSTNVEEAFKNILTEIYRIVS 177          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000016036.1 (SMESG000016036.1)

HSP 1 Score: 432.565 bits (1111), Expect = 1.778e-155
Identity = 212/212 (100.00%), Postives = 212/212 (100.00%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCCSK 760
            MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCCSK
Sbjct:    1 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCCSK 212          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000023556.1 (SMESG000023556.1)

HSP 1 Score: 210.69 bits (535), Expect = 6.332e-68
Identity = 97/216 (44.91%), Postives = 153/216 (70.83%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCCSK*FM 769
            MSK D YD++FKIV++G+SG GK+NL+SRFT+N+F  ++ STIGVEF ++ V ++GK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+ K+SSF N  RWL+ ++D+   + V+ L+GNK DL + R V  ++A++YA++  + ++ETSA ++ NVE+AF ++++ +Y++ S +       N T    T  + +  +      +NCCSK F+
Sbjct:    1 MSKDDEYDFLFKIVLIGDSGTGKSNLLSRFTRNEFNLESKSTIGVEFATRSVHIDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKQSSFQNKERWLQELRDHADSSTVVTLVGNKVDLRHLRAVGKQDAQVYAEQQDIYFLETSALDATNVEEAFTQILSSIYRIVSQNPSINPNYNATENHHTQPIISSLTENDKPKTNCCSKSFI 216          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000073334.1 (SMESG000073334.1)

HSP 1 Score: 209.534 bits (532), Expect = 1.545e-67
Identity = 99/219 (45.21%), Postives = 154/219 (70.32%), Query Frame = 2
Query:  125 MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYMPKAKVI-LIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK-------LHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNCCS 757
            M++ D YDY+FK+V++G+SGVGK+NL+SRFT+N+F  ++ STIGVEF ++ V +EGK IKAQ+WDTAGQERY+A+ +AYYR  +G LLV+D+ K +++ N+ RWLK ++D+     VI L+GNK+DL + R V  E+AK +A+ + + ++ETSA  + NVE AFI++++ +Y+       + S+ IG  +K N    + ++    +NS+      NCCS
Sbjct:    1 MARDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVTIEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIVKHATYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRSVPREDAKAFAERHNISFIETSALEATNVEDAFIQILSAIYRIVSQRPPMESAPIG--HKLNTQPIIPSLDDTMRNSNGK---KNCCS 214          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000024495.1 (SMESG000024495.1)

HSP 1 Score: 177.948 bits (450), Expect = 3.362e-55
Identity = 85/206 (41.26%), Postives = 132/206 (64.08%), Query Frame = 2
Query:  137 DSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNC 751
            ++Y Y+FK +++G+ GVGK+ L+ +FT+++F  D   TIGVEF +KI+EV G+ +K Q+WDTAGQER++AV  +YYR   G +LV+D+ ++++F  ++ WL + +    P+   ILIGNK DL+  REVS E+ K  A+ENGM ++E SA   E+VE AFIE   ++Y+         N A+N V +       K++    K  +C
Sbjct:    4 EAYSYIFKYIIIGDMGVGKSCLLHQFTESKFLPDCPHTIGVEFGTKIIEVSGEKVKLQIWDTAGQERFRAVTRSYYRGAAGAILVYDITRKATFNRVHSWLSDARSLTSPQTVFILIGNKGDLNENREVSFEDGKELAEENGMFFLECSARTGEHVEDAFIETARKIYQHIQEGNVDLNSASNGVVMKRSPTPAKSAQSNQKNCSC 209          
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Match: SMESG000044270.1 (SMESG000044270.1)

HSP 1 Score: 174.866 bits (442), Expect = 7.120e-54
Identity = 81/205 (39.51%), Postives = 134/205 (65.37%), Query Frame = 2
Query:  143 YDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSKIVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVNLNRWLKNMQDYM-PKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVETSAYNSENVEQAFIELVNEVYK-LHSSSIGTFNKANNTVKLDTVSLNNKNSSFTDKISNC 751
            Y Y+FK +++G+ GVGK+ L+ +FT+ +F +D   TIGVEF ++I+E+ G+ IK Q+WDTAGQER++AV  +YYR   G LLV+D+ ++S+F +++ WL + +    P   + +IGNK+D++ +R+V+ +E K  ADENG+ ++E SA   E VE AFIE   ++++ +   S+   N AN+ V +        +   +DK + C
Sbjct:    8 YSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEINGEKIKLQIWDTAGQERFRAVTRSYYRGAAGALLVYDVTRKSTFNHIHSWLTDARGLTSPNTVIFMIGNKSDMNEQRDVTYDEGKAVADENGLMFLECSAKTGEGVEDAFIETARKIFQNIQDGSV-DLNSANDGVVMKNNQGGQNSDGKSDKQTGC 211          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-11A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB11A3.315e-6651.43RAB11A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB11B2.634e-6550.86RAB11B, member RAS oncogene family [Source:HGNC Sy... [more]
RAB11B1.407e-6252.76RAB11B, member RAS oncogene family [Source:HGNC Sy... [more]
RAB256.191e-6142.86RAB25, member RAS oncogene family [Source:HGNC Sym... [more]
RAB149.089e-5647.31RAB14, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-11.12.382e-6753.49Ras-related protein rab-11.1 [Source:UniProtKB/Sw... [more]
rab-11.12.382e-6753.49Ras-related protein rab-11.1 [Source:UniProtKB/Sw... [more]
rab-11.21.108e-5744.44RAB family [Source:UniProtKB/TrEMBL;Acc:Q1ZXR4][more]
rab-141.133e-5545.83RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
rab-141.133e-5545.83RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab114.167e-6945.97gene:FBgn0015790 transcript:FBtr0084011[more]
Rab114.167e-6945.97gene:FBgn0015790 transcript:FBtr0084010[more]
Rab145.265e-5646.71gene:FBgn0015791 transcript:FBtr0343678[more]
Rab145.265e-5646.71gene:FBgn0015791 transcript:FBtr0080626[more]
Rab141.009e-5546.71gene:FBgn0015791 transcript:FBtr0080627[more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11a2.769e-6644.44RAB11a, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab11a2.769e-6644.44RAB11a, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab11al8.377e-6646.51RAB11a, member RAS oncogene family, like [Source:Z... [more]
rab11ba3.357e-6550.86RAB11B, member RAS oncogene family, a [Source:ZFIN... [more]
rab11bb5.654e-6551.16RAB11B, member RAS oncogene family, b [Source:ZFIN... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11a8.615e-6744.08RAB11A, member RAS oncogene family [Source:NCBI ge... [more]
lrrc8a2.467e-6550.86leucine rich repeat containing 8 VRAC subunit A [S... [more]
hivep37.798e-6550.29HIVEP zinc finger 3 [Source:Xenbase;Acc:XB-GENE-48... [more]
hivep32.917e-6252.15HIVEP zinc finger 3 [Source:Xenbase;Acc:XB-GENE-48... [more]
crebbp3.624e-6141.94CREB binding protein [Source:Xenbase;Acc:XB-GENE-6... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab11a2.276e-6651.43RAB11A, member RAS oncogene family [Source:MGI Sym... [more]
Rab11b1.553e-6550.86RAB11B, member RAS oncogene family [Source:MGI Sym... [more]
Rab251.092e-6045.18RAB25, member RAS oncogene family [Source:MGI Symb... [more]
Rab148.591e-5647.31RAB14, member RAS oncogene family [Source:MGI Symb... [more]
Rab11a6.165e-5552.78RAB11A, member RAS oncogene family [Source:MGI Sym... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q39572|YPTC6_CHLRE1.717e-6645.28Ras-related protein YPTC6 OS=Chlamydomonas reinhar... [more]
sp|O01803|RB11A_CAEEL3.030e-6653.49Ras-related protein rab-11.1 OS=Caenorhabditis ele... [more]
sp|O49513|RAA1E_ARATH3.292e-6646.41Ras-related protein RABA1e OS=Arabidopsis thaliana... [more]
sp|O04486|RAA2A_ARATH1.088e-6546.41Ras-related protein RABA2a OS=Arabidopsis thaliana... [more]
sp|P62494|RB11A_RAT1.592e-6551.43Ras-related protein Rab-11A OS=Rattus norvegicus O... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Y2CUH22.953e-7149.53Ras-domain-containing protein OS=Rhizoclosmatium g... [more]
A0A0L0T2N11.235e-6948.82Small GTP-binding protein domain OS=Allomyces macr... [more]
A0A507FF916.490e-6853.98Uncharacterized protein OS=Chytriomyces confervae ... [more]
A0A167KXR08.149e-6846.23GTPase OS=Calocera viscosa (strain TUFC12733) OX=1... [more]
A0A0V1M4Y02.129e-6747.03Ras-related protein Rab-11A (Fragment) OS=Trichine... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11a9.735e-6650.86RAB11A, member RAS oncogene family [Source:NCBI ge... [more]
ENSAMXT00000055778.11.331e-6544.95ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
rab11bb8.156e-6551.16ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
rab25b2.003e-6044.39RAB25, member RAS oncogene family [Source:NCBI gen... [more]
rab25b2.003e-6044.39RAB25, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab11ba4.699e-6152.17RAB11B, member RAS oncogene family, a [Source:ZFIN... [more]
ENSPMAT00000002219.11.401e-5545.51pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene... [more]
RAB2B7.580e-5137.56RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
rab2a1.268e-5040.86RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a2.132e-5039.20RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT311.008e-6555.29Rab family GTPase; involved in the exocytic pathwa... [more]
YPT325.015e-6449.07Rab family GTPase involved in the exocytic pathway... [more]
YPT11.659e-5040.98Rab family GTPase; involved in the ER-to-Golgi ste... [more]
SEC43.878e-4440.74Rab family GTPase; essential for vesicle-mediated ... [more]
YPT62.003e-3637.08Rab family GTPase; required for endosome-to-Golgii... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO331716.728e-6845.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330741.362e-6745.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491171.858e-5942.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433194.298e-5741.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474711.414e-5042.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB11A1.527e-6644.44RAB11A, member RAS oncogene family [Source:NCBI ge... [more]
rab11ba1.523e-6550.86ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
rab11al1.593e-6544.19ras-related protein Rab-11A [Source:NCBI gene;Acc:... [more]
rab25a5.057e-6545.02ras-related protein Rab-25-like [Source:NCBI gene;... [more]
rab11bb8.284e-6551.16ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Ras-related protein Rab-11A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016036.11.778e-155100.00SMESG000016036.1[more]
SMESG000023556.16.332e-6844.91SMESG000023556.1[more]
SMESG000073334.11.545e-6745.21SMESG000073334.1[more]
SMESG000024495.13.362e-5541.26SMESG000024495.1[more]
SMESG000044270.17.120e-5439.51SMESG000044270.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000248 ID=SMED30000248|Name=Ras-related protein Rab-11A|organism=Schmidtea mediterranea sexual|type=transcript|length=864bp
TTGACTAACATTTGTTTTGTTTAAATGTATCAAATATATAGATACATTCG
AAAATTATAAATTTATTCTTTCGAAAAAAAAATATTTATTATTATTTCTT
AGTTTGACAATTATTTATTTAGAAATGTCCAAATATGATTCTTATGATTA
CATGTTTAAAATCGTTGTCGTTGGTGAGTCTGGAGTGGGTAAAACTAATT
TAATATCCCGATTTACCAAAAACCAATTCACATCAGATACAGCGTCAACT
ATTGGAGTTGAATTCACATCAAAAATTGTTGAAGTTGAAGGAAAATTAAT
CAAAGCTCAATTATGGGATACAGCGGGACAAGAACGATATCAGGCCGTTG
CAACTGCATATTATCGAAACGGAATTGGAGGTTTGTTAGTTTTCGATCTA
GCTAAACGAAGCTCGTTTGTTAACCTTAATCGGTGGTTAAAAAATATGCA
GGACTATATGCCAAAAGCGAAAGTCATTTTAATTGGAAATAAAACAGATC
TCTCTAATAAACGTGAAGTGAGTTCAGAGGAAGCCAAATTGTATGCAGAT
GAAAATGGAATGAAATATGTCGAGACGTCTGCTTACAACTCTGAAAACGT
TGAGCAAGCATTTATAGAATTGGTTAACGAAGTTTATAAGCTCCATTCCT
CATCTATTGGAACGTTCAACAAAGCAAATAATACCGTTAAATTGGACACG
GTTTCTTTGAACAATAAAAATTCAAGCTTTACAGATAAAATATCAAATTG
TTGCTCCAAATAATTTATGCAGATTCTATGATAAATTATTATTATTATTA
TTTTCTAAGAAAATTAATAAACATTTTATAAATAATTTAACTACAGTTTT
GCTCAATATCCTCC
back to top

protein sequence of SMED30000248-orf-1

>SMED30000248-orf-1 ID=SMED30000248-orf-1|Name=SMED30000248-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
MSKYDSYDYMFKIVVVGESGVGKTNLISRFTKNQFTSDTASTIGVEFTSK
IVEVEGKLIKAQLWDTAGQERYQAVATAYYRNGIGGLLVFDLAKRSSFVN
LNRWLKNMQDYMPKAKVILIGNKTDLSNKREVSSEEAKLYADENGMKYVE
TSAYNSENVEQAFIELVNEVYKLHSSSIGTFNKANNTVKLDTVSLNNKNS
SFTDKISNCCSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0006898receptor-mediated endocytosis
GO:0009792embryo development ending in birth or egg hatching
GO:0015031protein transport
GO:0030703eggshell formation
GO:0032467positive regulation of cytokinesis
GO:0060471cortical granule exocytosis
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005737cytoplasm
GO:0005768endosome
GO:0005794Golgi apparatus
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030133transport vesicle
GO:0031410cytoplasmic vesicle
GO:0055037recycling endosome
GO:0055038recycling endosome membrane
GO:0060473cortical granule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 34..50
score: 32.26
coord: 52..74
score: 51.09
coord: 113..126
score: 44.65
coord: 148..170
score: 39.26
coord: 11..32
score: 48.61
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 16..212
e-value: 3.4E-5
score: 24.6
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 11..173
e-value: 1.7E-87
score: 306.6
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 11..173
e-value: 2.1E-29
score: 113.7
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 13..173
e-value: 6.2E-13
score: 45.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 4..210
e-value: 3.5E-62
score: 211.3
NoneNo IPR availablePANTHERPTHR24073:SF1068RAS-RELATED PROTEIN RABA2Acoord: 5..184
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 5..184
NoneNo IPR availablePROSITEPS51419RABcoord: 6..210
score: 33.198
IPR001806Small GTPasePFAMPF00071Rascoord: 12..171
e-value: 4.3E-57
score: 192.2
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 9..163
e-value: 1.9E-33
score: 113.5
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 6..185