Zinc finger protein 112-like

Overview
NameZinc finger protein 112-like
Smed IDSMED30000245
Length (bp)2854
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein 112-like (SMED30000245) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein 112-like (SMED30000245) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein 112-like (SMED30000245) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein 112-like (SMED30000245) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000245

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30000245SMESG000072474.1 SMESG000072473.1 dd_Smed_v4_2635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000245SMESG000072474.1 SMESG000072473.1 dd_Smed_v4_2635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000245SMESG000072474.1 SMESG000072473.1 dd_Smed_v4_2635_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein 112-like vs. Ensembl Human
Match: ZNF546 (zinc finger protein 546 [Source:HGNC Symbol;Acc:HGNC:28671])

HSP 1 Score: 83.5741 bits (205), Expect = 1.247e-15
Identity = 114/440 (25.91%), Postives = 177/440 (40.23%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2749
             C K +  R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  307 ECGKAF--RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 716          

HSP 2 Score: 69.707 bits (169), Expect = 1.916e-11
Identity = 91/334 (27.25%), Postives = 137/334 (41.02%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKH 2437
             C KT+ +R  Y +T+   ++   K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H         P +  E   A R       H  +H G   Y  C E     S N  + +        K Y C+ C   F    +L  H
Sbjct:  475 ECGKTFSSR--YHLTQHYRIHTGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHTGEK-----PYSCKECGNAFRLQAELTRHHIVHTGEKPYK-CKECGKAFSVNSELTRHHRIHTGEKPYQCKECGKAFIRSDQLTLH 797          

HSP 3 Score: 55.4546 bits (132), Expect = 5.631e-7
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  189 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 576          
BLAST of Zinc finger protein 112-like vs. Ensembl Human
Match: ZNF546 (zinc finger protein 546 [Source:HGNC Symbol;Acc:HGNC:28671])

HSP 1 Score: 83.5741 bits (205), Expect = 1.247e-15
Identity = 114/440 (25.91%), Postives = 177/440 (40.23%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2749
             C K +  R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  307 ECGKAF--RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 716          

HSP 2 Score: 69.707 bits (169), Expect = 1.916e-11
Identity = 91/334 (27.25%), Postives = 137/334 (41.02%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKH 2437
             C KT+ +R  Y +T+   ++   K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H         P +  E   A R       H  +H G   Y  C E     S N  + +        K Y C+ C   F    +L  H
Sbjct:  475 ECGKTFSSR--YHLTQHYRIHTGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHTGEK-----PYSCKECGNAFRLQAELTRHHIVHTGEKPYK-CKECGKAFSVNSELTRHHRIHTGEKPYQCKECGKAFIRSDQLTLH 797          

HSP 3 Score: 55.4546 bits (132), Expect = 5.631e-7
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  189 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 576          
BLAST of Zinc finger protein 112-like vs. Ensembl Human
Match: ZNF546 (zinc finger protein 546 [Source:HGNC Symbol;Acc:HGNC:28671])

HSP 1 Score: 82.8037 bits (203), Expect = 1.783e-15
Identity = 114/440 (25.91%), Postives = 177/440 (40.23%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2749
             C K +  R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  333 ECGKAF--RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 742          

HSP 2 Score: 69.707 bits (169), Expect = 2.291e-11
Identity = 72/249 (28.92%), Postives = 112/249 (44.98%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHA 2206
             C KT+ +R  Y +T+   ++   K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H 
Sbjct:  501 ECGKTFSSR--YHLTQHYRIHTGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHT 744          

HSP 3 Score: 54.6842 bits (130), Expect = 8.645e-7
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  215 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 602          
BLAST of Zinc finger protein 112-like vs. Ensembl Human
Match: ZNF546 (zinc finger protein 546 [Source:HGNC Symbol;Acc:HGNC:28671])

HSP 1 Score: 82.8037 bits (203), Expect = 1.783e-15
Identity = 114/440 (25.91%), Postives = 177/440 (40.23%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2749
             C K +  R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  333 ECGKAF--RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 742          

HSP 2 Score: 69.707 bits (169), Expect = 2.291e-11
Identity = 72/249 (28.92%), Postives = 112/249 (44.98%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHA 2206
             C KT+ +R  Y +T+   ++   K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H 
Sbjct:  501 ECGKTFSSR--YHLTQHYRIHTGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHT 744          

HSP 3 Score: 54.6842 bits (130), Expect = 8.645e-7
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  215 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 602          
BLAST of Zinc finger protein 112-like vs. Ensembl Human
Match: ZNF808 (zinc finger protein 808 [Source:HGNC Symbol;Acc:HGNC:33230])

HSP 1 Score: 80.1073 bits (196), Expect = 1.306e-14
Identity = 110/430 (25.58%), Postives = 164/430 (38.14%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTI-TELNILIKTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHI-----------------------TKAHRQIEPGK--YECPFCKK-IVCA--ISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTD---VSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHL---SSHQIYQCIKCQKKFFNPNSLVLHEQVH 2671
            C  T+ +RA       L+ L K++ C  CNK  +R      H   H   +  KC +CG   N+    SH+  H +       Y CE C ++   K   E H  +H   K   C  CD +F +  +LARH                           HR++  G+  Y+C  C K  VC   ++ H R H    P +C  C++  SN S+   H R H                  S  + + C  C KTF+ KA    H + H+        P    +     R   S V H  LH G   Y    CD+       ++ +I I+ + K Y C  C   F  +  L++HH      KP K                      C AC +   R SH+K H    +  + Y+C +C K F + ++L+ H+ +H
Sbjct:  447 CGNTFRHRASLVYHRRLHTLEKSYKCTVCNKVFMRNSVLAVHTRIHTAKKPYKCNECGKAFNQQ---SHLSRHRRLHTGEKPYKCEACDKVFGQKSALESHKRIHTGEKPYRCQVCDTAFTWNSQLARHTRIHTGEKTYKCNECGKTFSYKSSLVWHRRLHGGEKSYKCKVCDKAFVCRSYVAKHTRIHSGMKPYKCNECSKTFSNRSSLVCHRRIH------------------SGEKPYKCSECSKTFSQKATLLCHRRLHSGEK-----PYKCNDCGNTFRHWSSLVYHRRLHTGEKSYKCTVCDKAFVRNSYLARHIRIHTAEKPYKCNECGKAFNEQSHLSRHHRIHTGEKPYK----------------------CEACDKVFSRKSHLKRHRIIHTGEKPYKCNECGKAFSDRSTLIHHQAIH 828          

HSP 2 Score: 75.0998 bits (183), Expect = 4.275e-13
Identity = 112/438 (25.57%), Postives = 183/438 (41.78%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTITE-LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIV---TDVSDNINIYKS-KTYYCELCRIPFPNKFELNKH-----HNRRHKLKPRKKT----SLIIFMKKYRHQKLNFKKVSC---FACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            C K ++ ++  +  + L+  +K + C  C K     +    H   H G +  KC +CG   N ++ +  H   H     Y CE C ++ + K   ERH  +H   K   C  CD +F    +LAR     HR+I  G+  Y+C  C+K     S    H R H  E P +C +C         ++A + YH  L            H + KS  + C +C K F   ++   H + H      PY   N        + H+S  H  LH G   Y    CD++    + +  +  I+   K Y C++C   F    +L +H       + +K     KT    S +++ ++    + ++K   C   F C R     H + H S  + Y+C +C K F N +SLV H ++H      +CS C + F+    L+ H ++
Sbjct:  279 CGKAFNQQSHLSRHQRLHTGVKPYKCKICEKAFACHSYLANHTRIHSGEKTYKCNECGKAFNHQSSLARHHILHTGEKPYKCEECDKVFSQKSTLERHKRIHTGEKPYKCKVCDTAFTCNSQLAR-----HRRIHTGEKTYKCNECRKTFSRRSSLLCHRRLHSGEKPYKCNQCGNTFR----HRASLVYHRRL------------HTLEKS--YKCTVCNKVFMRNSVLAVHTRIHTAKK--PY-KCNECGKAFNQQSHLSR-HRRLHTGEKPYKCEACDKVFGQKSALESHKRIHTGEKPYRCQVCDTAFTWNSQLARHTRIHTGEKTYKCNECGKTFSYKSSLVWHRRLHGGEKSYKCKVCDKAFVC-RSYVAKHTRIH-SGMKPYKCNECSKTFSNRSSLVCHRRIHSGEKPYKCSECSKTFSQKATLLCHRRL 687          

HSP 3 Score: 62.3882 bits (150), Expect = 4.310e-9
Identity = 105/439 (23.92%), Postives = 174/439 (39.64%), Query Frame = 2
Query: 1574 TELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYH--------NILSSKGRDRTITPRH--LISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPY-CPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            T ++   KT+ C  C K    ++   RH + H G +  KC++C  V + K+ +  H + H     Y C+VC           RH  +H   K   C EC  +F     L       HR++  G+  Y+C  C        ++ +H R H  E   +C  CN+V    S    H R H        N        ++   RH  L +  + + C+ C K F  K+    H + H      PY C +   ++       + A H  +H G   Y  C+E     S   ++          K+Y C++C   F  +  + KH      +KP K          ++SL+     +R      K   C  CS+        + H + H S  + Y+C  C   F + +SLV H ++H  + S +C++C + F  +  L  H+++
Sbjct:  321 TRIHSGEKTYKCNECGKAFNHQSSLARHHILHTGEKPYKCEECDKVFSQKSTLERHKRIHTGEKPYKCKVCDTAFTCNSQLARHRRIHTGEKTYKCNECRKTFSRRSSLL-----CHRRLHSGEKPYKCNQCGNTFRHRASLVYHRRLHTLEKSYKCTVCNKVFMRNSVLAVHTRIHTAKKPYKCNECGKAFNQQSHLSRHRRLHTGEKPYKCEACDKVFGQKSALESHKRIHTGEK--PYRCQV--CDTAFTWNSQL-ARHTRIHTGEKTYK-CNECGKTFSYKSSLVWHRRLHGGEKSYKCKVCDKAFVCRSYVAKHTRIHSGMKPYKCNECSKTFSNRSSLVC----HRRIHSGEKPYKCSECSKTFSQKATLLCHRRLH-SGEKPYKCNDCGNTFRHWSSLVYHRRLHTGEKSYKCTVCDKAFVRNSYLARHIRI 743          

HSP 4 Score: 59.3066 bits (142), Expect = 3.222e-8
Identity = 85/349 (24.36%), Postives = 136/349 (38.97%), Query Frame = 2
Query: 1745 KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIVTDVSDNINIYK-----SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKM 2749
            +Y C+VCG++   K+    H   H   K   C EC  SF Y   L  H  + H  ++P  Y+C  C K+     A+  H   H  E P +C  C +  +  S    H R H           + P         + C+IC+K F   +    H + H+      C  C           R HI      LH G   Y    CD++ +  S  +  +K      K Y C++C   F    +L +H     ++   +KT      +K       F + S   C R++         S  + Y+C +C   F +  SLV H ++H  + S +C++C + F  +  L  H ++
Sbjct:  189 QYKCDVCGKLFNHKQYLACHRRCHTGEKPYKCKECGKSFSYKSSLTCH-HRLHTGVKP--YKCNECGKVFRQNSALVIHKAIHTGEKPYKCNECGKAFNQQSHLSRHQRLHT---------GVKP---------YKCKICEKAFACHSYLANHTRIHSGEKTYKCNECGKAFNHQSSLARHHI------LHTGEKPYKCEECDKVFSQKS-TLERHKRIHTGEKPYKCKVCDTAFTCNSQLARH----RRIHTGEKTYKCNECRK------TFSRRSSLLCHRRLH--------SGEKPYKCNQCGNTFRHRASLVYHRRLHTLEKSYKCTVCNKVFMRNSVLAVHTRI 491          
BLAST of Zinc finger protein 112-like vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0335473)

HSP 1 Score: 69.707 bits (169), Expect = 9.227e-12
Identity = 103/440 (23.41%), Postives = 168/440 (38.18%), Query Frame = 2
Query: 1595 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDC-GLVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGR----DRTITPR-HLI------SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTD---VSDNINIYKSKTYY-CELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFHKMAF 2767
            K F C  C +     ++  RH   H+G     C  C  +  N   +  HMK H     + C +C +  A KE+ + H   H       C  C  +F     +  H+ K   Q     ++C  C K       +++H+R+H  E P +CE C +  S    +  HI +H    +  R     +T T + HL+      +      C  C KTF  K     H + H   +   C YC           +EH++  H   H G + +   +C +  T    +++++ ++   + + CE C+  F  K  LN H  +     P           +K  LI  M +       F   +C  C +   +      H +SH    ++   + C KC K F     LV H + H  +    C++C + F     L  H+KM H  A 
Sbjct:  247 KPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGQTP---HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYC-----TKTFTRKEHLTN-HVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPF---TCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 674          
BLAST of Zinc finger protein 112-like vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0335474)

HSP 1 Score: 65.4698 bits (158), Expect = 2.205e-10
Identity = 100/429 (23.31%), Postives = 156/429 (36.36%), Query Frame = 2
Query: 1595 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDC-GLVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTD---VSDNINIYKSKTYY-CELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFHKMAF 2767
            K F C  C +     ++  RH   H+G     C  C  +  N   +  HMK H     + C +C +  A KE+ + H   H       C  C  +F     +  H+ K H    P  + C FC K      H   H+R H  E+P +C  C +  +       HIR H                  +    F C  C K F  K     H + H   +   C YC           +EH++  H   H G + +   +C +  T    +++++ ++   + + CE C+  F  K  LN H  +     P           +K  LI  M +       F   +C  C +   +      H +SH    ++   + C KC K F     LV H + H  +    C++C + F     L  H+KM H  A 
Sbjct:  247 KPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETP--HRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH------------------TGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTR-----KEHLTN-HVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPF---TCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 645          
BLAST of Zinc finger protein 112-like vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0080263)

HSP 1 Score: 64.3142 bits (155), Expect = 3.927e-10
Identity = 92/388 (23.71%), Postives = 145/388 (37.37%), Query Frame = 2
Query: 1679 KCKDCGL-VVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIVT---DVSDNINIYKSKTYY-CELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFHKMAF 2767
            +C  CG     K  + +HM+SH     + CE+CG+  + KE+   HI  H     + C  C  +F     L  H+ + H    P  + C +C K      H   H+R H  E P +C  C +  +       H+R H   S                     C  C KTF  K   T H + H   +   C YC     +     +EH++  H  LH G + +   +C +  T    +++++  + S   + C +C  PF  K  L  H +R H                        +  +C  C +   +      H +SH    ++   + C KC K F     LV H + H  +    C++C + F     L  H+KM H  A 
Sbjct:  184 QCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHV-RQHTGESP--HRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESP------------------HKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYC-----KKTFTRKEHLTN-HVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCH---------------------TGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 523          
BLAST of Zinc finger protein 112-like vs. Ensembl Fly
Match: Meics (gene:FBgn0025874 transcript:FBtr0333030)

HSP 1 Score: 62.3882 bits (150), Expect = 1.446e-9
Identity = 84/342 (24.56%), Postives = 135/342 (39.47%), Query Frame = 2
Query: 1682 CKDCGLVVNKN-KICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALR-EHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISH-MKSHLSSHQI--YQCIKCQKKFFNPNSLVLHEQVH 2671
            C  CG     N ++ +H + H     + C +C +        + H+  H++ K + CP+CD +F     L  HI + H    P  Y+CP C +       +  H R H EE P +CE C +          H+R HN       DR             F C  C K+F  K+   +H + H+        P    E   A    H    H  +H G   Y  CD+     S N ++ K   ++ +    PF    +  K ++ +  L+  +KT       K  HQ        C  C  +  +   +  H++SH+I  + C +C + FF+  SL  H ++H
Sbjct:  262 CDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKCPQCDKTFYTRGNLRAHIQR-HTGERP--YKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHN------GDRQ------------FKCPDCDKSFFEKSNMMKHQRTHSGIK-----PFKCEECGQAFSHNHHLKSHLRIHTGEKPYK-CDQCGKGFSANQSLMKHTLWHVDNNDRPFKCS-QCPKAYDTQQSLRGHEKTHKNPDEPKTLHQ--------CPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKSLKKHLRLH 567          

HSP 2 Score: 58.5362 bits (140), Expect = 2.534e-8
Identity = 60/230 (26.09%), Postives = 96/230 (41.74%), Query Frame = 2
Query: 1607 CVTCNKTVRKR-NEKRHALTHLGNE--KCKDCGLVVNKN---KICSHM-KSHFKYICEVCGRIDAFKENHE--RHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTH-----EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ------FTCCPYCPI 2236
            C  C+KT   R N + H   H G    KC DC     KN   K+ S + K    + CE+CG+   F +N     H+ VH   ++  CP+CD SF     + +H  + H  I+P  ++C  C +   + +HHL++H      E P +C++C +  S   +   H  +                H+ +    F C  C K ++ +     H K H           CP+C +
Sbjct:  318 CPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGK--GFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKH-QRTHSGIKP--FKCEECGQAF-SHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLW----------------HVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDV 525          

HSP 3 Score: 52.373 bits (124), Expect = 1.903e-6
Identity = 49/189 (25.93%), Postives = 86/189 (45.50%), Query Frame = 2
Query: 1562 KYTITELNI--LIKTFFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNP--CPECDASFQYLVELARHITKAHRQIEPGK--YECPFCK---KIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNI 2071
            ++ IT L +    + F C  C+K+   K N  +H  TH G +  KC++CG   + N    H+KSH +       Y C+ CG+  +  ++  +H   H      P  C +C  ++     L  H  K H+  +  K  ++CP C     +   +  H+ +H+  P  C +C +   +  + K H+R HN+
Sbjct:  385 QHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHN---HHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGH-EKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRPHPCPQCPEGFFSQKSLKKHLRLHNL 569          

HSP 4 Score: 50.0618 bits (118), Expect = 9.963e-6
Identity = 80/323 (24.77%), Postives = 118/323 (36.53%), Query Frame = 2
Query: 1838 CPECDASFQYLVELARHITKAHRQIEPGK-YECPFCK---KIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKH---HNRRHKLK-PRKKTSLIIFMKKYRHQKL--NFKKVSCFACSRKIRIS-HMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR---CSICYQFFTSHIRLMAHLK 2746
            C EC  S+     LARH+ K   Q +  K + C FC    +    ++ H R H  E P +C  C +  ++    K+H+  H+    KG                  C  C KTF  +     H + H       CP CP  +      L+     +H  LH+                      + + + CELC   F     L  H   HN   + K P    S        +HQ+     K   C  C +    + H+KSHL  H   + Y+C +C K F    SL+ H   H  ++ R   CS C + + +   L  H K
Sbjct:  230 CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFKCPLCPKAYTHGPTLKSHMHTHD--EEKGH----------------KCPQCDKTFYTRGNLRAHIQRHTGERPYKCPDCP-QTFAKNSGLK-----LHSRLHK----------------------EERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEK 506          
BLAST of Zinc finger protein 112-like vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0080260)

HSP 1 Score: 62.7734 bits (151), Expect = 1.450e-9
Identity = 97/429 (22.61%), Postives = 157/429 (36.60%), Query Frame = 2
Query: 1595 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDC-GLVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA----ISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTD---VSDNINIYKSKTYY-CELCRIPFPNKFELNKHHNRRHKLKPR----------KKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFHKMAF 2767
            K F C  C +     ++  RH   H+G     C  C  +  N   +  HMK H     + C +C +  A KE+ + H   H       C  C  +F     +  H+ K H    P  + C  CKK        ++H++    E P +C+ C++  +       H+R H   S                     C  C KTF  K     H + H   +   C YC           +EH++  H   H G + +   +C +  T    +++++ ++   + + CE C+  F  K  LN H  +     P           +K  LI  M +       F   +C  C +   +      H +SH    ++   + C KC K F     LV H + H  +    C++C + F     L  H+KM H  A 
Sbjct:  247 KPFMCQVCGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRK-HTGETP--HRCDICKKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESP------------------HRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYC-----TKTFTRKEHLTN-HVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPF---TCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM 645          
BLAST of Zinc finger protein 112-like vs. Ensembl Zebrafish
Match: drll.3 (draculin-like, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-060531-126])

HSP 1 Score: 94.7449 bits (234), Expect = 1.616e-19
Identity = 111/436 (25.46%), Postives = 178/436 (40.83%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTITEL-NILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSD----NINI---YKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHEKSSQR---CSICYQFFTSHIRLMAHLK 2746
            C K++ ++ +  I  L +   K   C  C K+ R + E K+H   H G +  KC++CG     KN +  HMK H     Y C+ CG+   +K++ + H+ +H K     C EC  SF+  ++   H+T  H + +P  Y+C  C+K      H   H++ H  E P +CE C +        ++H+  H         R + P         ++C  C K F  K  + +H   H      PY      +  P   E    +H   H G   +  CD+     S     NI++      K Y C+ C + F +   L  H       KP       K  S  +F+K +       +  SC  C +    +  ++ H   H +   + C  C K +F    L  H  VH  S++R   CS+C++ F+    L  H K
Sbjct:  200 CGKSFRSKGEVKIHMLIHTRKKPHECDQCGKSFRSKGEVKQHMSIHTGLKPYKCEECGKFFAQKNNLQVHMKVHTGEKPYRCDQCGKCFPYKQSLKLHLEIHAKGNPYTCDECGKSFKTCLQFRSHMT-LHPEYKP--YKCDQCEKSYGREDHLQRHMKLHTGEKPHKCEHCGKSFPMRDLLRSHLMVH---------REVKP---------YTCDQCGKGFTLKKCYNEHMNIHTGER--PYTCDQCGKGFPY--EQSLNLHMRFHRGEKPF-TCDQCGQSFSQKGAYNIHMKIHTGEKPYTCDQCGMSFRHGSSLKLHMTHHTGEKPFHCDQCDKCYSTALFLKNHMKTHNKDQIYSCLTCGKTFNLLGCLRMHEKRHTLVKPFMCFDCGKCYFTDTELKQHLSVH--SNERPYMCSLCFKSFSRMDSLKKHEK 607          
BLAST of Zinc finger protein 112-like vs. Ensembl Zebrafish
Match: znf1143 (zinc finger protein 1143 [Source:ZFIN;Acc:ZDB-GENE-131125-17])

HSP 1 Score: 87.0409 bits (214), Expect = 1.762e-17
Identity = 109/432 (25.23%), Postives = 172/432 (39.81%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTI-TELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKN-KICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIVTDVSDNINIYKSKT----YYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            C K++ + + +     ++   K F C  C K  R  ++ K+H   H G +   C  CG   +++ ++  HM  H     +IC  CG   + + + ++H+ +H   K   CP+C  SF++L   ++     H+ I  G+  Y C  C K     SH   H+RTH  E P  C +C    S  S+   H+  H                  +  + F+C  C K+F+  +  TQH K H       C +C      S   LR     VH +LH     Y    C++  T  S      KS T    Y C  C+  +    +L  H       KP K                      C  C ++   +  +KSH   H   ++Y+C +C K+F +  +L  HE++H       C  C Q FT   RL  H+ +
Sbjct:   43 CGKSFRDSSTFNKHMTIHTDEKPFTCTQCGKNFRDSSQLKQHMRIHTGEKPFTCTQCGKSFSQSSQLNQHMMIHTGAKPFICSQCGASFSQQSSLKQHMRIHTGEKPFTCPQCGKSFRHLSNFSK-----HKMIHTGEKPYACSQCGKSFSHSSHRNRHMRTHTGEKPHTCTQCGTSFSEPSSLNQHMMIH------------------TGEKPFTCSQCGKSFSLSSRLTQHMKIHTGEKPHKCDHC------SKTFLRPSKLKVHLALHRSEKPYSCPVCEKSYTLESKLKRHQKSHTAVRQYMCFKCKKTYITATQLKLHERNHTGEKPFK----------------------CSHCDKRFSLLGSLKSHEKVHTGEKLYKCSQCSKRFSHLGTLKRHERIHTGEKPYTCDQCSQSFTYLERLKKHMNI 423          

HSP 2 Score: 55.4546 bits (132), Expect = 2.288e-7
Identity = 90/389 (23.14%), Postives = 149/389 (38.30%), Query Frame = 2
Query: 1682 CKDCGLVV-NKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            CK CG    +K+ +  HM+ H     + C  CG+         +H+++H   K   C +C  +F+   +L +H+ + H   +P  + C  C K       ++ H+  H    P  C +C    S  S+ K H+R H                  +  + F+C  C K+F + + F++H   H   +   C  C  +   S    R      H   H G   +  C +  T  S+  ++ +        K + C  C   F     L +H       KP K           + L + +  +R +    K  SC  C +   +      H KSH +  Q Y C KC+K +     L LHE+ H      +CS C + F+    L +H K+
Sbjct:   12 CKLCGKTFKHKSHLNQHMRIHTGERPFSCTQCGKSFRDSSTFNKHMTIHTDEKPFTCTQCGKNFRDSSQLKQHM-RIHTGEKP--FTCTQCGKSFSQSSQLNQHMMIHTGAKPFICSQCGASFSQQSSLKQHMRIH------------------TGEKPFTCPQCGKSFRHLSNFSKHKMIHTGEKPYACSQCGKSFSHSSHRNR------HMRTHTGEKPHT-CTQCGTSFSEPSSLNQHMMIHTGEKPFTCSQCGKSFSLSSRLTQHMKIHTGEKPHKCDHCSKTFLRPSKLKVHLALHRSE----KPYSCPVCEKSYTLESKLKRHQKSHTAVRQ-YMCFKCKKTYITATQLKLHERNHTGEKPFKCSHCDKRFSLLGSLKSHEKV 367          
BLAST of Zinc finger protein 112-like vs. Ensembl Zebrafish
Match: znf1057 (zinc finger protein 1057 [Source:ZFIN;Acc:ZDB-GENE-131120-158])

HSP 1 Score: 87.0409 bits (214), Expect = 2.937e-17
Identity = 107/432 (24.77%), Postives = 166/432 (38.43%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTI-TELNILIKTFFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVV-NKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSHQ---IYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            C K++  +  +     ++   + F C  C K+     N   H   H G +   C  CG     K  +  HM+ H     Y CE CG+  + K+  + H+ +H   ++  C +C  SF +   LA H+ + H   +P  + C  C K  C    +  H+R H  E P  CE+C +  S   + K H+R H      G  +             F CQ C K+  +      H + H     F+C   C   S    P L       H  +H     Y  C++    +    ++Y         K Y C  C   FP+K  L KHH R H                        K  +C  C +     + +K+H++ H    ++ C +C K     +S+  H ++H EK   RCS C + F     L AHLK+
Sbjct:  115 CGKSFGQKQSFKAHMRIHTGERKFTCQECGKSFYHAGNLAAHMRIHTGEKPFSCNQCGKSFCQKPNLDVHMRVHTGEKPYTCEQCGKSFSQKQGFKAHMRIHTGERKFTCQQCGKSFYHAGNLAAHM-RIHTGEKP--FSCKQCGKSFCQKPNLEDHMRVHTGEKPYTCEQCGKSFSQKQSLKTHMRIHT-----GERK-------------FPCQQCGKSVYHAGNLAAHMRTHTGEKPFSC-KQC-RKSFSKKPNL-----IAHMRVHTREKLY-TCEQCGKSLGKKQDLYIHMRIHTGEKPYSCTECGKSFPHKSSL-KHHMRTH---------------------TGEKPFTCDQCGKSFSTKASLKNHMNGHTGTIVFTCDQCGKSLTRKDSIKNHMKIHSEKDHFRCSECGKGFKCKRSLSAHLKL 495          

HSP 2 Score: 61.2326 bits (147), Expect = 3.748e-9
Identity = 61/226 (26.99%), Postives = 103/226 (45.58%), Query Frame = 2
Query: 1595 KTFFCVTCNKTV-RKRNEKRHALTHLGNEK--CKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN---ILSSKGRDRTITPRHLI-------SKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2209
            K + C  C K+  +K++ K H   H G  K  C+ CG  V +   + +HM++H     + C+ C +  + K N   H+ VH + K   C +C  S     +L  H+ + H   +P  Y C  C K      ++ HH+RTH  E P  C++C +  S  ++ K H+  H    + +     +++T +  I       S+ + F C  C K F  K   + H K H++
Sbjct:  276 KPYTCEQCGKSFSQKQSLKTHMRIHTGERKFPCQQCGKSVYHAGNLAAHMRTHTGEKPFSCKQCRKSFSKKPNLIAHMRVHTREKLYTCEQCGKSLGKKQDLYIHM-RIHTGEKP--YSCTECGKSFPHKSSLKHHMRTHTGEKPFTCDQCGKSFSTKASLKNHMNGHTGTIVFTCDQCGKSLTRKDSIKNHMKIHSEKDHFRCSECGKGFKCKRSLSAHLKLHSR 498          
BLAST of Zinc finger protein 112-like vs. Ensembl Zebrafish
Match: si:ch73-367f21.5 (si:ch73-367f21.5 [Source:ZFIN;Acc:ZDB-GENE-120214-29])

HSP 1 Score: 85.1149 bits (209), Expect = 1.274e-16
Identity = 119/431 (27.61%), Postives = 176/431 (40.84%), Query Frame = 2
Query: 1601 FFCVTCNK--TVRKRNEKRHALTHLGNEK--CKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI---------LSSKGRDRTITPRHLISKSE-CFSCQICQKTFNYKAMFTQHYKCHA---QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTD------VSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            F C  C+K  TV++  E  H   H G +   C  CG     K+ +  HM+ H     Y C+VCG+    K++ E+H+++H   K   CPEC  SF+    L  HI K H   +P  Y C  C K       +  H+R H  E P  C  C +        K H+R H             S   ++ +T    I   E  F C  C K F  K     H + H    ++T CP C   S     +L  HI +     H G   +  CD+          +  +I I+   K + C  C   F  K +L +H       KP            K SL I M+ +  +KL     +C  C +        ISHMK H +  + Y C++C K F    SL +H ++H   +   CS C + F    +L++H+++
Sbjct:   90 FTCPECDKCFTVKQSLET-HLKIHTGEKPFICPYCGKNFRIKHSLEGHMRIHTGEKPYPCQVCGKSFREKQSLEKHLTIHTGEKPYSCPECGKSFRVKNCLENHI-KIHTGEKP--YTCQECGKSFTEKQNLKRHMRIHTGEKPFTCSHCGKSFRVSKDLKIHVRIHTGEKPFSCQQCGKSFSENKKLTSHMRIHTGEKPFVCSHCGKRFRGKQNLESHIRLHTGEKRYT-CPQCG-KSYNEQKSLENHIRS-----HTGEKPFA-CDQCGKSFRQQRILKGHIRIHTGEKPFTCPQCGKSFIEKTKLERHKKIHSGEKPYTCHHCKKSFTMKQSLDIHMRIHTGEKL----YTCQQCGKSFALKQRLISHMKVH-TGEKPYTCLQCGKGFREKQSLDIHNRIHTGQNPFTCSQCGKSFRVKQKLVSHMRV 503          

HSP 2 Score: 65.855 bits (159), Expect = 1.451e-10
Identity = 103/400 (25.75%), Postives = 158/400 (39.50%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPR-------------HLISKS--ECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEG-------HTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH 2671
            K + C  C K+ R K++ ++H   H G +   C +CG     KN + +H+K H     Y C+ CG+    K+N +RH+ +H   K   C  C  SF+   +L  H+ + H   +P  + C  C K       ++ H+R H  E P  C  C +        ++HIR H      G  R   P+             H+ S +  + F+C  C K+F  + +   H + H     FTC P C  + +E     R      H  +H G       H K  F  +   D+   I+  + K Y C+ C   F               LK R    LI  MK +  +K      +C  C +  R       H + H +    + C +C K F     LV H +VH
Sbjct:  144 KPYPCQVCGKSFREKQSLEKHLTIHTGEKPYSCPECGKSFRVKNCLENHIKIHTGEKPYTCQECGKSFTEKQNLKRHMRIHTGEKPFTCSHCGKSFRVSKDLKIHV-RIHTGEKP--FSCQQCGKSFSENKKLTSHMRIHTGEKPFVCSHCGKRFRGKQNLESHIRLHT-----GEKRYTCPQCGKSYNEQKSLENHIRSHTGEKPFACDQCGKSFRQQRILKGHIRIHTGEKPFTC-PQCGKSFIEKTKLER------HKKIHSGEKPYTCHHCKKSFTMKQSLDIHMRIHTGE-KLYTCQQCGKSFA--------------LKQR----LISHMKVHTGEK----PYTCLQCGKGFREKQSLDIHNRIH-TGQNPFTCSQCGKSFRVKQKLVSHMRVH 504          

HSP 3 Score: 59.6918 bits (143), Expect = 1.298e-8
Identity = 66/247 (26.72%), Postives = 107/247 (43.32%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTI-TELNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNEK--CKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-------ILSSKG-RDRTITPRH--LISKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2209
            C K++    K T    ++   K F C  C K  R K+N + H   H G ++  C  CG   N+ K + +H++SH     + C+ CG+    +   + HI +H   K   CP+C  SF    +L RH  K H   +P  Y C  CKK      ++  H+R H  E    C++C +  +      +H++ H        +   KG R++     H  + +    F+C  C K+F  K     H + H +
Sbjct:  263 CGKSFSENKKLTSHMRIHTGEKPFVCSHCGKRFRGKQNLESHIRLHTGEKRYTCPQCGKSYNEQKSLENHIRSHTGEKPFACDQCGKSFRQQRILKGHIRIHTGEKPFTCPQCGKSFIEKTKLERH-KKIHSGEKP--YTCHHCKKSFTMKQSLDIHMRIHTGEKLYTCQQCGKSFALKQRLISHMKVHTGEKPYTCLQCGKGFREKQSLDIHNRIHTGQNPFTCSQCGKSFRVKQKLVSHMRVHTE 506          

HSP 4 Score: 55.0694 bits (131), Expect = 3.021e-7
Identity = 85/372 (22.85%), Postives = 142/372 (38.17%), Query Frame = 2
Query: 1748 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK---IVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN--------ILSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSR-----KIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            + C+ CG I    ++HE H  +H   +   C EC  SF  +  L  H+ K H    P  + CP C K   +  ++  HL+ H  E P  C  C +      + + H+R H         +     R++    +HL   +  + +SC  C K+F  K     H K H   +   C  C  +  E     R      H  +H G   +     G    +  D+  ++ I+   K + C+ C   F    +L  H       KP          R K +L   ++ +  +    K+ +C  C +     K   +H++SH +  + + C +C K F     L  H ++H       C  C + F    +L  H K+
Sbjct:   34 FTCKQCGEIFTTNQSHECHTMIHNGEQTFICSECGKSFTQMRYLKNHM-KIHSGDHP--FTCPECDKCFTVKQSLETHLKIHTGEKPFICPYCGKNFRIKHSLEGHMRIHTGEKPYPCQVCGKSFREKQSLEKHLTIHTGEKPYSCPECGKSFRVKNCLENHIKIHTGEKPYTCQECGKSFTEKQNLKR------HMRIHTGEKPFTCSHCGKSFRVSKDLKIHVRIHTGEKPFSCQQCGKSFSENKKLTSHMRIHTGEKPFVCSHCGKRFRGKQNLESHIRLHTGE----KRYTCPQCGKSYNEQKSLENHIRSH-TGEKPFACDQCGKSFRQQRILKGHIRIHTGEKPFTCPQCGKSFIEKTKLERHKKI 391          
BLAST of Zinc finger protein 112-like vs. Ensembl Zebrafish
Match: znf1028 (zinc finger protein 1028 [Source:ZFIN;Acc:ZDB-GENE-131125-19])

HSP 1 Score: 84.3445 bits (207), Expect = 2.634e-16
Identity = 99/410 (24.15%), Postives = 162/410 (39.51%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKN-KICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPR-----KKTSLIIF-MKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            + F C  C K+ R+ ++  +H + H   +   C  CG        +  HM  H     +IC  CG+      +  +H+ VH   K   CP+C  SF+Y+    +     H+ I  G+  Y C  C K     SH   H+RTH  E P  C +C    S  S+   H+R H                  +  + F+C  C K+F+  +  TQH K H                 P   EH S    S               + +  ++++++S K Y C +C   +  + +L +H      ++       KKT +    +K +       K   C  C ++   +  +KSH   H   ++Y+C +C K+F +  +L  HE++H       C  C Q FT   RL  H+ +
Sbjct:  216 RPFTCTQCGKSFRETSQLNKHMMIHTDEKPFTCTKCGKSFKHELSVIKHMMIHTGAKPFICSQCGKSFRLSSSLNQHMRVHTGEKPFTCPQCGKSFRYVSNFTK-----HKMIHTGEKPYACSQCGKSFSHSSHRNRHMRTHTGEKPHTCTQCGTSFSEPSSLNQHMRIH------------------TGEKPFTCSQCGKSFSLSSRLTQHMKIHTG-------------EKPHKCEHCSKTFLS--------------ASQLKMHLSVHRSEKPYSCPVCEKSYTVESKLKRHQKSHTAVRQYMCFKCKKTYITATQLKLHERNHTGEKPFKCSHCDKRFSLLGSLKSHEKVHTGEKLYKCSQCSKRFSHLGTLKRHERIHTGEKPYTCDQCSQSFTYLERLKKHMNI 575          

HSP 2 Score: 60.4622 bits (145), Expect = 7.268e-9
Identity = 102/427 (23.89%), Postives = 167/427 (39.11%), Query Frame = 2
Query: 1607 CVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKI---VCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITP---RHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            C  C K+ R K++ K H   H   +  KC  CG      + +  HM+ H     + C  CG+      +  +H+ +H   +   C +C+ SFQY   L +H+   H    P  + C  C K       ++ H+  H +E P  C +C +   +  +   H+  H      I S  G+   ++    +H+   +  + F+C  C K+F Y + FT+H   H   +   C  C  +   S    R      H   H G   +  C +  T  S+  ++ +        K + C  C   F     L +H       KP K           + L + +  +R +    K  SC  C +   +      H KSH +  Q Y C KC+K +     L LHE+ H      +CS C + F+    L +H K+
Sbjct:  108 CTQCGKSFRTKKSLKLHMRIHTRKKPFKCTQCGKSFQYSSSLNLHMRIHTGERPFTCTQCGKSFKHSSHLNQHMRIHTGERPFTCTQCEKSFQYTSNLNKHMM-IHTGERP--FTCTQCGKSFRETSQLNKHMMIHTDEKPFTCTKCGKSFKHELSVIKHMMIHTGAKPFICSQCGKSFRLSSSLNQHMRVHTGEKPFTCPQCGKSFRYVSNFTKHKMIHTGEKPYACSQCGKSFSHSSHRNR------HMRTHTGEKPHT-CTQCGTSFSEPSSLNQHMRIHTGEKPFTCSQCGKSFSLSSRLTQHMKIHTGEKPHKCEHCSKTFLSASQLKMHLSVHRSE----KPYSCPVCEKSYTVESKLKRHQKSHTAVRQ-YMCFKCKKTYITATQLKLHERNHTGEKPFKCSHCDKRFSLLGSLKSHEKV 519          

HSP 3 Score: 56.6102 bits (135), Expect = 1.280e-7
Identity = 78/352 (22.16%), Postives = 130/352 (36.93%), Query Frame = 2
Query: 1745 KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-----RISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            +  C  CG+    K++ + H+ +H + K   C +C  SFQY   L  H+ + H    P  + C  C K     SH   H+R H  E P  C +C +       Y +++  H ++ +  R               F+C  C K+F   +   +H   H         P    +   + +  +S + H  +H G                      +K + C  C   F     LN+H       KP       K    +    K++      K  +C  C +       R  HM++H +  + + C +C   F  P+SL  H ++H       CS C + F+   RL  H+K+
Sbjct:  105 RLTCTQCGKSFRTKKSLKLHMRIHTRKKPFKCTQCGKSFQYSSSLNLHM-RIHTGERP--FTCTQCGKSFKHSSHLNQHMRIHTGERPFTCTQCEKSF----QYTSNLNKHMMIHTGERP--------------FTCTQCGKSFRETSQLNKHMMIHTDEK-----PFTCTKCGKSFKHELSVIKHMMIHTG----------------------AKPFICSQCGKSFRLSSSLNQHMRVHTGEKPFTCPQCGKSFRYVSNFTKHKMIHTGEKPYACSQCGKSFSHSSHRNRHMRTH-TGEKPHTCTQCGTSFSEPSSLNQHMRIHTGEKPFTCSQCGKSFSLSSRLTQHMKI 407          
BLAST of Zinc finger protein 112-like vs. Ensembl Xenopus
Match: ENSXETT00000031570.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:100498644])

HSP 1 Score: 84.7297 bits (208), Expect = 3.292e-16
Identity = 98/402 (24.38%), Postives = 157/402 (39.05%), Query Frame = 2
Query: 1535 CNKTYDNRAK-YTITELNILIKTFFCVTCNKTVRKR-NEKRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKYG--FCDEIVTDVSDNINIYKSKT----YYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH 2671
            C K +  +   Y    ++   + F C  C KT   + N   H   H G +   C++CG   + K  +C H + H +   +IC  CG+  A K N + HI  H   K   C EC   F +   L RH+ + H+  +P  Y C  C +I    CA+  H + H  E+P  C  C ++ S   +  +H++ H     KG                F+C  C K F+ K+    HY+ H+        P   +E   A  +  +   H+ +H G   +    C    +  S  ++ YK  T    + C  C   F +K +L  H       KP                       +C  C ++    S +K H   H   + + C  C KKF   ++L  H+++H
Sbjct:  231 CGKRFSQKGNLYRHQTMHTGERPFMCTECGKTFSDQSNLSAHHKIHRGEKPFSCRECGKSFSHKGNLCRHQEVHIQAKQFICTECGKTFAHKSNFKTHIKTHSAEKLFSCTECGKMFAHKAVLGRHL-EIHKPRKP--YPCAVCGRIFTGKCALLTHQKLHNGESPFSCIECGKIFSAKHSLLSHLKSHT--GEKG----------------FTCTQCGKEFSRKSTLQSHYRIHSGEK-----PFTCMECGKAFSQKSNLQTHYKIHTGEKPFTCMECGRTFSQKSTLLSHYKMHTGERPFSCTECGKSFSHKNKLTLHQKIHTGEKP----------------------FACTECGKRFPEKSKLKIHWKIHTREKPFSCTDCGKKFSRESNLYFHQKMH 584          

HSP 2 Score: 68.5514 bits (166), Expect = 3.675e-11
Identity = 103/426 (24.18%), Postives = 151/426 (35.45%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTIT-ELNILIKTFFCVTCNKTV-RKRNEKRHALTHLGNEK--CKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            C K +  R+   +  +L+   K F C  C K   +K N  RH   H G     C +CG    +++ + +H K H     + C  CG+  + K N  RH  VH +AK+  C EC  +F +      HI K H   +   + C  C K+      +  HL  H+   P  C  C ++ +   A   H + HN  S                   FSC  C K F+ K     H K H     FTC       S       R+     H+ +H G                       K + C  C   F  K  L  H+      KP                       +C  C R        +SH K H +  + + C +C K F + N L LH+++H       C+ C + F    +L  H K+
Sbjct:  203 CGKQFSLRSNLLVHHKLHTGEKPFTCTECGKRFSQKGNLYRHQTMHTGERPFMCTECGKTFSDQSNLSAHHKIHRGEKPFSCRECGKSFSHKGNLCRHQEVHIQAKQFICTECGKTFAHKSNFKTHI-KTHSAEK--LFSCTECGKMFAHKAVLGRHLEIHKPRKPYPCAVCGRIFTGKCALLTHQKLHNGESP------------------FSCIECGKIFSAKHSLLSHLKSHTGEKGFTCTQCGKEFS-------RKSTLQSHYRIHSG----------------------EKPFTCMECGKAFSQKSNLQTHYKIHTGEKP----------------------FTCMECGRTFSQKSTLLSHYKMH-TGERPFSCTECGKSFSHKNKLTLHQKIHTGEKPFACTECGKRFPEKSKLKIHWKI 555          

HSP 3 Score: 56.6102 bits (135), Expect = 1.927e-7
Identity = 91/378 (24.07%), Postives = 143/378 (37.83%), Query Frame = 2
Query: 1709 KNKICSHMKSHFKY---ICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAIS----HHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCH---AQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTD---VSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHL---SSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            K+++CS   SH      +    G+  +    H  H+ +H  AK  PC EC   F     L  H  K H   +P  + C  C K          H      E P  C  C +  S+ S   AH + H         R   P         FSC+ C K+F++K    +H + H    QF C  C     +       ++ H +   FS  E       C ++      +  ++ I+K  K Y C +C   F  K  L  H    +   P            K SL+  +K +  +    K  +C  C ++  R S ++SH    S  + + C++C K F   ++L  H ++H       C  C + F+    L++H KM
Sbjct:  154 KSRLCSQWGSHTGTNHSLAWKVGKKISKSNFHRLHVKIHSGAKLFPCTECGKQFSLRSNLLVH-HKLHTGEKP--FTCTECGKRFSQKGNLYRHQTMHTGERPFMCTECGKTFSDQSNLSAHHKIH---------RGEKP---------FSCRECGKSFSHKGNLCRHQEVHIQAKQFICTECGKTFAHKSNFKTHIKTHSAEKLFSCTE-------CGKMFAHKAVLGRHLEIHKPRKPYPCAVCGRIFTGKCALLTHQKLHNGESPFSCIECGKIFSAKHSLLSHLKSHTGE----KGFTCTQCGKEFSRKSTLQSHYRIHSGEKPFTCMECGKAFSQKSNLQTHYKIHTGEKPFTCMECGRTFSQKSTLLSHYKM 499          
BLAST of Zinc finger protein 112-like vs. Ensembl Xenopus
Match: abraxas1 (abraxas 1, BRCA1 A complex subunit [Source:Xenbase;Acc:XB-GENE-5730310])

HSP 1 Score: 82.0333 bits (201), Expect = 1.853e-15
Identity = 119/459 (25.93%), Postives = 178/459 (38.78%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTITE-LNILIKTFFCVTCNKTVRKR-NEKRHALTHLGNEK--CKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYC-PINSLESIPALREHISAVHFSLHEGHTKY-----GFCDEIVTDVS--DNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKL-KP----------RKKTSLIIFMKKYRHQKLNFKKVSCFAC--SRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRC 2794
            C+K + ++ K+   + ++   K F C  C K+   R N  RH  TH G +   C +CG   + ++ +  H ++H     Y C  CG+  +++ + + H   H   K   C EC  SF  L     H  + H   +P  Y C  C K   A S    H RTH  E P  C  C +  S  S  K H R H                  S  + FSC  C K F+Y++    H++ H     F+C  C  C P  S      L+E     H+  H G   Y     G C  I+  +S     +    K + C  C   F    +L  H  R H   KP             + L +  + +  +K  F    C  C   R     H ++H      Y C +C K F   +   +HE++H    Q  CS C ++F S    ++H + +H        SC+ C
Sbjct:   56 CHKHFTDKRKFDKHQRVHKREKPFSCSECGKSFPCRSNLDRHHRTHTGEKPFFCSECGKCFSCRSDLKKHCRTHTGEKPYSCSECGKCFSYRSHLKEHYRTHTGEKPFSCSECGKSFSSLYMCNVHQRRTHTGEKP--YSCSECGKCFAASSDLTVHHRTHTGERPFPCPDCGKCFSYRSHLKEHYRTH------------------SGEKPFSCSECGKCFSYRSHLNNHHRTHTGEKPFSCSECGKCFPYRSY-----LKE-----HYRTHTGEKPYSCSECGKCFAILYSLSVHQRRSHTGEKPFSCSDCEKCFAASSDLTSHRRRNHTGEKPFSCSICGKSFASSSELTVHGRTHTREKP-FSCSECGKCFSDRSCLKDHHRTHTGEKPFY-CSECGKCFATSSQRTVHERIHTGEKQFPCSECGKYFGSSSERISHQRRYHTEKPFKCYSCTDC 482          

HSP 2 Score: 51.9878 bits (123), Expect = 3.877e-6
Identity = 86/363 (23.69%), Postives = 136/363 (37.47%), Query Frame = 2
Query: 1748 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI-----LSSKGRDRT------ITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTS----LIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSH--------QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2740
            ++C  C +    K   ++H  VH++ K   C EC  SF     L RH  + H   +P    EC  C      +  H RTH  E P  C  C +  S  S  K H R H        S  G+  +      +  R   +  + +SC  C K F   +  T H++ H      P+ P        + R H+   H+  H G   +     G C    + ++++   +   K + C  C   FP +  L +H+      KP   +       I      HQ+ +      F+CS   +     S L+SH        + + C  C K F + + L +H + H +     CS C + F+    L  H
Sbjct:   51 HLCNECHKHFTDKRKFDKHQRVHKREKPFSCSECGKSFPCRSNLDRHH-RTHTGEKPFFCSECGKCFSCRSDLKKHCRTHTGEKPYSCSECGKCFSYRSHLKEHYRTHTGEKPFSCSECGKSFSSLYMCNVHQRRTHTGEKPYSCSECGKCFAASSDLTVHHRTHTGER--PF-PCPDCGKCFSYRSHLKE-HYRTHSGEKPFSCSECGKCFSYRSHLNNHHRTHTGEKPFSCSECGKCFPYRSYLKEHYRTHTGEKPYSCSECGKCFAILYSLSVHQRRSHTGEKPFSCSDCEKCFAASSDLTSHRRRNHTGEKPFSCSICGKSFASSSELTVHGRTHTREKPFSCSECGKCFSDRSCLKDH 408          
BLAST of Zinc finger protein 112-like vs. Ensembl Xenopus
Match: stk31 (serine/threonine kinase 31 [Source:Xenbase;Acc:XB-GENE-983236])

HSP 1 Score: 81.6481 bits (200), Expect = 3.759e-15
Identity = 113/431 (26.22%), Postives = 162/431 (37.59%), Query Frame = 2
Query: 1601 FFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN---------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSR 2791
             FC  C K VR ++    H   H G     C +CG     KN + +HMK H     + C  CG+    K++ E H+ +H   K   C EC   F     +  H+ K H   +P  + C  C K      +   HL+TH  E P  C  C +   +  A  AH + H            S +G+      RH+ +  + FSC+ C K FN K +   H   H   +   CP C   +L S  +L  H+                  +I T V         K + C  C I F  K  L  H       KP   T    S  +     RH ++    K  SC  C    R     + H+K H +    + C +C K F   +SL+ H  +H       C+ C + F     L+AH K   K   + S  C +
Sbjct:  421 LFCTECGKGVRSKSHLASHMKKHTGERPYTCSECGKGFAQKNNLDTHMKIHTGEKPFTCTECGKCFTQKKHLESHMKIHTGEKPFTCTECGKDFAQKSSILSHM-KTHTGEKP--FTCTECGKNFAHKNSFQSHLQTHTGEKPFTCTECGKGYFSRIALLAHQKCHTHGPFICTKCGKSFRGKSSLFHHRHVHNIHKTFSCKECGKCFNQKRLLIGHQNTHTGERNVTCPECG-KTLSSRRSLNTHL------------------KIHTGV---------KPFTCTECGIGFAEKNNLVSHMKTHTGEKPFTCTECGKSFTLKDSLTRHLRIHTGEKPYSCTECGANFRYKSSLLDHLKIH-TGEAPFICTECGKIFQQKSSLITHFNMHTGEKPFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGK 819          

HSP 2 Score: 80.4925 bits (197), Expect = 1.021e-14
Identity = 107/439 (24.37%), Postives = 160/439 (36.45%), Query Frame = 2
Query: 1535 CNKTYDNRAK-YTITELNILIKTFFCVTCNKTVRKR-NEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCH---AQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNF------KKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            C KT  +    +T  +++   K F C  C K   ++   K H   H G +   C +CG     K  + SHMK H     Y C  CG+  A   N   H+ +H   K   C EC   F   + L  H+ K H   +P  + C  C K     C +  H++ H  E P  C  C +   +  +   H+  H  +                    F+C  C K F  ++    H K H    +F+C         E      +    A H  +H G     FC E    V    ++          + Y C  C   F  K  L+ H       KP   T       + +H + +       K  +C  C +        +SHMK+H +  + + C +C K F + NS   H Q H       C+ C + + S I L+AH K
Sbjct:  175 CGKTLSSSGSLHTHLKIHTGEKPFTCTECGKGFTQKCYLKSHIKVHTGEKPFTCTECGKGFTQKCYLKSHMKKHTGERPYTCSECGKSFAHSNNLVTHMKIHTGEKPFTCTECGKGFAQKISLLSHM-KMHTGEKP--FSCTECGKGFTQKCYLKSHIKVHTGEKPLTCTECGKQFEHKESLLGHLNLHTGVKP------------------FTCSECGKGFARRSSLVSHMKLHKVEKEFSC--------TECGKKFAQQGGLAYHLKIHTGEKL--FCTECGKGVRSKSHLASHMKKHTGERPYTCSECGKGFAQKNNLDTHMKIHTGEKPFTCTECGKCFTQKKHLESHMKIHTGEKPFTCTECGKDFAQKSSILSHMKTH-TGEKPFTCTECGKNFAHKNSFQSHLQTHTGEKPFTCTECGKGYFSRIALLAHQK 581          

HSP 3 Score: 64.6994 bits (156), Expect = 7.549e-10
Identity = 75/276 (27.17%), Postives = 111/276 (40.22%), Query Frame = 2
Query: 1607 CVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGL-VVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH----NILSSKGRDRTITPRHLISKSEC----FSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSK 2377
            C  C KT+  +R+   H   H G +   C +CG+    KN + SHMK+H     + C  CG+    K++  RH+ +H   K   C EC A+F+Y   L  H+ K H    P  + C  C KI     ++  H   H  E P  C  C +     S   AH + H       S++          +IS+       F C  C K    K   + H K H + T  PY      +S   L E    +H  +H G   +  C E     + ++ + K K
Sbjct:  646 CPECGKTLSSRRSLNTHLKIHTGVKPFTCTECGIGFAEKNNLVSHMKTHTGEKPFTCTECGKSFTLKDSLTRHLRIHTGEKPYSCTECGANFRYKSSLLDHL-KIHTGEAP--FICTECGKIFQQKSSLITHFNMHTGEKPFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGKSVDQETQIISQQNIRVKPFICTECGKHLTSKRSLSAHQKIHIRGT--PYTCTECGKSY--LIERSLLIHQRIHTGEKPF-TCTECGKGFTQSVGLQKHK 913          

HSP 4 Score: 62.7734 bits (151), Expect = 2.662e-9
Identity = 95/384 (24.74%), Postives = 141/384 (36.72%), Query Frame = 2
Query: 1679 KCKDCG-LVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQK-----LNF----KKVSCFACSRKI-RISHMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLK 2746
            +C  CG   V++  + +H KSH     + C+ CG+    K N   H  VH K K   C EC   F     L  H  K H         CP C K +    ++  HL+ H  E P  C  C +  +     K+HI+ H                  +  + F+C  C K F  K     H K H      PY      +S       ++  H  +H G   +  C E     +  I++          K + C  C   F  K  L  H       KP   T      K++ H++     LN     K  +C  C +   R S + SH+  H++   + C +C KKF     L  H ++H      C+ C +   S   L +H+K
Sbjct:   87 ECTKCGKGYVSRIALLTHQKSHTVGKPFTCKKCGKSFHRKANLLCHQRVHSKKKPFTCNECGKRFSQKSLLVNH-QKTHTGER--NVTCPECGKTLSSSGSLHTHLKIHTGEKPFTCTECGKGFTQKCYLKSHIKVH------------------TGEKPFTCTECGKGFTQKCYLKSHMKKHTGER--PYTCSECGKSFAHSNNLVT--HMKIHTGEKPF-TCTECGKGFAQKISLLSHMKMHTGEKPFSCTECGKGFTQKCYLKSHIKVHTGEKPLTCTEC---GKQFEHKESLLGHLNLHTGVKPFTCSECGKGFARRSSLVSHMKLHKVEKEFSCTECGKKFAQQGGLAYHLKIHTGEKLFCTECGKGVRSKSHLASHMK 441          

HSP 5 Score: 62.3882 bits (150), Expect = 3.742e-9
Identity = 96/413 (23.24%), Postives = 152/413 (36.80%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMK--SHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCA---ISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIY----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2740
            K F C  C K    +N  + H  TH G +   C +CG    ++  + +H K  +H  +IC  CG+    K +   H  VH   K   C EC   F       + +   H+    G+    CP C K + +   ++ HL+ H    P  C  C    +  +   +H++ H                  +  + F+C  C K+F  K   T+H + H         P +  E     R   S + H  +H G   +    C +I    S  I  +      K + C  C   F  K  L  H     K +    T    S+    +    Q +  K   C  C + +     K  LS+HQ        Y C +C K +    SL++H+++H       C+ C + FT  + L  H
Sbjct:  531 KPFTCTECGKNFAHKNSFQSHLQTHTGEKPFTCTECGKGYFSRIALLAHQKCHTHGPFICTKCGKSFRGKSSLFHHRHVHNIHKTFSCKECGKCFN-----QKRLLIGHQNTHTGERNVTCPECGKTLSSRRSLNTHLKIHTGVKPFTCTECGIGFAEKNNLVSHMKTH------------------TGEKPFTCTECGKSFTLKDSLTRHLRIHTGEK-----PYSCTECGANFRYKSSLLDHLKIHTGEAPFICTECGKIFQQKSSLITHFNMHTGEKPFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGKSVDQETQIISQQNIRVKPFICTECGKHLT---SKRSLSAHQKIHIRGTPYTCTECGKSYLIERSLLIHQRIHTGEKPFTCTECGKGFTQSVGLQKH 912          
BLAST of Zinc finger protein 112-like vs. Ensembl Xenopus
Match: ENSXETT00000036804.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:757182:796022:-1 gene:ENSXETG00000015770.1 transcript:ENSXETT00000036804.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 6.699e-15
Identity = 102/438 (23.29%), Postives = 177/438 (40.41%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNKN-KICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            C K +  R      + +  +K+F C  C K  + ++E   H  +H G +   C +CG    ++  +  H ++H     Y C  CG+  +   +  RH  +H   K   C +C   F    EL  H +     +E G Y C  C K       ++ H R+H  E P  C +C +   + S  +AH+R H                  +  + F+C  C+K F +++   +H K H     F+C  C    I++ +    LR H     +S  E     G C +  + ++ +  I+   K + C  C   F  +  L +H      +K           + ++ LI+  + +  +    K  SC  C ++       I H ++H +  + Y C  C K+F  P+ L +H++ H       CS C + F     L AHL++
Sbjct:  241 CGKGFKERTTLNHQKTHTGVKSFVCSVCEKHFKWQSELIVHQRSHTGEKPFSCSECGKRFTRHVHLIEHYRTHTGEKPYSCSDCGKRFSHGSDFNRHCRIHRLEKLCICSQCKKQFTSHSELIVHQSS---HMEEGPYSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRIH------------------TGEKPFTCSQCEKCFTHRSDLNRHLKSHKGEKTFSCSQCGKYFISTSDLTVHLRIHTGERPYSCSE----CGKCFKDPSYLTTHQRIHTGEKPFTCTECGKCFSGRVGLLEHQKTHTGVKSFVCSVCEKCFKYQSKLILHQRSHTGE----KPFSCSECGKRFTQHVHLIEHHRTH-TGEKPYSCSHCGKRFNCPSKLTVHQRSHTGERPYSCSECGKGFKDSWNLRAHLRI 648          

HSP 2 Score: 60.8474 bits (146), Expect = 8.998e-9
Identity = 101/424 (23.82%), Postives = 159/424 (37.50%), Query Frame = 2
Query: 1592 IKTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFC-KKIVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCD-----EIVTDVSDNINIYK-SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRC 2794
            +K F C  C K  + + +   H  +H G +   C +CG    ++  +  H ++H     Y C  CG+  +   +  RH  +H   K   C +C+  F    EL  H +     +  G Y C  C K+  C   ++ H R H  E P  C  C +     +    H + H  + S                  F C +C+K F +++    H + H         P +  E       H+  + H+  H G   Y   D        +D + +  I++  K   C  C+  F +  EL  H +   +  P                       SCF C ++  R S +  H  SH   + Y C KC K F + ++L  H ++H       CS C + FT    L  HLK  HK   +   SCS+C
Sbjct:   93 VKPFVCSVCEKRFLWETDYIVHKRSHTGEKLFSCSECGKRFRHRVPLIEHYRTHTGEKPYSCSDCGKSFSRSSDFNRHCRIHRLEKSCICSKCNKQFTSHSELIVHQSS---HVGEGPYSCSECGKRFNCPSKLTIHERIHTGERPYSCSECGKGFKERTTLN-HQKTHTGVKS------------------FVCSVCEKHFKWQSELIVHQRSHTGEK-----PFSCSECGKRFTRHVHLIEHYRTHTGEKPYSCSDCGKRFSHGSDFNRHCRIHRLEKLCICSQCKKQFTSHSELIVHQSSHMEEGP----------------------YSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRIHTGEKPFTCSQCEKCFTHRSDLNRHLKS-HKGEKTF--SCSQC 464          

HSP 3 Score: 60.4622 bits (145), Expect = 1.426e-8
Identity = 104/454 (22.91%), Postives = 171/454 (37.67%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKTVRKRNEK-RHALTHL--GNEKCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSS----------KGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHIS-------------------AVHFSLHEGHTKYGFCDEIVTDVSDNINI-------YKSKTYYCELCRIPFPNKFELNKH---HNRRHKLKPRK-------KTSLIIFMKKYRHQKLNF--KKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            ++ L K   C  C K     +E   H  +H+  G   C +CG     ++++  H +SH     Y C  CG+    +     H+ +H   K   C +C+  F +  +L RH+ K+H+  +   + C  C K   + S    HLR H  E P  C  C +   + S    H R H                GR   +  +   +  + F C +C+K F Y++    H + H     F+C  C       +  I   R H                      VH   H G   Y  C E      D+ N+          K + C  C   F ++  L +H   H R       +       ++ L   +K ++ +K     +   CF+C+  + + H++SH S  + Y C +C K F   ++L +H++ H       C  C + FT+   L  H K
Sbjct:  340 IHRLEKLCICSQCKKQFTSHSELIVHQSSHMEEGPYSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRIHTGEKPFTCSQCEKCFTHRSDLNRHL-KSHKGEK--TFSCSQCGKYFISTSDLTVHLRIHTGERPYSCSECGKCFKDPSYLTTHQRIHTGEKPFTCTECGKCFSGRVGLLEHQKTHTGVKSFVCSVCEKCFKYQSKLILHQRSHTGEKPFSCSECGKRFTQHVHLIEHHRTHTGEKPYSCSHCGKRFNCPSKLTVHQRSHTGERPYS-CSECGKGFKDSWNLRAHLRIHTGEKPFTCSQCEKCFTHRSALKRHLALHKREKTFSCSRCGKCFTHRSDLNRHLKSHKGEKTFSCSQCGKCFSCTSALNV-HLRSH-SGERPYSCSECGKCFKYYSNLTVHQRTHTGEKPFSCPECGKCFTNGASLTYHKK 787          

HSP 4 Score: 55.0694 bits (131), Expect = 6.260e-7
Identity = 69/241 (28.63%), Postives = 97/241 (40.25%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKR-NEKRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI-----LSSKGR------DRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSL 2245
            K F C  C K   +  +   H  TH G +   C  CG   N  +K+  H +SH     Y C  CG+      N   H+ +H   K   C +C+  F +   L RH+    R+       C  C      ++ HL++H+ E    C +C +  S  SA   H+R H+       S  G+      + T+  R    +   FSC  C K F   A  T H KCH     FTC  C  C  NS+
Sbjct:  569 KPFSCSECGKRFTQHVHLIEHHRTHTGEKPYSCSHCGKRFNCPSKLTVHQRSHTGERPYSCSECGKGFKDSWNLRAHLRIHTGEKPFTCSQCEKCFTHRSALKRHLALHKREKTFSCSRCGKCFTHRSDLNRHLKSHKGEKTFSCSQCGKCFSCTSALNVHLRSHSGERPYSCSECGKCFKYYSNLTVHQRTHTGEKP-FSCPECGKCFTNGASLTYHKKCHTGEKPFTCTECGKCFRNSM 808          
BLAST of Zinc finger protein 112-like vs. Ensembl Xenopus
Match: stk31 (serine/threonine kinase 31 [Source:Xenbase;Acc:XB-GENE-983236])

HSP 1 Score: 80.8777 bits (198), Expect = 6.845e-15
Identity = 107/436 (24.54%), Postives = 171/436 (39.22%), Query Frame = 2
Query: 1535 CNKTYDNRAKY-TITELNILIKTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN----------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHL 2743
            C K++  R    T  +++   K F C+ C K   RK++ + H   H G +   C +CG    +KN + SHMK+H     + C  CG+    K     H+ +H   +   C EC A+F+Y   L  H+ K H    P  + C  C KI     ++  H + H  E    C  C +     S   AH + H             S    ++ I+ ++++ K   F C  C K    K   + H K H + T  PY      +S   LRE    +H  +H G                       K + C  C   F  K    +H N+    KP       K+ + + ++  +    +  K   C  C +   ++  ++SH   H   + + C +C K F + NSLV H  +H       C+ C + F     L++HL
Sbjct:  404 CGKSFAQRINLVTHMKIHTGEKPFTCIECGKDFARKKHLESHMKIHTGEKPFTCTECGKGFAHKNNLVSHMKTHTGEKPFTCTECGKSFTHKHGFTIHLRIHTGERPYSCTECGANFRYKSSLLDHL-KIHTGEAP--FICTECGKIFQQKSSLITHFKMHTGEKQFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGKSIDQENQIISQQNILVKP--FICTECGKHLTSKKTLSAHQKIHIRGT--PYTCTECGKSY--LRERSLLIHQRIHTG----------------------EKPFTCTECGEGFHEKATFLRHQNKHTGEKPFSCTECGKRFAFLRYLTVHLRVHIGEKPFECKECGKGFTQLKFLRSHSRIHTGEKPFTCTECGKGFAHKNSLVSHLYIHTGEKPFTCTECGKGFAHKNNLVSHL 808          

HSP 2 Score: 72.0182 bits (175), Expect = 3.864e-12
Identity = 101/414 (24.40%), Postives = 156/414 (37.68%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKTVRKRNEKRHAL---THLGNEKCKDCGL-VVNKNKICSHMKSHF--KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIYK----SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKLNFKKVSCFAC-----SRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2740
            L+  +K F C  C K   KR+     +   T   N  C +CG     K+ + +H+K H   K IC  CG+    K     H+ +H   K   C EC  SF   + L  H+ K H   +P  + C  C K      H   H++ H  E P  C  C +  ++ +   +H++ H                  +  + F+C  C K+F +K  FT H + H         P +  E     R   S + H  +H G   +    C +I    S  I  +K     K + C  C   F  K  L  H     K +    T    S+    +    Q +  K   C  C     S+K   +H K H+     Y C +C K +    SL++H+++H       C+ C + F      + H
Sbjct:  309 LHTGVKPFTCSECGKGFAKRSSLVSHMKLHTEGKNFSCAECGKKFARKDCLVNHLKIHTGEKNICTECGKGICSKSQLASHMKIHTGEKPFTCSECGKSFAQRINLVTHM-KIHTGEKP--FTCIECGKDFARKKHLESHMKIHTGEKPFTCTECGKGFAHKNNLVSHMKTH------------------TGEKPFTCTECGKSFTHKHGFTIHLRIHTGER-----PYSCTECGANFRYKSSLLDHLKIHTGEAPFICTECGKIFQQKSSLITHFKMHTGEKQFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGKSIDQENQIISQQNILVKPFICTECGKHLTSKKTLSAHQKIHIRG-TPYTCTECGKSYLRERSLLIHQRIHTGEKPFTCTECGEGFHEKATFLRH 695          

HSP 3 Score: 68.5514 bits (166), Expect = 4.993e-11
Identity = 99/422 (23.46%), Postives = 154/422 (36.49%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKR-NEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-------KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSR 2791
            K F C  C K   ++   K H   H G +   C +CG    +KN + SHMK H     + C  CG+  A KE+   H+++H   K   C EC   F     L  H+ K H   E   + C  C K       + +HL+ H      C  C + + + S   +H++ H                  +  + F+C  C K+F  +     H K H      P+  I   +   A ++H+ + H  +H G   +  C E     +   N+          K + C  C   F +K     H       +P                       SC  C    R     + H+K H +    + C +C K F   +SL+ H ++H    Q  C+ C + F     L+AH K   K   + S  C +
Sbjct:  230 KPFTCTECGKGFTQKCYLKYHMKIHTGEKPFTCTECGKGYAHKNSLVSHMKIHTGEKPFTCTECGKQFARKESLLGHLNLHTGVKPFTCSECGKGFAKRSSLVSHM-KLH--TEGKNFSCAECGKKFARKDCLVNHLKIHTGEKNICTECGKGICSKSQLASHMKIH------------------TGEKPFTCSECGKSFAQRINLVTHMKIHTGEK--PFTCIECGKDF-ARKKHLES-HMKIHTGEKPF-TCTECGKGFAHKNNLVSHMKTHTGEKPFTCTECGKSFTHKHGFTIHLRIHTGERP----------------------YSCTECGANFRYKSSLLDHLKIH-TGEAPFICTECGKIFQQKSSLITHFKMHTGEKQFTCTECGESFYKKSLLVAHQKSHTKQEGAPSTECGK 602          

HSP 4 Score: 60.4622 bits (145), Expect = 1.507e-8
Identity = 99/388 (25.52%), Postives = 140/388 (36.08%), Query Frame = 2
Query: 1679 KCKDCG-LVVNKNKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCC----PYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            +C  CG   V++  + +H KSH     + C  CG+    K N   H  VH K K   C EC   F     L +H  K+H         CP C K +    ++  HL+ H  E P  C  C +  +  +   +H+  H                  +  + F+C  C K F  K     H K H     FTC      Y   NSL S           H  +H G                       K + C  C   F  K  L  H N    +KP           K++SL+  MK +   K NF   SC  C +K       ++H+K H     I  C +C K   + + L  H ++H       CS C + F   I L+ H+K+
Sbjct:   93 ECTKCGKGYVSRIALLTHQKSHTVGKPFTCTKCGKSFHRKANLLCHQRVHSKKKPFICNECGKRFSQKSFLVKH-QKSHTGER--NVTCPECGKTLSSSGSLHTHLKIHTGEKPFTCTECGKGFTQKNNLVSHMYIH------------------TGEKPFTCTECGKGFTQKCYLKYHMKIHTGEKPFTCTECGKGYAHKNSLVS-----------HMKIHTG----------------------EKPFTCTECGKQFARKESLLGHLNLHTGVKPFTCSECGKGFAKRSSLVSHMKLHTEGK-NF---SCAECGKKFARKDCLVNHLKIHTGEKNI--CTECGKGICSKSQLASHMKIHTGEKPFTCSECGKSFAQRINLVTHMKI 420          

HSP 5 Score: 53.5286 bits (127), Expect = 1.980e-6
Identity = 64/256 (25.00%), Postives = 102/256 (39.84%), Query Frame = 2
Query: 1526 SHSCNKTYDNRAKYTITELNILIKTFFCVTCNK-TVRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHN-------ILSSKG---RDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC 2218
            S  C K+ D   +  I++ NIL+K F C  C K    K+    H   H+      C +CG   + +  +  H + H     + C  CG     K    RH + H   K   C EC   F +L  L  H+ + H   +P  +EC  C K    +   LR+H      E P  C  C +  ++ ++  +H+  H            KG   ++  ++  ++ +  + F+C  C K F  +     H K H     FTC
Sbjct:  597 STECGKSIDQENQI-ISQQNILVKPFICTECGKHLTSKKTLSAHQKIHIRGTPYTCTECGKSYLRERSLLIHQRIHTGEKPFTCTECGEGFHEKATFLRHQNKHTGEKPFSCTECGKRFAFLRYLTVHL-RVHIGEKP--FECKECGKGFTQLKF-LRSHSRIHTGEKPFTCTECGKGFAHKNSLVSHLYIHTGEKPFTCTECGKGFAHKNNLVSHLYIHTGEKPFTCTECGKGFAQRNNLVSHMKIHTGEKPFTC 847          
BLAST of Zinc finger protein 112-like vs. Ensembl Mouse
Match: Zfp26 (zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:99173])

HSP 1 Score: 83.9593 bits (206), Expect = 6.191e-16
Identity = 115/450 (25.56%), Postives = 177/450 (39.33%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTI-TELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSS---KGRDRTITPRHLISK-------SECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDEIVTDVSDNI----NIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSC---FACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR-CSICYQFFTSHIRLMAHLK 2746
            C K +  R+  TI    +   + + C  C K      +   H  TH G +  +CK C     +N  C  +K+HF+       Y C  CG+    +    +H+ +H   K   C EC  +F     L  HI + H   +P  +EC  C K +    ++  HLRTH  E P +C +C++  +  S  + H+R H        K   +T   R  ++K          + C+ C K F   A  T H K H+        P        + R   S   HF +H G   Y   +C +  T  S       N    K+Y C+ C   F     L  H       KP             + L + +K +  +K  F+   C   F CS  + + HM++H +  + +QCI C K F   + L +H ++H       C  C + FT H  L  HL+
Sbjct:  489 CGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCARTF-RNSSC--LKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHI-RIHTGEKP--FECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSER-----PFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLKIHTGEK-PFQCTVCGKTFTCSSYLPV-HMRTH-TGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLR 924          

HSP 2 Score: 74.7146 bits (182), Expect = 4.968e-13
Identity = 93/386 (24.09%), Postives = 153/386 (39.64%), Query Frame = 2
Query: 1652 HALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEK-SSQRCSICYQFFTSHIRLMAHLK 2746
            H  TH G +  +C  CG    ++  +  H+++H     Y C+VCG+  + +     H+  H   +  PC EC+ +F    +L  HI K H   +P  + C  C +       +  H R H    P +C  C +  +  S    H+  HN                    + + C+ C K F+  +   +H + H     F C  C     +S   +  LR H     F  ++       CD+  T  S  + I+       K Y C+ C   FP +  L KH       +P +        K+     ++F +++           H+K+H SS + +QC  C K F N +SL  H ++H      +CS C + FT+   L  HL+
Sbjct:  446 HLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHI-KTHTGEKP--FRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHN------------------GEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQ-------CDKTFTR-SSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYE-------CKECGKGFISFAQLTV----------HIKTH-SSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLR 784          

HSP 3 Score: 65.4698 bits (158), Expect = 2.931e-10
Identity = 93/380 (24.47%), Postives = 151/380 (39.74%), Query Frame = 2
Query: 1727 HMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN--------ILSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            HM+SH     Y C+ CG+    + +   H+  H + K   C EC  +F     L  H+ ++H   +P  Y+C  C     + S+   HLRTH  E P +C  C +  +  S    HIR H         +       R+    HL   +    + C  C+K F   A  T+H K H       C  C   +  +   L+      HF +H G   Y   +C +  T    ++ ++ I+   K Y C+ C   F     L +H       KP +           +SL+  ++ +  +    K   C  C +   R S+++ H+ +H   + Y+C +C K F   + L  H + H       C  C + F S  +L  H+K
Sbjct:  362 HMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECKECGKTFIQPSRLTEHM-RSHTGEKP--YQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVC-ARTFRNSSCLK-----THFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGE----KPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIK 728          

HSP 4 Score: 61.6178 bits (148), Expect = 4.987e-9
Identity = 84/320 (26.25%), Postives = 114/320 (35.62%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEKR-HALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ------------FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP 2464
            K F C  C+KT  + +  R H  TH G +  +CK+CG    +   +  H+++H     Y C+ CG+          HI  H   +   C  C  SF+    L  H  + H  ++P  Y+C +C K   A   ++ HLR H  E    C+ C +  S  S   AHIR H     KG                F C  C K F   +    H K H              FTC  Y P                VH   H G   +        F       V   I+  + K Y C+ C   F     LNKH  +    KP
Sbjct:  650 KPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHF-RIHTGVKP--YKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSH-----KGEKP-------------FECDHCGKAFASSSYLNVHLKIHTGEKPFQCTVCGKTFTCSSYLP----------------VHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHTGE-KPYVCQYCGKAFTEHSGLNKHLRKHTGEKP 931          
BLAST of Zinc finger protein 112-like vs. Ensembl Mouse
Match: Zfp28 (zinc finger protein 28 [Source:MGI Symbol;Acc:MGI:99175])

HSP 1 Score: 82.4185 bits (202), Expect = 1.608e-15
Identity = 89/357 (24.93%), Postives = 142/357 (39.78%), Query Frame = 2
Query: 1748 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDE---IVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            Y C  CG+  +   +  RH   H   K   CPEC  +F     L RH    H   +P  ++C  C K       ++ H R H  E P  CE C++     S+   H R H                  +  + + C+IC+K F++ A  TQH + H+        P    E   A R++I  A H+ +H G   +  G C +   I + ++ +  I+   K Y C++CR  F  K  L +H       KP       K  S    + +++      K   C  C +          H + H +  + Y+C++C K F   +SL+ H + H       CS C + F+    L  H ++
Sbjct:  405 YKCNQCGKAFSDGSSFARHQRCHTGKKPYECPECGKAFIQNTSLVRHWRYYHTGEKP--FDCIDCGKAFSDHIGLNQHRRIHTGEKPYTCEVCHKSFRYGSSLTVHQRIH------------------TGEKPYECEICRKAFSHHASLTQHQRVHSGEK-----PFKCKECGKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEKPYECKVCRKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYKCLECGKAFGDNSSCTQHRRLH-TGQRPYECVECGKTFKTKSSLICHRRCHTGEKPYECSACGKAFSHRQSLSVHQRI 735          

HSP 2 Score: 55.0694 bits (131), Expect = 5.199e-7
Identity = 101/422 (23.93%), Postives = 159/422 (37.68%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTITE-LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFKYI--------CEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNIL-----SSKGRDRTI-----TPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVH 2671
            C KT+   +  T+ + ++   K + C  C K     +   RH   H G +  +C +CG    +N   + +  H++Y         C  CG+  +      +H  +H   K   C  C  SF+Y   L       H++I  G+  YEC  C+K      +++ H R H  E P +C+ C +         +H R H           G+  +I     T + + +  + + C++C+K F  KA   QH K H         P    E   A  +    + H  +H G   Y  C E      DN +  +        + Y C  C   F                  + K+SLI     +R      K   C AC +    SH +S LS HQ        Y+C +C+K F     L  H++VH
Sbjct:  382 CKKTFTQSSSLTVHQRIHTGEKPYKCNQCGKAFSDGSSFARHQRCHTGKKPYECPECGKAFIQN---TSLVRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRIHTGEKPYTCEVCHKSFRYGSSLT-----VHQRIHTGEKPYECEICRKAFSHHASLTQHQRVHSGEKPFKCKECGKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEKPYECKVCRKAFTQKAHLAQHQKTHTGEK-----PYECKECGKAFSQTTHLIQHQRVHTGEKPYK-CLECGKAFGDNSSCTQHRRLHTGQRPYECVECGKTF------------------KTKSSLIC----HRRCHTGEKPYECSACGKAF--SHRQS-LSVHQRIHSGKKPYECKECRKTFIQIGHLNQHKRVH 764          
BLAST of Zinc finger protein 112-like vs. Ensembl Mouse
Match: Zfp708 (zinc finger protein 708 [Source:MGI Symbol;Acc:MGI:3040674])

HSP 1 Score: 77.0258 bits (188), Expect = 5.871e-14
Identity = 108/442 (24.43%), Postives = 175/442 (39.59%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNKNKICS-HMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSK-----GRDRT-----ITPRHLISKSECFSCQICQKTFNYKAMFTQH---------YKCHA---QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQI-------YQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            +++  K   C  C K+  + +   +H   H G    KC++CG+      I S H + H     Y C+ CG+  +   N  +H  +H + K   C +C  +F     L +H  + H  ++P  Y+C  C K       + +H R H  E P +C  C +  + YS +  H R H+          G+  T     I  + + +  + ++C+ C K+FNY +   QH         YKC      F C  Y                   H  +H G   Y  C+      S +  ++K        K Y CE C   F N   L  H       KP K      +  +     +HQ+++ ++   + C    +   + S  S HQI       Y+C  C K F  P+ LV HE++H  +   +C +C + FTS   L  H ++
Sbjct:   74 IHLGSKAHKCKECGKSFDRNSVLIQHQRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKH-QRIHTGMKP--YKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYL----------------VKHQRIHTGEKPYK-CEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQP-YKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGERPYKCEVCGKAFTSSSNLKYHWRL 494          

HSP 2 Score: 50.8322 bits (120), Expect = 6.658e-6
Identity = 80/346 (23.12%), Postives = 130/346 (37.57%), Query Frame = 2
Query: 1775 DAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            D +    +  +++H  +K + C EC  SF     L +H  + H    P K  EC       C +S H R H  E P +C+ C +  S  S    H + H         R   P         + C  C K F+  +   +H + H         P    E   A     + + H  +H G   Y  G C +  T  S  +N  ++    K Y C+ C   F N + L +H       KP       K  +    +K+++      K   C  C +        + H + H +  + Y+C  C K F     L  H+++H    + RC  C + FT++  L+ H ++
Sbjct:   62 DLWSVKRKASVAIHLGSKAHKCKECGKSFDRNSVLIQH-QRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIH---------REEKP---------YKCDDCGKAFSCSSYLYKHQRIHTGMK-----PYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIH-TGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRV 382          
BLAST of Zinc finger protein 112-like vs. Ensembl Mouse
Match: Zfp708 (zinc finger protein 708 [Source:MGI Symbol;Acc:MGI:3040674])

HSP 1 Score: 76.6406 bits (187), Expect = 6.195e-14
Identity = 108/442 (24.43%), Postives = 175/442 (39.59%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNKNKICS-HMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSK-----GRDRT-----ITPRHLISKSECFSCQICQKTFNYKAMFTQH---------YKCHA---QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQI-------YQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            +++  K   C  C K+  + +   +H   H G    KC++CG+      I S H + H     Y C+ CG+  +   N  +H  +H + K   C +C  +F     L +H  + H  ++P  Y+C  C K       + +H R H  E P +C  C +  + YS +  H R H+          G+  T     I  + + +  + ++C+ C K+FNY +   QH         YKC      F C  Y                   H  +H G   Y  C+      S +  ++K        K Y CE C   F N   L  H       KP K      +  +     +HQ+++ ++   + C    +   + S  S HQI       Y+C  C K F  P+ LV HE++H  +   +C +C + FTS   L  H ++
Sbjct:   41 IHLGSKAHKCKECGKSFDRNSVLIQHQRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKH-QRIHTGMKP--YKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYL----------------VKHQRIHTGEKPYK-CEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQP-YKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGERPYKCEVCGKAFTSSSNLKYHWRL 461          

HSP 2 Score: 63.1586 bits (152), Expect = 1.005e-9
Identity = 71/273 (26.01%), Postives = 113/273 (41.39%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKK---IVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPY-CPI--NSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINI 2365
            K + C  C K+    +  K+H   H G +  KC+ CG   N  + +  H + H     Y CEVCG+  +F     +H  +H   KR  C EC  +F     L       HR++  G+  Y+C  C K   +  ++S H R H  E P +C+ C +  S +S +  H   H                  ++ + + C+ C KTF Y +   QH + H      PY C +   +  S   L+      H+ LH G   Y  C++      ++ N+
Sbjct:  242 KPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLI-----VHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQPYKCDECGKTFSVHSTFSKHQIMH------------------TREKPYKCKHCDKTFKYPSPLVQHERIHTGER--PYKCEVCGKAFTSSSNLK-----YHWRLHTGEKPYK-CEQCGKAFKNSSNV 483          

HSP 3 Score: 50.8322 bits (120), Expect = 7.216e-6
Identity = 80/346 (23.12%), Postives = 130/346 (37.57%), Query Frame = 2
Query: 1775 DAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            D +    +  +++H  +K + C EC  SF     L +H  + H    P K  EC       C +S H R H  E P +C+ C +  S  S    H + H         R   P         + C  C K F+  +   +H + H         P    E   A     + + H  +H G   Y  G C +  T  S  +N  ++    K Y C+ C   F N + L +H       KP       K  +    +K+++      K   C  C +        + H + H +  + Y+C  C K F     L  H+++H    + RC  C + FT++  L+ H ++
Sbjct:   29 DLWSVKRKASVAIHLGSKAHKCKECGKSFDRNSVLIQH-QRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIH---------REEKP---------YKCDDCGKAFSCSSYLYKHQRIHTGMK-----PYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIH-TGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRV 349          
BLAST of Zinc finger protein 112-like vs. Ensembl Mouse
Match: Zfp708 (zinc finger protein 708 [Source:MGI Symbol;Acc:MGI:3040674])

HSP 1 Score: 76.6406 bits (187), Expect = 7.344e-14
Identity = 108/442 (24.43%), Postives = 174/442 (39.37%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNKNKICS-HMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSK-----GRDRT-----ITPRHLISKSECFSCQICQKTFNYKAMFTQH---------YKCHA---QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQI-------YQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            +++  K   C  C K+  + +   +H   H G    KC++CG+      I S H + H     Y C+ CG+  +   N  +H  +H + K   C +C  +F     L +H  + H  ++P  Y+C  C K       + +H R H  E P +C  C +  + YS +  H R H+          G+  T     I  + + +  + ++C+ C K+FNY +   QH         YKC      F C  Y                   H  +H G   Y  C+      S +  ++K        K Y CE C   F N   L  H       KP K      +  +     +HQ+++ ++   + C    +   + S  S HQI       Y+C  C K F  P+ LV HE++H      +C +C + FTS   L  H ++
Sbjct:   86 IHLGSKAHKCKECGKSFDRNSVLIQHQRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKH-QRIHTGMKP--YKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYL----------------VKHQRIHTGEKPYK-CEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQP-YKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGERPYKCEVCGKAFTSSSNLKYHWRL 506          

HSP 2 Score: 50.8322 bits (120), Expect = 7.873e-6
Identity = 80/346 (23.12%), Postives = 130/346 (37.57%), Query Frame = 2
Query: 1775 DAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            D +    +  +++H  +K + C EC  SF     L +H  + H    P K  EC       C +S H R H  E P +C+ C +  S  S    H + H         R   P         + C  C K F+  +   +H + H         P    E   A     + + H  +H G   Y  G C +  T  S  +N  ++    K Y C+ C   F N + L +H       KP       K  +    +K+++      K   C  C +        + H + H +  + Y+C  C K F     L  H+++H    + RC  C + FT++  L+ H ++
Sbjct:   74 DLWSVKRKASVAIHLGSKAHKCKECGKSFDRNSVLIQH-QRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIH---------REEKP---------YKCDDCGKAFSCSSYLYKHQRIHTGMK-----PYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIH-TGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRV 394          
BLAST of Zinc finger protein 112-like vs. UniProt/SwissProt
Match: sp|P10076|ZFP26_MOUSE (Zinc finger protein 26 OS=Mus musculus OX=10090 GN=Zfp26 PE=2 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 2.401e-15
Identity = 115/450 (25.56%), Postives = 177/450 (39.33%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTI-TELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN---ILSSKGRDRTITPRHLISK-------SECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDEIVTDVSDNI----NIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSC---FACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR-CSICYQFFTSHIRLMAHLK 2746
            C K +  R+  TI    +   + + C  C K      +   H  TH G +  +CK C     +N  C  +K+HF+       Y C  CG+    +    +H+ +H   K   C EC  +F     L  HI + H   +P  +EC  C K +    ++  HLRTH  E P +C +C++  +  S  + H+R H        K   +T   R  ++K          + C+ C K F   A  T H K H+        P        + R   S   HF +H G   Y   +C +  T  S       N    K+Y C+ C   F     L  H       KP             + L + +K +  +K  F+   C   F CS  + + HM++H +  + +QCI C K F   + L +H ++H       C  C + FT H  L  HL+
Sbjct:  391 CGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCARTF-RNSSC--LKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHI-RIHTGEKP--FECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSER-----PFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLKIHTGEK-PFQCTVCGKTFTCSSYLPV-HMRTH-TGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLR 826          

HSP 2 Score: 75.0998 bits (183), Expect = 2.502e-12
Identity = 93/386 (24.09%), Postives = 153/386 (39.64%), Query Frame = 2
Query: 1652 HALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEK-SSQRCSICYQFFTSHIRLMAHLK 2746
            H  TH G +  +C  CG    ++  +  H+++H     Y C+VCG+  + +     H+  H   +  PC EC+ +F    +L  HI K H   +P  + C  C +       +  H R H    P +C  C +  +  S    H+  HN                    + + C+ C K F+  +   +H + H     F C  C     +S   +  LR H     F  ++       CD+  T  S  + I+       K Y C+ C   FP +  L KH       +P +        K+     ++F +++           H+K+H SS + +QC  C K F N +SL  H ++H      +CS C + FT+   L  HL+
Sbjct:  348 HLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHI-KTHTGEKP--FRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHN------------------GEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQ-------CDKTFTR-SSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYE-------CKECGKGFISFAQLTV----------HIKTH-SSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLR 686          

HSP 3 Score: 65.855 bits (159), Expect = 1.668e-9
Identity = 93/380 (24.47%), Postives = 151/380 (39.74%), Query Frame = 2
Query: 1727 HMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN--------ILSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            HM+SH     Y C+ CG+    + +   H+  H + K   C EC  +F     L  H+ ++H   +P  Y+C  C     + S+   HLRTH  E P +C  C +  +  S    HIR H         +       R+    HL   +    + C  C+K F   A  T+H K H       C  C   +  +   L+      HF +H G   Y   +C +  T    ++ ++ I+   K Y C+ C   F     L +H       KP +           +SL+  ++ +  +    K   C  C +   R S+++ H+ +H   + Y+C +C K F   + L  H + H       C  C + F S  +L  H+K
Sbjct:  264 HMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECKECGKTFIQPSRLTEHM-RSHTGEKP--YQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVC-ARTFRNSSCLK-----THFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGE----KPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIK 630          

HSP 4 Score: 61.6178 bits (148), Expect = 3.104e-8
Identity = 84/320 (26.25%), Postives = 113/320 (35.31%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEKR-HALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ------------FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP 2464
            K F C  C+KT  + +  R H  TH G +  +CK+CG    +   +  H+++H     Y C+ CG+          HI  H   +   C  C  SF+    L  H  + H  ++P  Y+C +C K   A   ++ HLR H  E    C+ C +  S  S   AHIR H     KG                F C  C K F   +    H K H              FTC  Y P                VH   H G   +        F       V   I+    K Y C+ C   F     LNKH  +    KP
Sbjct:  552 KPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHF-RIHTGVKP--YKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSH-----KGEKP-------------FECDHCGKAFASSSYLNVHLKIHTGEKPFQCTVCGKTFTCSSYLP----------------VHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHT-GEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKP 833          
BLAST of Zinc finger protein 112-like vs. UniProt/SwissProt
Match: sp|Q86UE3|ZN546_HUMAN (Zinc finger protein 546 OS=Homo sapiens OX=9606 GN=ZNF546 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 8.561e-15
Identity = 114/440 (25.91%), Postives = 177/440 (40.23%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNE--KCKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK-IVCA--ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYK---CHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKT----SLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKS-SQRCSICYQFFTSHIRLMAHLKM 2749
             C K +  R  Y +TE   ++   + + C  C KT R +R+  +H   H G +  KC +CG   +    +  H K H     Y C+ CG+  +F     RH  +H   K   C EC  +F+   EL RH  + H   +P  YEC  C K  +C   ++ HLRTH  E P +C+ C +  S+      H R H                  +  + + C  C K F  +   T+H++   C   + C  C    I+S + I   R H S   +   E       C +I +   +++ +  I+   K Y C  C   F  + EL +HH      KP K T    + I      +H ++    K   C  C +   R  H+  H   H   + Y C +C   F     L LH+++H       C  C + F+    L  H ++
Sbjct:  333 ECGKAF--RLHYQLTEHQRIHTGERPYECKVCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRH-HRTHTGEKP--YECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIH------------------TGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKE-------CGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRL 742          

HSP 2 Score: 69.707 bits (169), Expect = 1.100e-10
Identity = 72/249 (28.92%), Postives = 112/249 (44.98%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE---LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGR----DRTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHA 2206
             C KT+ +R  Y +T+   ++   K + C  C K  R + E  RH   H   +  +CK+CG   ++ N+  SH + H     YIC+ CG+I + + N  +H  +H   K   C EC  +F++  EL +H  + H   +P  Y+C  C K     +H   H R H  E P +C  C +  S +     H R H      I +  G        +T    I   E  + C+ C KTF+ +   TQH++ H 
Sbjct:  501 ECGKTFSSR--YHLTQHYRIHTGEKPYICNECGKAFRLQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKIHTGEKPYICNECGKAFRFQTELTQH-HRIHTGEKP--YKCTECGKAFIRSTHLTQHHRIHTGEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELPYECKECGKTFSRRYHLTQHFRLHT 744          

HSP 3 Score: 54.6842 bits (130), Expect = 4.152e-6
Identity = 96/419 (22.91%), Postives = 161/419 (38.42%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEK-RHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKY---RHQKL--NFKKVSCFACSRKIRISHMKSHLSSH-------QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            K++ C  C K  R+++   +H   H G    KC +CG    +   +  H   H     Y C+ CG+      +   H  +H   K   C EC  +F  + +L     + H+ I  G+  YEC  C K       ++ H R H  E P +C+ C +        + HI  H  + +      + P         + C  C K F++ +   QH K H         P    E   +   H   A H  +H G   Y     G    + T+++ +   +   K Y C+ C   F   ++L  H        P + K     F  +Y   +H ++    K   C  C +  R   ++  L+ H       + Y+C +C K F + N  + H+++H  +S+  C  C + F+    L  H K+
Sbjct:  215 KSYECKECRKAFRQQSYLIQHLRIHTGERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKPYECKECGKAFSRVRDL-----RVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECKVCGKTFR----VQRHISQHQKIHT-----GVKP---------YKCNECGKAFSHGSYLVQHQKIHTGEK-----PYECKECGKSFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFICGYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFR---LQGELTRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHFKI 602          
BLAST of Zinc finger protein 112-like vs. UniProt/SwissProt
Match: sp|P10078|ZFP28_MOUSE (Zinc finger protein 28 OS=Mus musculus OX=10090 GN=Zfp28 PE=2 SV=3)

HSP 1 Score: 82.4185 bits (202), Expect = 1.125e-14
Identity = 89/357 (24.93%), Postives = 142/357 (39.78%), Query Frame = 2
Query: 1748 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDE---IVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            Y C  CG+  +   +  RH   H   K   CPEC  +F     L RH    H   +P  ++C  C K       ++ H R H  E P  CE C++     S+   H R H                  +  + + C+IC+K F++ A  TQH + H+        P    E   A R++I  A H+ +H G   +  G C +   I + ++ +  I+   K Y C++CR  F  K  L +H       KP       K  S    + +++      K   C  C +          H + H +  + Y+C++C K F   +SL+ H + H       CS C + F+    L  H ++
Sbjct:  405 YKCNQCGKAFSDGSSFARHQRCHTGKKPYECPECGKAFIQNTSLVRHWRYYHTGEKP--FDCIDCGKAFSDHIGLNQHRRIHTGEKPYTCEVCHKSFRYGSSLTVHQRIH------------------TGEKPYECEICRKAFSHHASLTQHQRVHSGEK-----PFKCKECGKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEKPYECKVCRKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYKCLECGKAFGDNSSCTQHRRLH-TGQRPYECVECGKTFKTKSSLICHRRCHTGEKPYECSACGKAFSHRQSLSVHQRI 735          

HSP 2 Score: 55.0694 bits (131), Expect = 3.637e-6
Identity = 101/422 (23.93%), Postives = 159/422 (37.68%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTITE-LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFKYI--------CEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNIL-----SSKGRDRTI-----TPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVH 2671
            C KT+   +  T+ + ++   K + C  C K     +   RH   H G +  +C +CG    +N   + +  H++Y         C  CG+  +      +H  +H   K   C  C  SF+Y   L       H++I  G+  YEC  C+K      +++ H R H  E P +C+ C +         +H R H           G+  +I     T + + +  + + C++C+K F  KA   QH K H         P    E   A  +    + H  +H G   Y  C E      DN +  +        + Y C  C   F                  + K+SLI     +R      K   C AC +    SH +S LS HQ        Y+C +C+K F     L  H++VH
Sbjct:  382 CKKTFTQSSSLTVHQRIHTGEKPYKCNQCGKAFSDGSSFARHQRCHTGKKPYECPECGKAFIQN---TSLVRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQHRRIHTGEKPYTCEVCHKSFRYGSSLT-----VHQRIHTGEKPYECEICRKAFSHHASLTQHQRVHSGEKPFKCKECGKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEKPYECKVCRKAFTQKAHLAQHQKTHTGEK-----PYECKECGKAFSQTTHLIQHQRVHTGEKPYK-CLECGKAFGDNSSCTQHRRLHTGQRPYECVECGKTF------------------KTKSSLIC----HRRCHTGEKPYECSACGKAF--SHRQS-LSVHQRIHSGKKPYECKECRKTFIQIGHLNQHKRVH 764          
BLAST of Zinc finger protein 112-like vs. UniProt/SwissProt
Match: sp|Q9N003|ZN425_MACFA (Zinc finger protein 425 (Fragment) OS=Macaca fascicularis OX=9541 GN=ZNF425 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 3.100e-14
Identity = 110/415 (26.51%), Postives = 164/415 (39.52%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVR-KRNEKRHALTHLGNEK--CKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINI-------YKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHL 2743
            K F C  C++  R KR  K H   H G     C +CG   + K  + +H ++H +   + C+ CGR   +K   + HI VH   K   CPEC+ SF+    L     KAH     GK  ++CP C +      A+  H R H E+ P  C  C +  +  S    H R H+                  + + F C  C+KTF+ ++  TQH K H   T  P+       S    R H++  H  LH G   +  C E     S   ++          K + C  C   + ++ +L +H       KP      +K   L   +K +  Q    K  SC  C +          H++ H S  + +QC +C K +    SL +H   H      +C  C + F     L AHL
Sbjct:  317 KPFQCPQCDRCFRLKRGMKVHLSQHSGKRPFHCPECGRSFSRKAALKTHQRTHSEEKPFSCDECGRKFIYKIKLDEHIRVHTGEKPFSCPECNKSFRLKRSL-----KAHGLQHSGKRPFQCPECSRGFFWRNAMRAHQRLHSEQKPFPCAECGKRFTRPSKLACHTRVHD------------------RQKEFPCGECKKTFSQQSRLTQHLKVHN--TEKPFSCAECGRSF-RRRAHLTE-HTRLHSGEEPFQ-CPECDKSFSWKASMKFHQRMHRDEKPFACSECGKTYTHQSQLTEHLRLHSGEKPYQCPECQKTFRLKGNLKSHLLQHSGQKPFSCVMCGKSFTQQYRLTEHIRVH-SGEKPFQCPECDKSYCIRGSLKVHLYTHSGERPFQCPECGKGFLQKRSLKAHL 702          

HSP 2 Score: 68.5514 bits (166), Expect = 2.337e-10
Identity = 93/371 (25.07%), Postives = 147/371 (39.62%), Query Frame = 2
Query: 1745 KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHN------------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSKTYYCELC--RIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNF----KKVSCFACSRKI-RISHMKSHL---SSHQIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            ++ C  C +    K +   H  VH   +  PCPECD +F+Y   L +H+   HR   P  + C  C +     C ++ HLR H  E P QC +C++        K H+  H+              S K   +T    H  S+ + FSC  C + F YK    +H + H   +   CP C  +       L+  + A H   H G   +       GF           ++  + K + C  C  R   P+K   +   + R K  P  +       +    Q L      K  SC  C R   R +H+  H    S  + +QC +C K F    S+  H+++H ++    CS C + +T   +L  HL++
Sbjct:  234 RFQCSECEKSYFLKGSLVTHQVVHTGQRPYPCPECDKTFRYRANLKKHLC-LHRGERP--FCCGECGRAFVQQCELTEHLRLHSGEKPFQCPQCDRCFRLKRGMKVHLSQHSGKRPFHCPECGRSFSRKAALKTHQRTH--SEEKPFSCDECGRKFIYKIKLDEHIRVHTGEKPFSCPECNKSF-----RLKRSLKA-HGLQHSGKRPFQCPECSRGFFWRNAMRAHQRLHS-EQKPFPCAECGKRFTRPSKLACHTRVHDRQKEFPCGECKKTFSQQSRLTQHLKVHNTEKPFSCAECGRSFRRRAHLTEHTRLHSGEEPFQCPECDKSFSWKASMKFHQRMHRDEKPFACSECGKTYTHQSQLTEHLRL 592          

HSP 3 Score: 60.8474 bits (146), Expect = 5.277e-8
Identity = 64/237 (27.00%), Postives = 96/237 (40.51%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTI-TELNILIKTFFCVTCNKTVR-KRNEKRHALTHLGNEK--CKDCGLV-VNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2209
            C +++  RA  T  T L+   + F C  C+K+   K + K H   H   +   C +CG    +++++  H++ H     Y C  C +    K N + H+  H   K   C  C  SF     L  HI + H   +P  ++CP C K  C   ++  HL TH  E P QC  C +      + KAH+  H                  S    FSC  C ++F Y      H   HA+
Sbjct:  520 CGRSFRRRAHLTEHTRLHSGEEPFQCPECDKSFSWKASMKFHQRMHRDEKPFACSECGKTYTHQSQLTEHLRLHSGEKPYQCPECQKTFRLKGNLKSHLLQHSGQKPFSCVMCGKSFTQQYRLTEHI-RVHSGEKP--FQCPECDKSYCIRGSLKVHLYTHSGERPFQCPECGKGFLQKRSLKAHLCLH------------------SGERPFSCDECGRSFTYVGALKTHIAVHAK 735          
BLAST of Zinc finger protein 112-like vs. UniProt/SwissProt
Match: sp|Q4V348|Z658B_HUMAN (Zinc finger protein 658B OS=Homo sapiens OX=9606 GN=ZNF658B PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 3.553e-14
Identity = 116/453 (25.61%), Postives = 186/453 (41.06%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTITE-LNILIKTFFCVTCNKTVRKRNEKR-HALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI-----LSSKG-----RDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPY-CPI--NSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINI-------YKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSC---FACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            C KT+ ++   ++ + ++   K + C  C K+    +  R H   H G +  +C DC      N   S +++H +       Y C  CGR  A     + H  +H + K   C EC  SF Y   L     +AH++I  G+  YEC  C+K      A+  H R H  E P +C  C +  ++ SA +AH   H        S  G     + R  T R + +  + + C  C KTF+ K+  + H + H      PY C +   +     AL      VH  +H G   Y  C+E     S   ++          K Y C  C   F +   L  HH      KP +         K  H + + +  S    + CS   +    KS++S+HQ        Y+C  C K F + ++L +H+++H  + S  C+ C + F+    L AH ++
Sbjct:  311 CEKTFSHKTHLSVHQRVHTGEKPYECNDCGKSFTYNSALRAHQRIHTGEKPYECSDCEKTFAHN---SALRAHHRIHTGEKPYECNECGRSFAHISVLKAHQRIHTREKPYECNECGRSFTYNSAL-----RAHQRIHTGRKPYECSDCEKTFAHNSALKIHQRIHTGEKPYKCNECEKTFAHNSALRAHQNIHTGEKLYECSECGKTFFQKTRLSTHRRIHTGEKPYECSKCGKTFSQKSYLSGHERIHTGEK--PYECNVCGKTFVYKAAL-----IVHQRIHTGEKPYE-CNECGKTFSQRTHLCAHQRIHTGEKPYECNECGKTFADNSALRAHHRIHTGEKPYECNDCGKTFSKTSHLRAHLRTRSGEKPYECSECGKTFSEKSYVSAHQRVHTGEKPYECNVCGKPFAHNSTLRVHQRIHTGEKSYECNDCGKTFSQKSHLSAHQRI 747          

HSP 2 Score: 60.077 bits (144), Expect = 8.677e-8
Identity = 102/415 (24.58%), Postives = 158/415 (38.07%), Query Frame = 2
Query: 1724 SHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARH-----------------------ITKAHRQIEPGK--YECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSK-----GRDRTITP-----RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIV------TDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKL--NFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            SH+K H +       Y C  CG+  +   +   H  +H   K   C EC+ +F +   L+ H                         +AH++I  G+  YEC  C+K      A+  H R H  E P +C  C +  ++ S  KAH R H           GR  T        + + +  + + C  C+KTF + +    H + H      PY   N  E   A    + A H ++H G   Y  C E        T +S +  I+   K Y C  C   F  K  L+ H       KP +          K +LI+      HQ++    K   C  C +       ++HL +HQ        Y+C +C K F + ++L  H ++H       C+ C + F+    L AHL+ 
Sbjct:  263 SHLKGHQRILMGEKPYECIECGKTFSKTSHLRAHQRIHTGEKPYECVECEKTFSHKTHLSVHQRVHTGEKPYECNDCGKSFTYNSALRAHQRIHTGEKPYECSDCEKTFAHNSALRAHHRIHTGEKPYECNECGRSFAHISVLKAHQRIHTREKPYECNECGRSFTYNSALRAHQRIHTGRKPYECSDCEKTFAHNSALKIHQRIHTGEK--PY-KCNECEKTFAHNSALRA-HQNIHTGEKLYE-CSECGKTFFQKTRLSTHRRIHTGEKPYECSKCGKTFSQKSYLSGHERIHTGEKPYECNVCGKTFVYKAALIV------HQRIHTGEKPYECNECGKTFS---QRTHLCAHQRIHTGEKPYECNECGKTFADNSALRAHHRIHTGEKPYECNDCGKTFSKTSHLRAHLRT 663          
BLAST of Zinc finger protein 112-like vs. TrEMBL
Match: A0A3Q2CME3 (Uncharacterized protein OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.327e-17
Identity = 108/425 (25.41%), Postives = 168/425 (39.53%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCP---INSLESIPALREHIS-------------------AVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSI 2698
            K F C TC K+ R++ E  +H  TH G +  +C  CG   + K  +  HM++H     Y C  CG+    + +   H+ +H   K   C  C  SF++  +L RH  + H   +P  + CP C +     C +S H R H+ E    CE C++     S Y+ H+R H                  +  + F C++C+K+F  +   T+H + H   + + C  C     NS   +  +R H                      VH   H G  K   C       SD+ ++ +        KTY CELC   F   ++L +H       KP           +KT+L   M+ +  +    K   C  C +  R       HM++H +  + Y+C  C K F   N L  H + H      CS 
Sbjct:  203 KPFSCPTCGKSFRRQPELTQHMRTHTGEKPFRCPICGKGFIQKTTLNYHMRTHTGEKPYGCGFCGKSFIQRSDLTCHLRIHTDEKPYCCELCSKSFRHSSDLTRH-RRTHTTGKP--FSCPTCGRAFSKQCKLSRHERIHDSEKTYSCESCDKSFRRRSDYERHLRTH------------------TGEKPFDCELCEKSFRQRGDLTRHMRTHTGEKTSVCKVCGKSFSNSSSMLRHMRTHTGEKPYICKVCGKLFGFGGHLTVHLRTHTGE-KPCSCKVCGRSFSDSSSMARHMRTHTGEKTYPCELCEKSFRQSWDLARHRRTHTGEKPFQCLACGKGFVQKTTLSYHMRTHTGE----KPFPCEICDKSFRQRNDLTRHMRTH-TGEKPYRCEMCDKSFRQSNELTRHVKTHTGEDLSCSA 600          

HSP 2 Score: 76.2554 bits (186), Expect = 2.047e-10
Identity = 71/265 (26.79%), Postives = 110/265 (41.51%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTI-TELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFK----------------------------ENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA 2206
            SC+K++  R+ Y      +   K F C  C K+ R+R +  RH  TH G +   CK CG    N + +  HM++H     YIC+VCG++  F                              +  RH+  H   K  PC  C+ SF+   +LARH  + H   +P  ++C  C K       +S+H+RTH  E P  CE C++     +    H+R H                  +  + + C++C K+F      T+H K H 
Sbjct:  349 SCDKSFRRRSDYERHLRTHTGEKPFDCELCEKSFRQRGDLTRHMRTHTGEKTSVCKVCGKSFSNSSSMLRHMRTHTGEKPYICKVCGKLFGFGGHLTVHLRTHTGEKPCSCKVCGRSFSDSSSMARHMRTHTGEKTYPCELCEKSFRQSWDLARH-RRTHTGEKP--FQCLACGKGFVQKTTLSYHMRTHTGEKPFPCEICDKSFRQRNDLTRHMRTH------------------TGEKPYRCEMCDKSFRQSNELTRHVKTHT 592          

HSP 3 Score: 67.781 bits (164), Expect = 9.459e-8
Identity = 88/363 (24.24%), Postives = 144/363 (39.67%), Query Frame = 2
Query: 1709 KNKICSHMKSHFKYICEVCGRIDAFKENH--ERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCH--AQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKV--SCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            K KICS         CEVCG+   FK++     H+  H   K   CP C  SF+   EL +H+ + H   +P  + CP C K       +++H+RTH  E P  C  C +     S    H+R H                  +  + + C++C K+F + +  T+H + H   +   CP C     +     R      H  +H+    Y    CD+     SD     ++    K + CELC   F  + +L +H                  M+ +  +K +  KV    F+ S  + + HM++H +  + Y C  C K F     L +H + H       C +C + F+    +  H++
Sbjct:  173 KTKICS---------CEVCGK--CFKQHRYLNAHMMTHTAEKPFSCPTCGKSFRRQPELTQHM-RTHTGEKP--FRCPICGKGFIQKTTLNYHMRTHTGEKPYGCGFCGKSFIQRSDLTCHLRIH------------------TDEKPYCCELCSKSFRHSSDLTRHRRTHTTGKPFSCPTCGRAFSKQCKLSR------HERIHDSEKTYSCESCDKSFRRRSDYERHLRTHTGEKPFDCELCEKSFRQRGDLTRH------------------MRTHTGEKTSVCKVCGKSFSNSSSM-LRHMRTH-TGEKPYICKVCGKLFGFGGHLTVHLRTHTGEKPCSCKVCGRSFSDSSSMARHMR 477          
BLAST of Zinc finger protein 112-like vs. TrEMBL
Match: A0A5F9C3R0 (Uncharacterized protein OS=Oryctolagus cuniculus OX=9986 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 4.710e-17
Identity = 113/414 (27.29%), Postives = 174/414 (42.03%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTK----YGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKLNFKKVSC--------FACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            K + C  C K  R+R + K H   H G +   C+DCG V  + + + +H + H     + C+ CG+      + + H  VH   K   C  C   F++ + LA H  + H   +P  Y C  C K     S  L+ H+     E P +C  C +V S  S  ++H R H                  +  + +SC +C KTF++K+  T H++ HA   C  Y    +L ++P  R     VH +  + HT+     GF       V    +  + K Y CE C   F     L   H R H  KP        S         HQ+++  +  C        F CS  + I H + H +  ++Y+C +C K F  P+SL  H+ VH  + S  C +C + FT    L AH ++
Sbjct:  319 KPYKCDECGKGFRRRADLKIHCRIHTGEKPYHCEDCGQVFRQASNLLAHQRVHSGEKPFKCDACGKGFGRSSHLQAHQKVHTGEKPYRCEACGKGFKWSLNLAMH-QRVHTGEKP--YRCGECGKSFSQASS-LQLHQSVHTGEKPYRCGECGKVFSRSSQLRSHQRVH------------------TGEKPYSCAVCGKTFSWKSNLTIHHRIHAGDAC--YERGENLRALPVER----GVH-ATKKPHTREQCGQGFRRRSALSVHCKAHTAE-KPYPCEQCGRAFSQPAHLQD-HRRVHGEKPFTCDACGKSFGRNSHLQSHQRVHTGEKPCKCEDCGKGFTCSSNLYI-HQRVH-TGEKLYKCEECGKGFSRPSSLQAHQGVHTGEKSYMCIVCGKGFTLSSNLQAHQRV 699          
BLAST of Zinc finger protein 112-like vs. TrEMBL
Match: A0A3B4U132 (Uncharacterized protein OS=Seriola dumerili OX=41447 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.899e-17
Identity = 111/415 (26.75%), Postives = 163/415 (39.28%), Query Frame = 2
Query: 1601 FFCVTCNKTV-RKRNEKRHALTHLGNEK--CKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            + C TC K   R    K H  TH G +   C+ CG  +  +K +  HM++H     Y C  CG+  + K +  +H   H   K   C  C   F     L  H+ + H   +P  Y C  C K     S    H+RTH  E P  C  C +  SN S    H R H                  +  + + C+ C K F   ++   H + H   +   C  C  +   S  +L      VH   H G   Y  C+      S+  ++ K        K Y C+ C   F NK +L+KH       KP       +K S I  +K +     N K   C  C + +R S     HMK+H +  + Y C  C KKF N ++L  H + H ++    C  C + FT+   L+ H++ 
Sbjct:  156 YSCDTCGKKFSRTSRLKNHLRTHTGEKPYFCETCGKSLRSSKGLVVHMRTHTGEKPYTCNTCGKKFSNKSDLSKHTRTHTGEKPYSCEICGKGFTTRTVLLVHV-RIHTGEKP--YFCETCGKDFRTCSESLVHMRTHTGEKPYTCNTCGKKFSNKSDLSTHKRTH------------------TDEKPYCCEACGKGFRTSSVLLVHKRIHTGEKPYSCETCGKDFRTSYESL------VHMRTHTGEKPY-TCNTCGKKFSNKSDLSKHTRTHTGEKPYTCKTCGKKFTNKSDLSKHTRTHTGEKPYPCTTCGEKFSQISILKNHLRTHTNEKPYFCETCGKSLRSSKGLLIHMKTH-TREKPYTCTTCWKKFSNKSTLSKHTKTHIDQKLYFCETCGKGFTTRTLLLVHMRT 541          

HSP 2 Score: 71.2478 bits (173), Expect = 7.847e-9
Identity = 101/401 (25.19%), Postives = 158/401 (39.40%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRK-RNEKRHALTHLGNE--KCKDCGL-VVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITPRHLI-----SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTDVSDNINIYKS----KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFAC-----SRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVH 2671
            K +FC TC K++R  +    H  TH G +   C  CG    NK+ +  H ++H     Y CE+CG+    +     H+ +H   K   C  C   F+   E   H+ + H   +P  Y C  C K       +S H RTH +E P  CE C +     S    H R H         + G+D   +   L+     +  + ++C  C K F+ K+  ++H + H      PY      +      +   + H   H G   Y    C E  + +S   N  ++    K Y+CE C     +   L  H     + KP            K++L    K +  QKL F    C  C     +R + + HM++H +  + Y C  C K+F    +L  H  +H
Sbjct:  182 KPYFCETCGKSLRSSKGLVVHMRTHTGEKPYTCNTCGKKFSNKSDLSKHTRTHTGEKPYSCEICGKGFTTRTVLLVHVRIHTGEKPYFCETCGKDFRTCSESLVHM-RTHTGEKP--YTCNTCGKKFSNKSDLSTHKRTHTDEKPYCCEACGKGFRTSSVLLVHKRIHTGEKPYSCETCGKDFRTSYESLVHMRTHTGEKPYTCNTCGKKFSNKSDLSKHTRTHTGEK--PYTCKTCGKKFTNKSD--LSKHTRTHTGEKPYPCTTCGEKFSQISILKNHLRTHTNEKPYFCETCGKSLRSSKGLLIHMKTHTREKPYTCTTCWKKFSNKSTLSKHTKTHIDQKLYF----CETCGKGFTTRTLLLVHMRTH-TGEKPYPCDICGKRFSQKTNLARHVTIH 570          

HSP 3 Score: 61.2326 bits (147), Expect = 8.808e-6
Identity = 61/225 (27.11%), Postives = 91/225 (40.44%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEKR-HALTHLGNE--KCKDCGL-VVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH---NILSSKGRDRTITPRHLI-------SKSECFSCQICQKTFNYKAMFTQHYKCHA 2206
            K + C TC K  R   E   H  TH G +   C  CG    NK+ +  H ++H     Y C+ CG+    K +  +H   H   K  PC  C   F  +  L  H+ + H   +P  Y C  C K + +      H++TH  E P  C  C +  SN S    H + H    +   +   +  T R L+       +  + + C IC K F+ K    +H   H+
Sbjct:  350 KPYSCETCGKDFRTSYESLVHMRTHTGEKPYTCNTCGKKFSNKSDLSKHTRTHTGEKPYTCKTCGKKFTNKSDLSKHTRTHTGEKPYPCTTCGEKFSQISILKNHL-RTHTNEKP--YFCETCGKSLRSSKGLLIHMKTHTREKPYTCTTCWKKFSNKSTLSKHTKTHIDQKLYFCETCGKGFTTRTLLLVHMRTHTGEKPYPCDICGKRFSQKTNLARHVTIHS 571          
BLAST of Zinc finger protein 112-like vs. TrEMBL
Match: A0A096MF06 (Uncharacterized protein OS=Poecilia formosa OX=48698 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 6.221e-17
Identity = 114/445 (25.62%), Postives = 179/445 (40.22%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTI-TELNILIKTFFCVTCNKTVRKRNEKRHALTHL---GNEK---CKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-----HMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            +C KT+  ++  T    ++   K F CVTC K  R    K H ++H+     EK   C  CG    +   + +HMKSH     + C  CG+    K     HI  H   K   C  C   F     L+ H+ + H+  +P  + C  C+K   +   ++ H+RTH +E P  C  C + LS+ S +  H++ H                  +  + F+C  C K F  K+    H K H     FTC       SL+S          +H   H G   +     G C      ++ ++ I+   K + C+ C   F NK  L  H       KP          R ++SL I M+ +  +K      SC  C +          HM++H +  + + C+KC+K F    +L  H ++H       C IC + FT+   L  H++
Sbjct:  212 TCQKTFTQKSNLTTHLRIHTGKKPFSCVTCGKKFR---NKSHLISHMRIHTGEKPFTCMTCGKSFTQIGHLGTHMKSHTGEKAFACTTCGKQFREKRGLTSHIRSHTGDKPFSCGTCRKGFFTKDGLSYHM-RIHKGEKP--FSCKSCEKTFTSRSCLASHMRTHTDEKPFSCGTCGKSLSSRSHFTYHMKTH------------------TGEKPFTCCTCGKRFIQKSHLATHMKDHTGEKLFTCGICGKGFSLKSC-------LTIHMRTHTGEKPFTCGTCGKCFSTKDGLNSHMRIHTGEKPFSCKCCEKNFTNKTNLTFHMRSHTGEKPYACMTCGKSFRVRSSLTIHMRTHTGEK----PFSCMTCGKSFSARNCLTIHMRTH-TGERPFSCVKCEKSFREKGALTTHMKIHTGEKPFSCEICGKNFTNRKSLPVHMR 620          
BLAST of Zinc finger protein 112-like vs. TrEMBL
Match: A0A3B3VYT7 (Uncharacterized protein OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.308e-16
Identity = 113/420 (26.90%), Postives = 176/420 (41.90%), Query Frame = 2
Query: 1595 KTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGLVVNKNK-ICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH--------NILSSKGRDRTITPRHLISKSE-CFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKL---NFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHL 2743
            K F C+TC K   +K N   H  TH G +   C+ CG     +  + SHM++H     + C VCG+    + N   H+  H   K   C  C  ++     L  HI ++H   +P  Y C  C K       +++H+RTH  E P  C+ C +  S+ S    H+R H        N+      D +   +H+ + ++  F C+ C K+F       +H   H     F+C   C   S  S  +L+ H S VH  +H+                        K + CELC   F N+  L +H       KP            K++LI  ++ +  +K    NF +VS    S+  R  H+++H +  + + C+ C KKF  P SL +H Q H       C  C + FT+  +L AH+
Sbjct:   84 KPFSCLTCGKGFTQKTNLIVHMRTHTGEKPHTCQLCGKSFRASGHLASHMRTHTGEKPFSCLVCGKGFTQQSNLTVHMRTHSGEKPYSCDVCGKAYSDKTYLNDHI-RSHTGEKP--YSCKVCGKSFSNRSPLTNHMRTHTGEKPYHCKTCGKAFSDCSNLAKHMRTHTGEKPYYCNVCGKASSDSSSMAKHMRTHTKKPFPCRSCDKSFRNSRDLVRHSTLHTGEKPFSC-GLC-GKSYPSRGSLKTH-SKVH--MHQ------------------------KPFVCELCAKTFTNRTNLVRHRRTHTGEKPFSCTACGKFFSDKSTLIRHVRSHTGEKPFSCNFCEVSFTDNSQLTR--HLRTH-TGEKPFSCVTCGKKFSKPYSLTMHFQTHTGEKPFSCQQCGKLFTARCKLTAHI 468          
BLAST of Zinc finger protein 112-like vs. Ensembl Cavefish
Match: ENSAMXT00000040057.1 (gastrula zinc finger protein XlCGF57.1-like [Source:NCBI gene;Acc:111191523])

HSP 1 Score: 79.7221 bits (195), Expect = 4.759e-15
Identity = 112/443 (25.28%), Postives = 177/443 (39.95%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTITEL-NILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPG--KYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTDVSD-------NINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-----ISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR-CSICYQFFTSHIRLMAHLKM 2749
            C K++ +   +   +L +   K + C  C KT R +N  + H   H G +   C DCG   N ++ + +H++ H     Y C VCG+  A   + + H  +H   K   C EC  SF     L RH     + I  G  +Y+C  C K    +S+   H R H  E P  C  C +  +  S  + H+R H                  +  + +SC  C K+F  +     H + H     F C P C           R+++   H   H G  +Y    C    TD+S+       +I +   K Y C  C   F  + +L KH +     KP       K  +  + ++ +       K  SC  C R        + H + H  S + Y CI+C + F  P++L  H+++H       CS C + F  H +L+AH + 
Sbjct:   67 CGKSFADNTSFKRHQLVHTGAKPYTCSECGKTFRHQNHFQAHQRLHAGEKPFSCLDCGKTFNTQSNLQTHLRVHTGEKPYSCSVCGKSFAQHSSLKTHQLLHTGEKPFSCTECGKSFTQKSVLERH-----KLIHSGEKRYDCSECGKSFTDVSNFQTHQRLHTGEKPYSCLECGKRFNAQSHLQTHLRVH------------------TGEKPYSCSECGKSFAQQINLRNHQRIHTGEKPFPC-PDC------GKSFTRKYVLERHRLGHTGEKRYDCSECGMSFTDLSEFQSHRRLHIGL---KPYSCLECGKRFNTEDDLQKHLHVHTGEKPYPCTVCGKTFAQPVNLRNHLRIHTGEKPFSCSDCGRCFTSQSNLLQHQRVH--SGERYICIECGRSFTLPSNLRKHQRLHTGDKPFCCSECGKSFRQHCQLLAHQRT 474          

HSP 2 Score: 73.1738 bits (178), Expect = 5.582e-13
Identity = 99/397 (24.94%), Postives = 156/397 (39.29%), Query Frame = 2
Query: 1679 KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI--------LSSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINI-------YKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKK--------TSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            +C DCG     ++ + +H   H     Y C  CG+  A   + +RH  VH  AK   C EC  +F++         +AH+++  G+  + C  C K     S+   HLR H  E P  C  C +  + +S+ K H   H                 +++  RH +  S  + + C  C K+F   + F  H + H      PY  +   +   A + H+   H  +H G   Y  C E     +  IN+          K + C  C   F  K+ L + H   H  + R          T L  F + +R   +  K  SC  C ++      ++ HL  H   + Y C  C K F  P +L  H ++H       CS C + FTS   L+ H ++
Sbjct:   35 QCSDCGKGFTTESGLKNHQLIHTGEKPYSCTECGKSFADNTSFKRHQLVHTGAKPYTCSECGKTFRHQNHF-----QAHQRLHAGEKPFSCLDCGKTFNTQSNLQTHLRVHTGEKPYSCSVCGKSFAQHSSLKTHQLLHTGEKPFSCTECGKSFTQKSVLERHKLIHSGEKRYDCSECGKSFTDVSNFQTHQRLHTGEK--PYSCLECGKRFNA-QSHLQ-THLRVHTGEKPYS-CSECGKSFAQQINLRNHQRIHTGEKPFPCPDCGKSFTRKYVLER-HRLGHTGEKRYDCSECGMSFTDLSEF-QSHRRLHIGLKPYSCLECGKRFNTEDDLQKHLHVHTGEKPYPCTVCGKTFAQPVNLRNHLRIHTGEKPFSCSDCGRCFTSQSNLLQHQRV 419          

HSP 3 Score: 53.9138 bits (128), Expect = 6.636e-7
Identity = 63/247 (25.51%), Postives = 99/247 (40.08%), Query Frame = 2
Query: 1595 KTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGL-VVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFT-CCPYCP--INSLESIPALREHISAVHFSL 2296
            K F C  C K+  RK   +RH L H G ++  C +CG+   + ++  SH + H     Y C  CG+    +++ ++H+ VH   K  PC  C  +F   V L  H+ + H   +P  + C  C +   + S+   H R H      C  C +  +  S  + H R H                  +  + F C  C K+F        H + H +    CP C      L SI   +   + V F+L
Sbjct:  284 KPFPCPDCGKSFTRKYVLERHRLGHTGEKRYDCSECGMSFTDLSEFQSHRRLHIGLKPYSCLECGKRFNTEDDLQKHLHVHTGEKPYPCTVCGKTFAQPVNLRNHL-RIHTGEKP--FSCSDCGRCFTSQSNLLQHQRVHSGERYICIECGRSFTLPSNLRKHQRLH------------------TGDKPFCCSECGKSFRQHCQLLAHQRTHTEEKYICPVCGKSFKQLSSIETHKCTSNPVDFTL 509          
BLAST of Zinc finger protein 112-like vs. Ensembl Cavefish
Match: ENSAMXT00000011094.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000150.1:841156:842598:-1 gene:ENSAMXG00000010805.2 transcript:ENSAMXT00000011094.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 1.050e-14
Identity = 111/426 (26.06%), Postives = 169/426 (39.67%), Query Frame = 2
Query: 1595 KTFFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH---NILSSKGRDRT-ITPRHLI------SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALR--EHISAVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLK-----PRKKTSLIIFMKKYRHQKL--NFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            K F C  C K+  R+ N + H   H G +  +C DCG   N+ + +  H++ H     Y C  CG+   ++ N ++H  VH   K + C EC  SF+ L  L  H    HR   P  Y+C  C K       +  H R H  + P QC  C +  ++    + H R H   N+       +T     HL       +  + + C +C K+F  +     H + H         P +  E     R   H+  VH  +H G   Y     G     V ++ ++  I+   K + C +C   F     L K H R H  +     P  + S I       HQ++    K   C  C +  R + H+K H   H   + Y C +C K F +   L  H+ VH      +CS C + FT    L  H ++
Sbjct:   56 KQFQCSECGKSFNRQSNLQAHQRIHTGEKPFQCPDCGKTFNRQSNLQLHLRVHTGEKPYQCPDCGKSFTYQSNFQQHQRVHTGEKPHQCSECGKSFRSLGNLKGHQL-VHRGETP--YQCSVCGKSFNRQSNLQQHQRIHTGDKPHQCLECGKSFTHKCKLQEHQRIHTGENLYQCSDCGKTCFKKSHLEDHQRIHTGEKPYQCSVCGKSFALQTTLQIHQRVHTGEK-----PYHCSECGKGFRYAGHL-KVHQRVHTGEKPYHCPECGKSFNYVGNLKEHQRIHSGEKPFPCTVCGKSFRYLGHL-KEHRRVHTGEKPFQCPECEKSFIAKHSLQIHQRIHTGEKPYQCSECGKFFRCLDHLKGHQRVHTGEKPYYCSECGKSFSDLRVLTAHQHVHTGDKPYQCSTCGKSFTLKRSLQIHQRV 471          

HSP 2 Score: 66.2402 bits (160), Expect = 7.750e-11
Identity = 99/400 (24.75%), Postives = 153/400 (38.25%), Query Frame = 2
Query: 1754 CEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI-----LSSKGRD----RTITPRHLISKSEC-FSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPA------LREHIS-----------------------AVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH--EKSSQRCSICYQFFTSHIRLMAHLKMFHKM 2761
            C  CG     K + + H  VH   K+  C EC  SF     L     +AH++I  G+  ++CP C K     S+   HLR H  E P QC  C +  +  S ++ H R H        S  G+       +    L+ + E  + C +C K+FN ++   QH + H         P   LE   +      L+EH                           H  +H G   Y        F  +    +   ++    K Y+C  C   F     L  H       KP       K  + +  +K+++      K   C  C +  R + H+K H   H   + +QC +C+K F   +SL +H+++H  EK  Q CS C +FF    R + HLK   ++
Sbjct:   32 CSECGVSFITKSHLQVHQRVHTGEKQFQCSECGKSFNRQSNL-----QAHQRIHTGEKPFQCPDCGKTFNRQSNLQLHLRVHTGEKPYQCPDCGKSFTYQSNFQQHQRVHTGEKPHQCSECGKSFRSLGNLKGHQLVHRGETPYQCSVCGKSFNRQSNLQQHQRIHTGDK-----PHQCLECGKSFTHKCKLQEHQRIHTGENLYQCSDCGKTCFKKSHLEDHQRIHTGEKPYQCSVCGKSFALQTTLQIHQRVHT-GEKPYHCSECGKGFRYAGHLKVHQRVHTGEKPYHCPECGKSFNYVGNLKEHQRIHSGEKPFPCTVCGKSFRYLGHLKEHRRVHTGEKPFQCPECEKSFIAKHSLQIHQRIHTGEKPYQ-CSECGKFF----RCLDHLKGHQRV 415          

HSP 3 Score: 58.151 bits (139), Expect = 3.362e-8
Identity = 62/231 (26.84%), Postives = 94/231 (40.69%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEKR-HALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRD----RTITP-RHLISKSECFSCQICQKTFNYKAMFTQHYKCHA 2206
            K + C  C K+   +   + H   H G +   C +CG      +   H+K H +       Y C  CG+   +  N + H  +H   K  PC  C  SF+YL  L     K HR++  G+  ++CP C+K   A  H L+ H+     E P QC  C +        K H R H        S  G+     R +T  +H+ +  + + C  C K+F  K     H + H 
Sbjct:  252 KPYQCSVCGKSFALQTTLQIHQRVHTGEKPYHCSECGKGF---RYAGHLKVHQRVHTGEKPYHCPECGKSFNYVGNLKEHQRIHSGEKPFPCTVCGKSFRYLGHL-----KEHRRVHTGEKPFQCPECEKSFIA-KHSLQIHQRIHTGEKPYQCSECGKFFRCLDHLKGHQRVHTGEKPYYCSECGKSFSDLRVLTAHQHVHTGDKPYQCSTCGKSFTLKRSLQIHQRVHT 473          
BLAST of Zinc finger protein 112-like vs. Ensembl Cavefish
Match: ENSAMXT00000039103.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000052.1:2092417:2202492:1 gene:ENSAMXG00000040630.1 transcript:ENSAMXT00000039103.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 1.572e-14
Identity = 102/448 (22.77%), Postives = 169/448 (37.72%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE-LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI------------LSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----KTSLIIFMKKYRHQKL--NFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
             C K+++ +      + ++   K + C  C K+  ++   + H   H G +  +C DCG   N+   + SH + H     Y C  CG+  + K N + H+ +H + K  PC EC  +F+    L +H  + H   +P  Y+C  C K      ++  H R H  E P QC  C +  +   + ++H R H               + +G  ++    H   K   + C  C K+FN +     H + H         P +  E     R      H  +H G   Y  C E      ++  + K        K Y+C +C+  F  +  L  H       KP        S         HQ++    K   C  C +      + ++H   H   + YQC+ C K F    +L  H ++H       C  C + FT    L  H ++
Sbjct:  189 DCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSQCGKSFSQKINLQSHLRIHTEEKPFPCSECGKTFRESGALKKH-QRVHTGEKP--YQCSDCGKSFNQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKP--YQCSDCGKSFNQQGSLQSHQRIHTGEK-----PYHCSECGLRFRHSFKLFHQRIHTGEKPYQ-CSECGRSFRESGALRKHDCVFLGEKPYHCPVCQKGFTVQGNLQAHLRIHSGEKPFYCSVCGKSFTQHNNFQAHQRIHTGEKPYQCLECGKSFNEQGYFRAHQRVHTGEKPYQCLDCGKSFTQQGNLQKHLRIHTGEKPFHCEECGKSFTQQGNLQIHQRV 625          

HSP 2 Score: 68.5514 bits (166), Expect = 2.474e-11
Identity = 99/451 (21.95%), Postives = 174/451 (38.58%), Query Frame = 2
Query: 1532 SCNKTYDNRAKYTITE-LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRI--DAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK---IVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI------------LSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY--GFCDEIVTDVSDNINIYK-----SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
             C K+++ +      + ++   K + C  C K+  ++   + H   H G +  +C DCG   N+   + SH + H     Y C  CG     +FK  H+R   +H   K   C EC  SF+    L +H       +    Y CP C+K   +   +  HLR H  E P  C  C +  + ++ ++AH R H               + +G  R     H   K   + C  C K+F  +    +H + H         P +  E   +  +  +  +H  +H G   Y    C +  T  + ++ +++      K Y+C  C   F +      H       KP       K+ +   + + ++      +   C  C +   + ++++ H   H   + YQC  C K F    +L +H++VH       CS C + FT    L  H ++
Sbjct:  357 DCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSECGLRFRHSFKLFHQR---IHTGEKPYQCSECGRSFRESGALRKHDCVF---LGEKPYHCPVCQKGFTVQGNLQAHLRIHSGEKPFYCSVCGKSFTQHNNFQAHQRIHTGEKPYQCLECGKSFNEQGYFRAHQRVHTGEKP--YQCLDCGKSFTQQGNLQKHLRIHTGEK-----PFHCEECGKSFTQQGNLQIHQRVHTGEKPYECSECGKSFTFQTSSLKVHQRIHTGEKPYHCSDCSKSFGHLSHFKSHRRIHTGEKPYKCSECGKRFNERGYFRAHQRVHTGERPFPCLDCGKSFTQQANLQKHQRIHTGEKPYQCSDCGKSFTQQGNLTMHQRVHTGEKPYECSECGKSFTFQTALRRHQRL 794          

HSP 3 Score: 61.2326 bits (147), Expect = 4.009e-9
Identity = 103/417 (24.70%), Postives = 146/417 (35.01%), Query Frame = 2
Query: 1700 VVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSA----------------------------YKAHIRYHNILSSK-----GRDRTITP---RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKYGFCDEIVTDVSDNINIYKS-----------KTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVH--EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            V +K+K  +  K   +Y C  CG+  + +   + H   H   K   CP+C  SF  L  L RH  + H   +P  ++C  C K      ++  HLR H EE P  C  C +     SA                             K H RYH           G+  +IT    RH   K + + C  C K+FN +     H + H         P    +   +  +  S   H  +H G   Y       +D   + N   S           K Y+C  C   F  K  L  H     + KP       K       +KK++      K   C  C +     + +  L SHQ        YQC  C K F    SL  H++VH  EK  Q CS C + F     L +H ++
Sbjct:    4 VSDKSKQENSSKEKKEYHCSDCGKCFSAESQLKTHQRYHTGEKPYECPDCGKSFTILGHLQRH-RRVHTGEKP--FQCSDCGKSFYQQSSLKIHLRIHTEEKPYSCSECGKTFREDSALKKHQSVHTGEKPYKCLECGKSFPIESQLKTHQRYHTGEKPYECLECGKSFSITGHLLRHQREKKD-YHCLDCGKSFNQQGSLQSHQRIHTGEK-----PYQCSDCGKSFNQQGSLQSHQRIHTGEKPY-----QCSDCGKSFNQQGSLQSHQRIHTGEKPYHCSQCGKSFSQKINLQSHLRIHTEEKPFPCSECGKTFRESGALKKHQRVHTGEKPYQCSDCGKSF---NQQGSLQSHQRIHTGEKPYQCSDCGKSFNQQGSLQSHQRVHTGEKPYQ-CSDCGKSFNQQGSLQSHQRV 402          
BLAST of Zinc finger protein 112-like vs. Ensembl Cavefish
Match: ENSAMXT00000022193.2 (zinc finger protein 501-like [Source:NCBI gene;Acc:103045258])

HSP 1 Score: 73.9442 bits (180), Expect = 2.500e-13
Identity = 107/412 (25.97%), Postives = 151/412 (36.65%), Query Frame = 2
Query: 1595 KTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ--FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQ-------IYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAH 2740
            K F C  C +   RK N + H   H G +   C DCG    + N +  H + H     Y C  CG+    + + + H  +H   K   C +C  SF     L     K H++I  G+  Y C  C K       +  H R H  E P QC  C    S+  + + H R H                  +  + F C  C K+F  ++   +H + H++     CP C   S   I AL++H       +H G   Y  C E     +  I++ K        K Y+C  C   F     L KH       KP                         + CS        +SHL  HQ        YQC+KC K F    +L  H+ +H E+ +  CS C Q FT+   L  H
Sbjct:   51 KPFHCTECGQRFTRKNNLQMHQSIHTGEKPFHCSDCGRKFRRQNNLLIHQRIHTGERPYQCSECGKRFGHQISLQTHQRIHTGEKPYQCSDCGRSFSRQNNL-----KTHQRIHTGEKPYHCSECGKCFNQQATLQQHQRVHTGEKPYQCFICGHRFSHQISLQMHQRIH------------------TGEKPFRCLECGKSFIQQSNLQKHQRIHSEEKLYLCPECG-KSFREIGALKKHQR-----IHTGEKPYQ-CSECGKSFNHQISLQKHQRIHTGEKPYFCSDCGKSFRESCTLTKHQRIHTGEKP-------------------------YCCSECGASFTQQSHLQQHQRVHTGQKPYQCLKCGKSFRKSGALETHQCIHTEEKTYCCSDCGQSFTTSSVLDKH 407          
BLAST of Zinc finger protein 112-like vs. Ensembl Cavefish
Match: ENSAMXT00000039744.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001833.1:34030:37575:-1 gene:ENSAMXG00000036628.1 transcript:ENSAMXT00000039744.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 4.949e-13
Identity = 108/438 (24.66%), Postives = 170/438 (38.81%), Query Frame = 2
Query: 1571 ITELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHNILS----SKGRDRTITPRHLI------SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
             +E++   K ++C  C K+  +++  K+H   H G +   C DCG    +    SH+K H +       Y C  CG+    + N ++H  +H   K   C +C  SF     L     K H++I  G+  Y C  C K     S HL+ H+     E P  C  C +  +  S  K H R H        S    R     HL       +  + + C  C K+F  ++   +H   H      PY   +  +S    + H+   H  +H G   Y +C +     +   ++ K        K YYC  C   F  + +L KH       KP       K  +    +KK++      K   C  C +   + SH+K H   H   + Y C  C K F   + L  H+++H  +    CS C + FT    L  H ++
Sbjct:   14 FSEIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQ---SHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLKKHQHIHTGEKPYYCSDCGKSFTQQSHL-----KKHQRIHTGEKPYYCSDCGKRFTQQS-HLKKHQSIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKRFTQQSHLKIHQRIHTGEKPYYCSDCGKSFTEQSHLKKHQHIHTGEK--PYYCSDCGKSF-TQQSHLKK-HQRIHTGEKPY-YCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKRFTQQSDLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRI 437          

HSP 2 Score: 72.7886 bits (177), Expect = 1.698e-12
Identity = 104/435 (23.91%), Postives = 172/435 (39.54%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITP-----RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR-CSICYQFFTSHIRLMAHLKM 2749
            ++   K ++C  C K   ++ N ++H   H G +   C DCG    +    SH+K H +       Y C  CG+    + + ++H  +H   K   C +C  SF     L     K H++I  G+  Y C  C K     SH L+ H+     E P  C  C +  +  S  K H   H        S  G+  T        +H+ +  + + C  C K+F  ++   +H   H      PY   +  +S    + H+   H  +H G   Y +C +     +   ++ K        K YYC  C   F  +  L KH       KP       K+ +    ++K++H     K   C  C +   + S++K H   H   + Y C+ C K+F   + L +H+++H       CS C + FT    L  H ++
Sbjct:  605 IHTGEKPYYCSDCGKRFTQQSNLRKHQHIHTGEKPYYCSDCGKSFTQQ---SHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYHCSDCGKSFTQQSHL-----KKHQRIHTGEKPYYCSDCGKSFTQQSH-LKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSALKKHQHIHTGEK--PYHCSDCGKSF-TQQSHLKK-HQRIHTGEKPY-YCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYCCSDCGKRFTQQSNLRKHQHIHTGEKPYCCSDCGKSFTQQSNLKKHQRIHTGEKPYHCLDCGKRFTAESHLKIHQRIHTGEKPYCCSDCGKSFTEQSTLKKHQRI 1025          

HSP 3 Score: 71.2478 bits (173), Expect = 4.006e-12
Identity = 110/457 (24.07%), Postives = 171/457 (37.42%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARH-----------------------ITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITP-----RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            ++   K + C  C K+  +++  K+H   H G +   C DCG    +    SH+K H +       Y C  CG+    + N ++H  +H   K   C +C  SF     L +H                         K H+ I  G+  Y C  C K     SH   H R H  E P  C  C +  +  S  K H R H        S  G+  T        +H+ +  + + C  C K+F  ++   +H + H      PY   +  +S    + H+   H  +H G   Y  C +     +   ++ K        K YYC  C   F  +  L KH +     KP       K  +    +KK++H     K   C  C +   + SH+K H   H   + Y C  C K F   ++L  H+ +H  +    CS C + FT    L  H ++
Sbjct:  409 IHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQ---SHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKTFTEKSALKKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLRKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEK--PYYCSDCGKSF-TQQSHLKK-HQHIHTGEKPY-HCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSALKKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRI 857          

HSP 4 Score: 68.9366 bits (167), Expect = 2.229e-11
Identity = 113/451 (25.06%), Postives = 175/451 (38.80%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHN-----ILSSKGRDRTITP-----RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFT--SHIRLMAHLKMFHKMAFSISKSCSRC 2794
            ++   K + C  C K+  +++  K+H   H G +   C DCG    +    SH+K H +       Y C  CG+    + + ++H  +H   K   C +C  SF     L     K H++I  G+  Y C  C K     SH   H R H  E P  C  C +  +  S  K H R H        S  G+  T        + + +  + + C  C KTF  K+   +H   H      PY   +  +S    + H+   H  +H G   Y +C +     +   ++ K        K YYC  C   F  +  L KH +     KP       K  +    +KK++      K   C  C +   + SH+K H   H   + Y C  C K F   + L  H+++H  +    CS C + FT  SH++   H+    K  +     CS C
Sbjct:  325 IHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQ---SHLKKHQRIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYHCSDCGKSFTQQSHL-----KKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKTFTEKSALKKHQHIHTGEK--PYHCSDCGKSF-TQQSHLKK-HQRIHTGEKPY-YCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKRFTQQSNLRKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYY-----CSDC 757          

HSP 5 Score: 60.077 bits (144), Expect = 1.205e-8
Identity = 104/435 (23.91%), Postives = 166/435 (38.16%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHNI-----LSSKGRDRTITP-----RHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH-EKSSQRCSICYQFFTSHIRLMAHLKM 2749
            ++   K ++C  C K+  +++  K+H   H G +   C DCG    +    SH+K H +       Y C  CG+    + + ++H  +H   K   C +C  SF     L     K H+ I  G+  Y C  C K     SH L+ H+     E P  C  C +  +  SA K H   H        S  G+  T        + + +  + + C  C K+F  ++   +H + H      PY   +  +S    + H+   H  +H G   Y  C +     +   N+ K        K Y C  C   F  +  L KH       KP       K+ +    +K ++      K   C  C +     S +K H   H   + Y C  C K F   +SL  H+++H  +    CS C + FT    L  H ++
Sbjct:  661 IHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYHCSDCGKSFTQQ---SHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSHL-----KKHQHIHTGEKPYYCSDCGKSFTQQSH-LKKHQHIHTGEKPYYCSDCGKSFTQQSALKKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEK--PYYCSDCGKSF-TQQSHLKK-HQRIHTGEKPY-CCSDCGKRFTQQSNLRKHQHIHTGEKPYCCSDCGKSFTQQSNLKKHQRIHTGEKPYHCLDCGKRFTAESHLKIHQRIHTGEKPYCCSDCGKSFTEQSTLKKHQRIHTGEKPYYCSDCGKSFTEQSSLKNHQRIHTGEKPYYCSDCGKSFTEQSTLKKHQRI 1081          

HSP 6 Score: 56.225 bits (134), Expect = 1.933e-7
Identity = 95/399 (23.81%), Postives = 147/399 (36.84%), Query Frame = 2
Query: 1580 LNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHF-------KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH 2671
            ++   K ++C  C K+  +++  K+H   H G +   C DCG    +    SH+K H         Y C  CG+    + + ++H  +H   K   C +C  SF     L     K H+ I  G+  Y C  C K     SH   H R H  E P  C  C +  +  S  K H R H                  +  + + C  C K+F  ++   +H + H   +  CC  C          LR+H       +H G   Y  C +     +   N+ K        K Y+C  C   F  +  L  H       KP       K  +    +KK++      K   C  C +     S +K+H   H   + Y C  C K F   ++L  H+++H
Sbjct:  717 IHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQ---SHLKKHQHIHTGEKPYYCSDCGKSFTQQSHLKKHQHIHTGEKPYYCSDCGKSFTQQSAL-----KKHQHIHTGEKPYHCSDCGKSFTQQSHLKKHQRIHTGEKPYYCSDCGKSFTQQSHLKKHQRIH------------------TGEKPYYCSDCGKSFTQQSHLKKHQRIHTGEKPYCCSDCG-KRFTQQSNLRKHQH-----IHTGEKPY-CCSDCGKSFTQQSNLKKHQRIHTGEKPYHCLDCGKRFTAESHLKIHQRIHTGEKPYCCSDCGKSFTEQSTLKKHQRIHTGEKPYYCSDCGKSFTEQSSLKNHQRIHTGEKPYYCSDCGKSFTEQSTLKKHQRIH 1082          
BLAST of Zinc finger protein 112-like vs. Ensembl Sea Lamprey
Match: prdm5 (PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040708-1])

HSP 1 Score: 62.003 bits (149), Expect = 2.423e-10
Identity = 62/254 (24.41%), Postives = 106/254 (41.73%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHF---KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARH-----------------ITKAHRQIEPGKYE--CPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA 2206
            CNK + +     + E   + + F C  C+K     N+ +RH +TH       C+ CG    + +++ SH   H     Y C++CG+  A +  ++ H   H + +   C EC A F+    L RH                 + K+H++   G+ E  CP+C +   +   +  H+R+H  E P QC+ C++  S     K HIR H                  ++ + + C  C K F+ K    +H + H 
Sbjct:  135 CNKKFSSSD--ILMEHRKVHEIFDCQDCDKKFISANQLRRHMITHSEKRPFSCEVCGKSFKRLDQVASHKVIHSVDKPYTCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQRHHKKYKCDLCDKAFVTPSVLKSHKKTHTGEKEKICPYCGQKFASNGTLRVHIRSHTGERPYQCQYCDKAFSKNDGLKMHIRTH------------------TREKPYQCSECNKAFSQKRGLDEHMRTHT 368          
BLAST of Zinc finger protein 112-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003208.1 (pep scaffold:Pmarinus_7.0:GL477029:150127:219242:1 gene:ENSPMAG00000002911.1 transcript:ENSPMAT00000003208.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 4.050e-10
Identity = 53/175 (30.29%), Postives = 78/175 (44.57%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEKR-HALTHLGNEK---CKDCGLVVNKNKIC-----SHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCK---KIVCAISHHLRTH-----EENPKQCERCNQVLSNYSAYKAHIRYHN 2068
            K + C  C K        R H L+H  N +   C+ CG    K         +H +S   Y C +CG+    + +  +H+ VH  A    C EC+ +F     L RH+ ++H   E   YEC FC    +   ++ H L TH      E P +C+ C+Q   +YSA   H+R HN
Sbjct:  424 KGYACDLCGKRFLDSLRLRMHLLSHSANGQSYSCEQCGAAFTKESSLEHHREAHRESGMAYFCLLCGKRLQTQSSLLQHMEVHAGAHEYVCGECNRTFPSHSTLKRHL-RSHTSGE-HPYECEFCGSCFRDEASLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHN 596          
BLAST of Zinc finger protein 112-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000782.1 (pep scaffold:Pmarinus_7.0:GL478091:36496:71460:1 gene:ENSPMAG00000000706.1 transcript:ENSPMAT00000000782.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 2.460e-9
Identity = 79/354 (22.32%), Postives = 135/354 (38.14%), Query Frame = 2
Query: 1748 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLR-----THEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLH---EGHTKYGFCDEIVTDVSDNINIYK----------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2740
            Y CE+C R     +  ++H+  H   K   C  C   F+      RH  + H   +P  Y C  C +     S++ R     +  E P  C  C Q  S  S+ K H                  RH+ +  + + C++C   F+++++   H + HA+    PY  +  L     +R      H  +H      T Y  C++     S + ++ +           K Y CE C   F   F L  H                + +K+++      +   C  C+R   R + +KSH   H   + ++C  C + F +P +L  H+ VH +  Q +C +C + F+    L  H
Sbjct:    3 YACELCRRRFTRHDYLQKHMRSHTGEKPYCCEVCGHGFKRCGNFKRH-QRMHTGEKP--YRCDLCGRRFSQCSNYKRHQCHHSAGEEPLSCSSCPQAFSQCSSLKDH------------------RHMHTGEKPYRCEVCDLHFSHRSILWSHRRTHAELQ--PY--VCELCQRRFVRSDYLQKHMCIHTYKRTVTPY-RCEQCGRGFSQSGSLERHRLREHLHTGEKPYRCEACGQAFMRAFSLKNH----------------LTLKRHQGIHTGERPYVCEVCNRSFARDTTLKSHRRVHTGEKPFRCEVCDRAFSHPTTLKNHQYVHMQGKQHQCDVCGKAFSRATTLRKH 314          
BLAST of Zinc finger protein 112-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008822.1 (pep scaffold:Pmarinus_7.0:GL477256:50027:56378:-1 gene:ENSPMAG00000007983.1 transcript:ENSPMAT00000008822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 2.278e-8
Identity = 86/383 (22.45%), Postives = 134/383 (34.99%), Query Frame = 2
Query: 1742 FKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYE-CPFCKKIVCAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH--------NILSSKGRDRTITPRH--LISKSECFSCQICQKTFNYKAMFTQHYKC--HAQFTCCP------------------YCPINSLE-----------SIPALREHISAVHFSLHEGHTKYG--FCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKS-HLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSS-QRCSICYQFFTSHIRLMAHLK 2746
             K+ C  CG+    + +   H  +H   K   C +CDASF     L  H+ K H   +P   E C  C +    ++ H R H +E P  C  C        + K H+R H        N+      +R   P H  L +    F C+ C K F  K    +H     + Q    P                  YC + +             ++   R+    VH + H G        C ++           K+  + CE+C   F +   L +H N    ++P K +   + F   +R+  L                SH+K+ H      YQC  C K+F  P+ L  H + H       C +C + F +   L  H +
Sbjct:    3 MKFECTTCGKTMTTRHSFNEHQRLHTGEKPYKCSQCDASFTIQTNLRTHMRK-HSGEKPFVCESCGQCFRNRSTLTVHRRRHTQERPYACTVCGARFRQSDSCKTHMRIHTGEKPFECNVCGKTFANRGNLPSHMRLHTGERLFQCEYCGKKFTLKGTMQKHVNSIHNPQNVVKPSSSSLGRRLVKVETVQEEYCGVTTSTLAGGCFECSACALQFSRQTEFVVHMAGHNGLEVLSCTVCKKLCVGQEALERHTKAHKHVCEICGKNFTSSNNLTQHMNLHLDVRPYKCQYCDVAF---HRNNSL---------------WSHIKARHNYGLPAYQCTHCNKRFATPSQLTHHLRYHTGERFHACELCGRMFVNRSGLQRHTR 366          

HSP 2 Score: 55.4546 bits (132), Expect = 2.863e-8
Identity = 50/171 (29.24%), Postives = 73/171 (42.69%), Query Frame = 2
Query: 1571 ITELNILIKTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCA---ISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIR 2059
            +T   +    F C  C     ++ E   H   H G E   C  C  L V +  +  H K+H K++CE+CG+      N  +H+++H   +   C  CD +F     L  HI   H    P  Y+C  C K       ++HHLR H  E    CE C ++  N S  + H R
Sbjct:  198 VTTSTLAGGCFECSACALQFSRQTEFVVHMAGHNGLEVLSCTVCKKLCVGQEALERHTKAH-KHVCEICGKNFTSSNNLTQHMNLHLDVRPYKCQYCDVAFHRNNSLWSHIKARHNYGLPA-YQCTHCNKRFATPSQLTHHLRYHTGERFHACELCGRMFVNRSGLQRHTR 366          
BLAST of Zinc finger protein 112-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.430e-8
Identity = 104/405 (25.68%), Postives = 147/405 (36.30%), Query Frame = 2
Query: 1595 KTFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPIN-SLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHL---SSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR---CSICYQFFTSHIRLMAHLK 2746
            + F C  C K  ++    K H   H G     CK+CG   +  + +  H K+H     +IC+ CGR  A K + + H  +H   K   C  C  SF     L  H  K H +  P  Y C  C K       +  H+RTH    P  C  C    S     KAH R H                  +    F C+IC K F  K+    H   H+  +   C +C    SL+S   L+ H                   EIV            K + C+ C   F     L     + HKL    +   I                 C  C R+  + S +K+H    +  + + C  C K+F  P+SL  H+Q+H  SS+R   C  C + F+ +  L  H K
Sbjct:  128 RPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAH-QKTHLKERP--YMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIH------------------TGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKS--TLKNH-------------------EIVHS--------GEKPFLCKECGKGFSQGSSL-----KNHKLTHDGEQPFI-----------------CQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMH--SSERPFICKECGKSFSYYSNLKVHQK 458          

HSP 2 Score: 53.9138 bits (128), Expect = 1.303e-7
Identity = 49/171 (28.65%), Postives = 74/171 (43.27%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGNEK--CKDCGLVVNKNKICSHMKSHF-------KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH 2065
            K F C  C K   + +  K H LTH G +   C++CG   ++    S +K+H         ++C  CG+  +F  + ++H  +H   +   C EC  SF Y   L  H  K H   +P  + C  C +      H   H RTH  E P +C+ C +  S     K H + H
Sbjct:  352 KPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQT---SSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVH-QKTHTGDKP--FTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKTH 516          

HSP 3 Score: 53.1434 bits (126), Expect = 2.022e-7
Identity = 90/386 (23.32%), Postives = 142/386 (36.79%), Query Frame = 2
Query: 1682 CKDCGLVVNKNK-ICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTHE-----ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINI-------YKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSHQI---YQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAH 2740
            C+ CG   +  + +  H+K+H +       +IC+ CG+  + K   + H   H   K   C +C   F     +     K HR    G+  Y C  C +     S  L+TH+     E P  C  C +     S  K H + H                  +    + C+ C K+F+Y +  T H K H      P+   +      A + H+   H  +H G   Y  C+      S N N+        K + Y CELC   F +K  L  H      +KP        K S    +K ++      +   C  C +   + S +K+H  +H +   + C  C K +   ++L  HE VH       C  C + F+    L  H
Sbjct:   16 CEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYM-----KVHRLTHTGERPYACQDCGQRFSQPS-SLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIH------------------TGERPYVCKECGKSFSYSSAMTVHQKTHTGEK--PFICKDCGRGF-AQKPHL-KTHQRIHTGEKPYA-CNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNH 372          
BLAST of Zinc finger protein 112-like vs. Ensembl Nematostella
Match: EDO48839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ4])

HSP 1 Score: 78.5666 bits (192), Expect = 5.680e-15
Identity = 109/466 (23.39%), Postives = 173/466 (37.12%), Query Frame = 2
Query: 1535 CNKTYDNRAKYT--ITELNILIKTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCGLVVNKN------------------KICS--------------HMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-----SKTYYCELCRIPFPNKFELNKHHNRRHKLKP----------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKM 2749
            C+K +  +AK        ++ +K F C  CNK    K +  +H  TH G +   CK CG +  ++                  K+C               H      Y CE+CGR  +   N  RH+  H+  K   C +C+ SF    +L RH+ K H   +P  Y C  C K     C +S H + H    P  C  C++  +      +H+R H                  +  + F C  C K F+ K   T H + H      PY      +S   + + +        E   K   C +        ++I+K      K + C  C   F  K +L++H       KP          R K SL I M+ +     N K+ SC  C +     + ++ H+  H   + Y+C  C K F    +  +H + H K    +C+ C + F+    L  H++ 
Sbjct:   81 CSKKFKTKAKVAEHTRRTHLKVKPFSCTYCNKKCASKSDLDKHERTHTGEKPYSCKYCGRMFGESSSLIMHQRIHTNEKPYKCKLCPKAFTSHSSLVMHNRHHSGDKPYKCEICGRAFSVSSNRARHMRSHKNIKPYSCSQCEWSFTTSSDLKRHL-KTHTGEKP--YRCEECDKAFSSSCGLSTHKKIHFNIKPHSCTVCHKRFATTGQVTSHMRTH------------------TGEQPFKCTYCDKAFSIKGNLTVHIRRHTNER--PYVCTTCGKSFTVISQLVMHNRSHTDERPYKCDICGKKFRQ-QGGLSIHKKIHTEEKPHECTQCEKAFITKAKLDRHFRTHSGEKPYRCEICEKSFRDKDSLNIHMRIHN----NDKRHSCSYCPKLFYTKTELRQHVRIHTGEKPYKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRT 518          

HSP 2 Score: 60.4622 bits (145), Expect = 2.428e-9
Identity = 48/176 (27.27%), Postives = 76/176 (43.18%), Query Frame = 2
Query: 1703 VNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2209
            + K K+  H ++H     Y CE+C +    K++   H+ +H   KR+ C  C   F    EL +H+ + H   +P  Y+CP+C K      +   H RTH +E P +C  C +  S  S  + H+R H  +                    F C IC+K F  +    +H K H +
Sbjct:  395 ITKAKLDRHFRTHSGEKPYRCEICEKSFRDKDSLNIHMRIHNNDKRHSCSYCPKLFYTKTELRQHV-RIHTGEKP--YKCPYCDKAFAVKGNCTVHARTHTKERPYKCTNCGRAFSCRSGLREHMRTHGGVKE------------------FICSICEKAFLRRGCLKKHEKLHVK 549          
BLAST of Zinc finger protein 112-like vs. Ensembl Nematostella
Match: EDO35006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP5])

HSP 1 Score: 73.9442 bits (180), Expect = 7.692e-14
Identity = 82/307 (26.71%), Postives = 132/307 (43.00%), Query Frame = 2
Query: 1607 CVTCNKTVRK-RNEKRHALTHLGNEKCKDCG-LVVNKNKICSHMKSHFK-YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHN---ILSSKGRDRTITP---------RHLISKSEC--FSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY--GFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKH 2437
            C  C K+ +  R    H LTH+ ++KC  C  +  + +++  H   H   Y C  C +  A +   + H+ +H+      CP+CD +F +   L  H+ + H   +P  + C  C K       ++ HLRTH  E P QCE C+Q  ++ S  K H+R H        +  DRT +           H + K+E     C++C K+F    + T+H K H       C +C      ++P+      AVH   H G   Y   +C    +  S N+ ++       K Y C  C+I F    +L +H
Sbjct:  115 CNYCKKSFKGIRELSVHILTHMDSQKCNKCDKIFSSSSELVRHFHHHMDVYQCTKCDKTFARECELKMHLIMHDSKPTLTCPKCDKTFIHSHGLNLHL-RVHTGEKP--FTCKHCGKAFAHSGNLTVHLRTHTGEKPYQCEYCHQAFNHSSNLKNHMRLHTGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETPMHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFC--GKAFTVPSGL----AVHLRTHTGEKPYRCEYCSRAFSH-SSNLKVHVRTHTGEKPYNCPTCKITFARSSDLRRH 411          

HSP 2 Score: 53.1434 bits (126), Expect = 3.426e-7
Identity = 58/240 (24.17%), Postives = 94/240 (39.17%), Query Frame = 2
Query: 1598 TFFCVTCNKT-VRKRNEKRHALTHLGNEK--CKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARH-ITKAHRQIEPGKYECPFCKKI---VCAISHHLRTHEE-NPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHA--QFTCCPYCPINSLESIPALREHI 2275
            T  C  C+KT +       H   H G +   CK CG    +   +  H+++H     Y CE C +      N + H+ +H   K   C  CD +F     L  H I+ +  + E   + C  C K    +  ++ HL+TH +  P QC  C +  +  S    H+R H                  +  + + C+ C + F++ +    H + H   +   CP C I    S   LR H+
Sbjct:  192 TLTCPKCDKTFIHSHGLNLHLRVHTGEKPFTCKHCGKAFAHSGNLTVHLRTHTGEKPYQCEYCHQAFNHSSNLKNHMRLHTGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETPMHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFCGKAFTVPSGLAVHLRTH------------------TGEKPYRCEYCSRAFSHSSNLKVHVRTHTGEKPYNCPTCKITFARS-SDLRRHV 412          

HSP 3 Score: 51.2174 bits (121), Expect = 1.330e-6
Identity = 93/398 (23.37%), Postives = 142/398 (35.68%), Query Frame = 2
Query: 1679 KCKDCGLVV-NKNKICSHMKSH---FKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVC---AISHHLRTH-EENPKQCERCNQVLSNYSAYKAHIRYH----------NILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ--FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYG--FCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRH----------QKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            +C+ C  V  NK +   H++ H   FK+ C  C        +   H++ H K+K   C +C+  F    +LA H+ + H  I+P  + C FC+       A+S H+  H  E   +C  C +          HI  H           I SS         RH     + + C  C KTF  +     H   H       CP C    + S      H   +H  +H G   +    C +     S N+ ++       K Y CE C   F +   L  H       KP K  +      +  H           K       C  C +    +  +  HL +H   + +QC  C K F  P+ L +H + H      RC  C + F+    L  H++
Sbjct:    2 QCQHCDKVCSNKRQYVKHLRYHQKSFKHKCPCCPEKFNDPSSLALHVACHVKSKGFLCGQCNKCFTSDRQLAEHMVQ-HSGIKP--FICHFCRSGFTHSLALSRHVILHLNEQSCRCNYCKKSFKGIRELSVHILTHMDSQKCNKCDKIFSSSSE----LVRHFHHHMDVYQCTKCDKTFARECELKMHLIMHDSKPTLTCPKCDKTFIHS------HGLNLHLRVHTGEKPFTCKHCGKAFAH-SGNLTVHLRTHTGEKPYQCEYCHQAFNHSSNLKNHMRLHTGEKPYKCRACDRTFSRSSHLRNHVISHSLGKTETPMHRCEVCDKSFPELDLLTEHLKTHNDMRPHQCRFCGKAFTVPSGLAVHLRTHTGEKPYRCEYCSRAFSHSSNLKVHVR 385          
BLAST of Zinc finger protein 112-like vs. Ensembl Nematostella
Match: EDO41082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5G4])

HSP 1 Score: 73.559 bits (179), Expect = 1.287e-13
Identity = 99/423 (23.40%), Postives = 159/423 (37.59%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNEKR-HALTHLGNEKCKDCGLVVNKNKICSHMKSH-FKY------ICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHN----------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAV-HFSLHEGHTKY--GFCDEIVTDVSDNINIY-----KSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-----RISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFH 2755
            K + C TC+K   +R+    H   H G E+  +C     +    SH   H FK+      +C++C +  +      RH+  H   K   C +C+ +F Y   L +H    HR ++P  YEC  C +       +  H RTH  E P +C  C+ + S       H+R H             +    D   +   L +    + C+IC K F   +  + H   H+        P   L      R   + + H   H G   +    C ++    SDN++ +       K Y C++C   F     L  H  R   +KP K                      C  C ++      R  HM++H +  + Y C  C++ F    SL  H+ +H  +   +C  C + F S   L  H+K+ H
Sbjct:   25 KPYSCRTCDKEFTRRDALTCHIRIHTG-ERPYECRYCDKRFSQPSHRVQHEFKHSGERSHMCDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDRVYHRGVKP--YECDICGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSAAFSVSDTLKSHLRLHTGERPYKCEICNKGFVQSSALSSHLLTHSGKR-----PYECLTCGQTFRSRSNLLYHERRHRGEAPFECQTCGKVFVR-SDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRHDGIKPYK----------------------CERCDKRFTSSNERTRHMRTH-TGDKPYTCDICKENFMYTTSLARHKLIHSGAKPFKCDTCEKAFRSSSELTRHVKLVH 415          

HSP 2 Score: 50.447 bits (119), Expect = 2.696e-6
Identity = 96/401 (23.94%), Postives = 141/401 (35.16%), Query Frame = 2
Query: 1754 CEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHL---------RTH-----------------------EENPKQCERCNQVLSNYSAYKAHIR-YH--------NILSSKGRDRTITPRH--LISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKY-------GFCDEIVTDVSDNINIYKSK-TYYCELCRIPFPNKFELNKHHNRRHKLKPRK-KTSLIIFMKKYRHQK-----LNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMA 2764
            C  C R    K +  +H  VH   K   C  CD  F     L  HI + H    P  YEC +C K     SH +         R+H                       ++ P  C +CN+  +  ++   H R YH        +I      DR+   +H    +    F C  C   F+ K + T+H + H       C YC   +      L+ H+      LH G   Y       GF     + +S ++  +  K  Y C  C   F ++  L  H  R     P + +T   +F++     K        K   C  C R     S +KSH   H   + Y+C +C K+F + N    H + H       C IC + F     L  H K+ H  A
Sbjct:    1 CSECSRAFKNKSDLVKHKRVHCDDKPYSCRTCDKEFTRRDALTCHI-RIHTGERP--YECRYCDKRFSQPSHRVQHEFKHSGERSHMCDICSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDRVYHRGVKPYECDICGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSA-AFSVSDTLKSHL-----RLHTGERPYKCEICNKGFVQS--SALSSHLLTHSGKRPYECLTCGQTFRSRSNLLYHERRHRGEAPFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRHDGIKPYKCERCDKRFTSSNERTRHMRTHTGDKPYTCDICKENFMYTTSLARH-KLIHSGA 389          
BLAST of Zinc finger protein 112-like vs. Ensembl Nematostella
Match: EDO31838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWT3])

HSP 1 Score: 70.4774 bits (171), Expect = 1.538e-12
Identity = 105/429 (24.48%), Postives = 165/429 (38.46%), Query Frame = 2
Query: 1595 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK---IVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDR--------TITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHIS-AVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRK----------KTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-HMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHLKMFH 2755
            K + C  C K   R    K H + H G +  KC +CG    ++   +H++ H     Y C+ CG+  +     +RH+ +H   K + C +C   F    +L  H+ + H   +P  YEC  C K   +   +  HLR H  + P +C+ C +  +     K H+  H+       D             RHL   +  + + C  C K F       +H K H+        P    E   +  EH     H  +H G   Y     G C   +  +  ++ I+   K Y C+ C   F     L +H       KP K            +L   +  +  QK  +K   C  C +    S H+K HL  H   + Y+C +C K F     L  H ++H  +   +C +C + F+    L  HL M H
Sbjct:    7 KRYNCDECGKCFTRHAQLKEHLVIHSGKKPYKCDECGKCFTQHAN-THLRIHSGKKPYKCDECGKCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTRSGDLKTHL-RIHTGEKP--YECDDCGKRFTLSGNMKTHLRIHSGKKPYKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKK-----PYKCDECGKSFTEHAYLKTHLIIHSGKKPYKCDECGKCFTELETLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIHSGQKPYKCDVCGKCFTRSGALTTHLMIHSGQK-PYKPHKCDECGKCFNQSGHLKRHLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHL-MIH 424          

HSP 2 Score: 60.077 bits (144), Expect = 2.616e-9
Identity = 92/385 (23.90%), Postives = 141/385 (36.62%), Query Frame = 2
Query: 1595 KTFFCVTCNKT-VRKRNEKRHALTHLGNE--KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTH-----EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALRE--HISAVHFSLHEGHTKY--GFCDEIVT---DVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-HMKSHL---SSHQIYQCIKCQKKFFNPNSLVLHEQVHEK 2677
            K + C  C K      N K H + H G +  KC +CG        +  H++ H     Y C+ CG+      N ++H+ +H   K   C EC  SF     L  H+   H   +P  Y+C  C K    +   L+TH      E P +C+ C +  +     K H+  H                  S  + + C +C K F      T H   H+     PY P    E      +  H+   H  +H G   Y  G C +  T    +  ++ I+   K Y C++C   F     L +H              L+I   +        K   C  C +    S ++K HL   S  + Y+C +C K F    +L  H  +H +
Sbjct:  145 KPYKCDECGKCFTESGNLKTHLMIHSGEKPYKCDECGKCFTQSGDLKRHLRIHTGEKPYECDDCGKRFTLSGNMKKHLKIHSGKKPYKCDECGKSFTEHAYLKTHLI-IHSGKKP--YKCDECGKCFTELE-TLKTHLMIHSGEKPYKCDECGKCFTQSGNLKRHLMIH------------------SGQKPYKCDVCGKCFTRSGALTTHLMIHSGQK--PYKPHKCDECGKCFNQSGHLKR-HLKIHTGQKPYECGECSKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRH--------------LMIHSGQ--------KPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLSIHSR 482          
BLAST of Zinc finger protein 112-like vs. Ensembl Nematostella
Match: EDO26879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAT8])

HSP 1 Score: 69.3218 bits (168), Expect = 2.293e-12
Identity = 95/377 (25.20%), Postives = 143/377 (37.93%), Query Frame = 2
Query: 1679 KCKDCG-LVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK--YECPFCKKIVCAISHHLRTH-----EENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKY-----GFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRIS-HMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHE-KSSQRCSICYQFFTSHIRLMAHL 2743
            KC +CG        + +H++ H K   Y CEVCG+    K + + H+ VH   K   C EC   F     L     KAH  I  GK  Y+C  C K    +S  L+TH      E P +C+ C +  +   A K H+R H                  +  + + C  C   F+  A    H   H+     PY   +       L   +   H  +H G   Y     G C      +  ++ I+   K Y C+ C   F    +L +H              L+I   +  H+        C  C ++   S  +K+HL  H   + Y+C  C K+F    ++  H ++H  K   +C  C + FT H  L  HL
Sbjct:   60 KCDECGKCFTQSGTLKTHLRIHTKVKPYECEVCGKCFTRKTHLKTHLMVHSGQKPYKCDECGKCFTQHAHL-----KAHLVIHSGKKPYKCDECGKCF-TLSGDLKTHLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIH------------------TGKKPYKCDECGNCFSESAHLKAHLVIHSGEK--PY-KCDDCGKCFTLSGDLK-THLVIHSGEKPYECDDCGKCFTQSGAMKRHLRIHTGKKPYKCDECGNCFSESGKLKRH--------------LVIHTGEKPHK--------CDDCGKRFTQSGDLKTHLRIHTGEKPYECDDCGKRFTLSGNMKKHVKIHSGKKPYKCDECGKSFTEHAYLKTHL 386          
BLAST of Zinc finger protein 112-like vs. Ensembl Medaka
Match: ENSORLT00000000322.2 (pep primary_assembly:ASM223467v1:2:5774736:5929187:1 gene:ENSORLG00000000262.2 transcript:ENSORLT00000000322.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 6.814e-17
Identity = 112/418 (26.79%), Postives = 169/418 (40.43%), Query Frame = 2
Query: 1595 KTFFCVTCNKTV-RKRNEKRHALTHLGNEK--CKDCGLVV-NKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGK-YECPFCKKIVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSHQIYQ---CIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSI 2773
            K F C  C+ +  R  + KRH  TH G +   CK+C     + + +  HM++H     + C+ C +      N +RH+  H   K   C ECD +F+YL  L RH+ K H + +P    EC  C   +  +  H+RTH  E P  C+ C++  S  S+ K H+R H            TP         FSC+ C K F Y      H + H     F+C  C     N  +    +R H     FS  E    +     + T +  +      K + C+ C   F     L  H       KP       K+ S +  +KK+       K  SC  C +   + S +K+H+  H+I +   C KC K F   +SL  H + H       C  C + F        H++   + AFS+
Sbjct:  195 KPFSCKECDNSFNRITHLKRHMRTHTGKKPFPCKECDKGFRDVSDLKRHMRTHTGEKPFYCKECDKSFCDGSNLKRHMRTHTGEKPFSCKECDKNFRYLSHLKRHM-KIHTREKPFSCEECDKCFIQIYDLKTHMRTHTGEKPFSCKECDKSFSYLSSLKTHMRTHT---------GETP---------FSCKECDKGFTYIYDLKVHMRTHTGEKPFSCGECGKRCSNLSDLKIHMRTHTGEKPFSCKECDKSFSCASNLTTHMRTHTG---EKPFSCKECDKSFTCLSNLTTHMRTHTGEKPFYCVECDKRFSHVSDLKKHMRTHTGEKPFSCKECKKYFNQTSSLKTHMRIHKIGKPLSCKKCDKSFSCVSSLKTHMRTHTGDKPFSCKECEKSFRFLSHFKRHMRTHRREAFSV 590          

HSP 2 Score: 75.485 bits (184), Expect = 1.467e-13
Identity = 86/358 (24.02%), Postives = 142/358 (39.66%), Query Frame = 2
Query: 1745 KYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI--------LSSKGRDRTITPRHLISKS--ECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            ++ C+ C +  +F  N ++HI  H + K   C ECD SF     L RH+ + H   +P  + C  C      I+H   H+RTH  + P  C+ C++   + S  K H+R H                D +   RH+ + +  + FSC+ C K F Y +   +H K H +   F+C  C  C I   +    +R H     FS  E    + +   + T +  +        + C+ C   F   ++L  H       KP                       SC  C ++   +S +K H+ +H   + + C +C K F   ++L  H + H       C  C + FT    L  H++
Sbjct:  140 RFSCKGCDKGFSFLSNLKKHIRTHTREKPFSCKECDKSFSQASNLQRHM-RTHTGEKP--FSCKECDNSFNRITHLKRHMRTHTGKKPFPCKECDKGFRDVSDLKRHMRTHTGEKPFYCKECDKSFCDGSNLKRHMRTHTGEKPFSCKECDKNFRYLSHLKRHMKIHTREKPFSCEECDKCFIQIYDLKTHMRTHTGEKPFSCKECDKSFSYLSSLKTHMRTHTG---ETPFSCKECDKGFTYIYDLKVHMRTHTGEKP----------------------FSCGECGKRCSNLSDLKIHMRTHTGEKPFSCKECDKSFSCASNLTTHMRTHTGEKPFSCKECDKSFTCLSNLTTHMR 469          
BLAST of Zinc finger protein 112-like vs. Ensembl Medaka
Match: ENSORLT00000038798.1 (pep primary_assembly:ASM223467v1:2:457216:544830:-1 gene:ENSORLG00000026852.1 transcript:ENSORLT00000038798.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 9.081e-17
Identity = 111/444 (25.00%), Postives = 179/444 (40.32%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTI-TELNILIKTFFCVTCNKTVRKR-NEKRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIV---CAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCC-------PYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            C+K++ N++++ I T ++   K F C  C K   +R + K H   H G +   CK+C    N   + SH+K H +       + C  C +      + + H+ +H   K   C EC  SF  +  L RH+ + H   +P  Y C  C        ++  H+RTH  E P  C+ CN+  S  S    H+R H                  +  + FSC+ C+K F  K+    H + H    C         +C I+    I  L+      H   H G   +  C E     S   ++ K        K + C+ C+  F     LNKH       +P      +K  S +  + K+       K  SC  C +   +ISH+K+H+ +H   + + C +C+K F   +SL  H + H       C  C + F+    L  H++
Sbjct:  220 CDKSFCNKSQFRIHTRIHAEDKRFTCKDCEKRFSRRFHLKTHMRIHTGEKPFSCKECKKSFN---VLSHLKQHMRTHTGEKPFSCNECRKSFNQLSHLKTHMRIHTGEKPFSCKECSKSFYEISNLKRHM-RTHTGEKP--YSCQECDSSFSDGSSLKTHVRTHTGERPFPCKECNKSFSRISHLYIHMRTH------------------TGEKPFSCKECKKKFTQKSSLKTHMRIHTGEKCYICKECGKSFCDISHFNYISHLK-----AHMRTHTGEKPFS-CKECKKSFSQVSSLNKHMRTHTGEKPFSCKECKKSFSQVSSLNKHMRTHTGERPFSCKECKKSFSQVSSLNKHMRTHTGEKPFSCKECKKSFSQISHLKTHMRTHTGEKPFSCKECKKSFSQVSSLNKHMRNHTGEKPFSCKECKKSFSQISHLQTHMR 633          

HSP 2 Score: 73.559 bits (179), Expect = 6.724e-13
Identity = 100/398 (25.13%), Postives = 157/398 (39.45%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTF------NYKAMFTQHYKCHAQFT--CCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH 2671
            K F C  C K+    +  K+H  TH G +   C +C    N+    SH+K+H +       + C+ C +      N +RH+  H   K   C ECD+SF     L  H+ + H    P  + C  C K    ISH   H+RTH  E P  C+ C +  +  S+ K H+R H                  +  +C+ C+ C K+F      NY +    H + H       C  C   S   + +L +H+       H G   +  C E     S   ++ K        + + C+ C+  F     LNKH       KP      +K  S I  +K +       K  SC  C +   ++S +  H+ +H   + + C +C+K F   + L  H + H
Sbjct:  269 KPFSCKECKKSFNVLSHLKQHMRTHTGEKPFSCNECRKSFNQ---LSHLKTHMRIHTGEKPFSCKECSKSFYEISNLKRHMRTHTGEKPYSCQECDSSFSDGSSLKTHV-RTHTGERP--FPCKECNKSFSRISHLYIHMRTHTGEKPFSCKECKKKFTQKSSLKTHMRIH------------------TGEKCYICKECGKSFCDISHFNYISHLKAHMRTHTGEKPFSCKECK-KSFSQVSSLNKHMRT-----HTGEKPFS-CKECKKSFSQVSSLNKHMRTHTGERPFSCKECKKSFSQVSSLNKHMRTHTGEKPFSCKECKKSFSQISHLKTHMRTHTGEKPFSCKECKKSFSQVSSLNKHMRNHTGEKPFSCKECKKSFSQISHLQTHMRTH 635          

HSP 3 Score: 55.8398 bits (133), Expect = 1.876e-7
Identity = 92/369 (24.93%), Postives = 143/369 (38.75%), Query Frame = 2
Query: 1748 YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNIL--------SSKGRDRTITPRHLI--SKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPIN-SLESIPAL----REHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELN-----KHHNRRH-KLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            YIC+ C +    K     H  +H + KR  C +C+  F     L  H+ + H   +P  + C  CKK    +SH   H+RTH  E P  C  C +  +  S  K H+R H           S    + +   RH+   +  + +SCQ C  +F+  +    H + H      P    N S   I  L    R H     FS  E   K+     + T +  +      K Y C+ C   F +    N     K H R H   KP      +K  S +  + K+       K  SC  C +   ++S +  H+ +H   + + C +C+K F   +SL  H + H       C  C + F+    L  H++
Sbjct:  215 YICKECDKSFCNKSQFRIHTRIHAEDKRFTCKDCEKRFSRRFHLKTHM-RIHTGEKP--FSCKECKKSFNVLSHLKQHMRTHTGEKPFSCNECRKSFNQLSHLKTHMRIHTGEKPFSCKECSKSFYEISNLKRHMRTHTGEKPYSCQECDSSFSDGSSLKTHVRTHTGERPFPCKECNKSFSRISHLYIHMRTHTGEKPFSCKECKKKFTQKSSLKTHMRIHTG---EKCYICKECGKSFCDISHFNYISHLKAHMRTHTGEKPFSCKECKKSFSQVSSLNKHMRTHTGEKPFSCKECKKSFSQVSSLNKHMRTHTGERPFSCKECKKSFSQVSSLNKHMRTHTGEKPFSCKECKKSFSQISHLKTHMR 577          

HSP 4 Score: 51.6026 bits (122), Expect = 4.108e-6
Identity = 54/197 (27.41%), Postives = 86/197 (43.65%), Query Frame = 2
Query: 1646 KRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHN------------ILSSKGRDRTITPRHLISKSECFSCQICQKTFNY 2170
            K H  TH G +   CK+C    ++ + +  HM++H     + C+ C +  +   +  +H+  H   +   C EC  SF  +  L +H+ + H   +P  + C  CKK    ISH   H+RTH  E P  C+ C +  S  S+   H+R H               S     +T    H   K   FSC+ C+K+F +
Sbjct:  461 KAHMRTHTGEKPFSCKECKKSFSQVSSLNKHMRTHTGEKPFSCKECKKSFSQVSSLNKHMRTHTGERPFSCKECKKSFSQVSSLNKHM-RTHTGEKP--FSCKECKKSFSQISHLKTHMRTHTGEKPFSCKECKKSFSQVSSLNKHMRNHTGEKPFSCKECKKSFSQISHLQTHMRTHTGEKP--FSCKECKKSFGH 652          
BLAST of Zinc finger protein 112-like vs. Ensembl Medaka
Match: ENSORLT00000028583.1 (pep primary_assembly:ASM223467v1:2:6354181:6394595:-1 gene:ENSORLG00000027186.1 transcript:ENSORLT00000028583.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 5.670e-16
Identity = 113/436 (25.92%), Postives = 174/436 (39.91%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVN-KNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKK---IVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGF--------CDEIVTDVSDNINIY-KSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRC 2794
            K F CV CNK     ++ K+H  TH G +   CK+C    +  + + +HM+ H     + C  CG+I +   N   H+ +H   K   C ECD  F ++ +L +HI + H    P  + C  CKK      ++  H+R H  E P  C+ C++  S  S  K H+R H                  +  + FSC+ C K F+  +   +H + H     F+C  C  C      S+  L++H+          H++           CD+     SD   I  + K   C+ C   F +   L  H       KP       K  S I  +K +       +  SC  C R    IS +KSH+ +H   + + C  C K F   +SL  H + H       C  C++ F+    L AH +          K C +C
Sbjct:  100 KHFSCVECNKGFSHVSDLKKHIRTHTGEKPFSCKECDKRFSCGSNLTTHMRIHTGEKPFSCTECGKIFSCLSNLITHMRIHTGEKPFSCKECDRRFSHVSDLKKHI-RTHTGERP--FSCKECKKQFSQTSSLQRHMRIHTGEKPFSCKECDKSFSCLSTLKKHVRTH------------------TGEKPFSCKECVKRFSSVSNLKKHMRTHTGEKPFSCKECVKC----FSSVSNLKKHMRT--------HSRKSLMTIFLCKVCDKSFILSSDMEKIMDRKKRLSCKECDKSFSHISNLKTHMRTHTGEKPFSCKECDKGFSHISNLKTHMRTHTGERPFSCKECDRSFSHISDLKSHMRTHTGEKPFSCSVCDKSFGQISSLQKHRRTHTGEKPFSCIYCHKSFSDISNLKAHARTHTGEKPFSCKECDKC 502          

HSP 2 Score: 61.6178 bits (148), Expect = 2.757e-9
Identity = 56/217 (25.81%), Postives = 94/217 (43.32%), Query Frame = 2
Query: 1589 LIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFT 2215
            L+  F C  C+K+    ++    +       CK+C    +  + + +HM++H     + C+ C +  +   N + H+  H   +   C ECD SF ++ +L  H+ + H   +P  + C  C K    IS    H RTH  E P  C  C++  S+ S  KAH R H                  +  + FSC+ C K FN+ +   +H + H + T
Sbjct:  325 LMTIFLCKVCDKSFILSSDMEKIMDRKKRLSCKECDKSFSHISNLKTHMRTHTGEKPFSCKECDKGFSHISNLKTHMRTHTGERPFSCKECDRSFSHISDLKSHM-RTHTGEKP--FSCSVCDKSFGQISSLQKHRRTHTGEKPFSCIYCHKSFSDISNLKAHARTH------------------TGEKPFSCKECDKCFNHMSHLRRHMRTHTRTT 520          

HSP 3 Score: 58.5362 bits (140), Expect = 2.553e-8
Identity = 92/360 (25.56%), Postives = 153/360 (42.50%), Query Frame = 2
Query: 1802 HISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFC-KKIVCA--ISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTITPRHLISK-------SECFSCQICQKTFNYKAMFTQHYKCHAQ---FTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYK-------SKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIF--------------MKKYRHQKLNFKKVSCFACSRKIR-ISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQR---CSICYQFFTSHIRLMAHLK 2746
            H+  H   K   C EC+  F ++ +L +HI + H   +P  + C  C K+  C   ++ H+R H  E P  C  C ++ S  S    H+R H      S K  DR  +    + K          FSC+ C+K F+  +   +H + H     F+ C  C   S   +  L++H+       H G   +  C E V   S   N+ K        K + C+ C   F +   L K H R H     +K+ + IF              M+K   +K   K++SC  C +    IS++K+H+ +H   + + C +C K F + ++L  H + H  + +R   C  C + F+    L +H++
Sbjct:   92 HLRSHTGEKHFSCVECNKGFSHVSDLKKHI-RTHTGEKP--FSCKECDKRFSCGSNLTTHMRIHTGEKPFSCTECGKIFSCLSNLITHMRIHTGEKPFSCKECDRRFSHVSDLKKHIRTHTGERPFSCKECKKQFSQTSSLQRHMRIHTGEKPFS-CKECD-KSFSCLSTLKKHVRT-----HTGEKPFS-CKECVKRFSSVSNLKKHMRTHTGEKPFSCKECVKCFSSVSNLKK-HMRTHS----RKSLMTIFLCKVCDKSFILSSDMEKIMDRK---KRLSCKECDKSFSHISNLKTHMRTHTGEKPFSCKECDKGFSHISNLKTHMRTH--TGERPFSCKECDRSFSHISDLKSHMR 430          
BLAST of Zinc finger protein 112-like vs. Ensembl Medaka
Match: ENSORLT00000042635.1 (pep primary_assembly:ASM223467v1:2:11817338:11931414:1 gene:ENSORLG00000027982.1 transcript:ENSORLT00000042635.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 5.791e-16
Identity = 103/395 (26.08%), Postives = 153/395 (38.73%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGN-----EKCKDCGLVVNKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHI-TKAHRQIEPGKYECPFCKKIVCAISH---HLRTH-EENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTITPRHLI-------SKSECFSCQICQKTFNYKAMFTQHYKCHAQFT--CCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRI-SHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH 2671
            K F C+ C+K+    +  K H  TH G      E+C  C   V+  KI  HM++H     + C+ C R  +   + + H+  H   +   C ECD  F  L  L  HI T     +    Y+C  C K     SH   H+RTH   NP  CE C+   S  S  KAH+R H      S K  D + +  H +       +  + FSC+ C+  F   +    H + H       C  C   S   I  LR H+       H G                       K + C++C I F + + L  H       KP          S +  +K +       K  SC  C +   + SH+K H+ +H   +++ C +C + F   +SL  H + H
Sbjct:  190 KPFACLECDKSYGDASTLKYHMTTHTGEKPFSCEECDACFSRVSGLKI--HMRTHTGEKPFSCKECDRSFSHVFSLKIHMRTHTGERPFSCKECDKRFSQLSTLKNHIRTHTGENLIKKPYDCKECGKSFSWWSHFRVHMRTHIGNNPFSCEECDTSFSRLSHLKAHMRTHTGEKPFSCKECDTSFSDMHNLKAHMRIHTGEKPFSCEKCETRFRRLSHLKAHMRTHTGEKPFLCKECD-KSFGQIFGLRRHMRT-----HTG----------------------EKPFSCKVCDIGFSDLYNLKAHMRTHTGEKPYSCEECDTSFSRLFHLKTHMRTHTGDKPFSCKECDKSYYVKSHLKRHIRTHTGEKVFSCKECDRGFSQMSSLKRHMKAH 554          

HSP 2 Score: 69.707 bits (169), Expect = 8.553e-12
Identity = 95/391 (24.30%), Postives = 145/391 (37.08%), Query Frame = 2
Query: 1682 CKDCGLVVNKNKICSHMKSHFK------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKI---VCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTITPRHLIS---------KSECFSCQICQKTFNYKAMFTQHYKCHAQFTCC--PYCPINSLESIPA-------LREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVHEKSSQ-RCSICYQFFTSHIRLMAHLK 2746
            C++CG      +  +H+K+H +      + C  C +    K   ERH+  H   K   C ECD  F  +  L RH+ + H   +P  + C  C K       + +H+ TH  E P  CE C+   S  S  K H+R H      S K  DR+ +  H+ S             FSC+ C K F+  +    H + H        PY      +S          +R HI    FS  E  T +     +   +  +      K + C+ C   F +   L  H       KP                       SC  C  +  R+SH+K+H+ +H   + + C +C K F     L  H + H       C +C   F+    L AH++
Sbjct:  111 CEECGESF---RWWTHLKTHMRTHSGELFSCTECDKSFCAKSYLERHMRSHTGEKLFSCKECDKGFGQISHLKRHM-RTHTGEKP--FACLECDKSYGDASTLKYHMTTHTGEKPFSCEECDACFSRVSGLKIHMRTHTGEKPFSCKECDRSFS--HVFSLKIHMRTHTGERPFSCKECDKRFSQLSTLKNHIRTHTGENLIKKPYDCKECGKSFSWWSHFRVHMRTHIGNNPFSCEECDTSFSRLSHLKAHMRTHTG---EKPFSCKECDTSFSDMHNLKAHMRIHTGEKP----------------------FSCEKCETRFRRLSHLKAHMRTHTGEKPFLCKECDKSFGQIFGLRRHMRTHTGEKPFSCKVCDIGFSDLYNLKAHMR 468          

HSP 3 Score: 53.5286 bits (127), Expect = 9.364e-7
Identity = 64/246 (26.02%), Postives = 105/246 (42.68%), Query Frame = 2
Query: 1535 CNKTYDNRAKYTI-TELNILIKTFFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVV-NKNKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCK---KIVCAISHHLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNI---LSSKGRDRTI-----TPRHLISKS--ECFSCQICQKTFNYKAMFTQHYKCHA 2206
            C K++   + + +    +I    F C  C+ +  R  + K H  TH G +   CK+C     + + + +HM+ H     + CE C        + + H+  H   K   C ECD SF  +  L RH+ + H   +P  + C  C      +  +  H+RTH  E P  CE C+   S     K H+R H      S K  D++        RH+ + +  + FSC+ C + F+  +   +H K H 
Sbjct:  313 CGKSFSWWSHFRVHMRTHIGNNPFSCEECDTSFSRLSHLKAHMRTHTGEKPFSCKECDTSFSDMHNLKAHMRIHTGEKPFSCEKCETRFRRLSHLKAHMRTHTGEKPFLCKECDKSFGQIFGLRRHM-RTHTGEKP--FSCKVCDIGFSDLYNLKAHMRTHTGEKPYSCEECDTSFSRLFHLKTHMRTHTGDKPFSCKECDKSYYVKSHLKRHIRTHTGEKVFSCKECDRGFSQMSSLKRHMKAHT 555          
BLAST of Zinc finger protein 112-like vs. Ensembl Medaka
Match: ENSORLT00000017686.2 (pep primary_assembly:ASM223467v1:3:9540654:9578150:1 gene:ENSORLG00000023806.1 transcript:ENSORLT00000017686.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 1.155e-15
Identity = 91/343 (26.53%), Postives = 150/343 (43.73%), Query Frame = 2
Query: 1565 YTITELNILIKT------FFCVTCNKTV-RKRNEKRHALTHLGNE--KCKDCGLVVNK-NKICSHMKSHFK---YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHI-----------------------TKAHRQIEPGK--YECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--C--PYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKS-KTYYCELCRIPFPNKFELNKHHN 2443
            + ++++ IL++T      + C  C+K   R  N KRH  TH G +   CK+C    N+ + +  HM++H     YIC+ CG+    K     H  +H + +R  C EC+ SF Y+  L +H+                        K H +I  G+  + C  CKK    +SH   H+RTH  E P  C+ C +  S  S  + H+R H                  +  + FSC+ C K+F   +   +H + H     F+C  C   +C +++L+S   +R H     FS  E +    FCD  V+++  ++  +   K + C+ C+  F  K    +H N
Sbjct:   79 HQLSQVKILMRTHTENKPYSCKECDKGFSRISNLKRHMRTHTGEKPFSCKECEKSFNQISDLNRHMRTHTGERCYICKECGKSFCDKSLFRIHTRIHAEDERFSCKECEKSFNYISHLKQHMRTHTGEKPFSCKECNKSFSHASTLKTHMRIHTGEKPFSCKECKKSFSHVSHLKTHMRTHTGEKPFSCKECKKSFSRVSHLQTHMRTH------------------TGEKPFSCKECDKSFRDVSTLKKHMRTHTGEKPFSCKECNKSFCDVSNLKS--HMRTHTGEKPFSCKECN--KSFCD--VSNLKTHMRTHTGEKPFSCKECKKSFKGKMFTPRHTN 397          

HSP 2 Score: 63.1586 bits (152), Expect = 6.928e-10
Identity = 76/308 (24.68%), Postives = 125/308 (40.58%), Query Frame = 2
Query: 1805 ISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ---FTC--CPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKP------RKKTSLIIFMKKYRHQKLNFKKVSCFACSRKI-RISHMKSHLSSH---QIYQCIKCQKKFFNPNSLVLHEQVH 2671
            +  H + K   C ECD  F  +  L RH+ + H   +P  + C  C+K    IS    H+RTH  E    C+ C +   + S ++ H R H                  ++ E FSC+ C+K+FNY +   QH + H     F+C  C     ++      +R H     FS  E    +     + T +  +      K + C+ C+  F     L  H       KP       K    +  +KK+       K  SC  C++    +S++KSH+ +H   + + C +C K F + ++L  H + H
Sbjct:   88 MRTHTENKPYSCKECDKGFSRISNLKRHM-RTHTGEKP--FSCKECEKSFNQISDLNRHMRTHTGERCYICKECGKSFCDKSLFRIHTRIH------------------AEDERFSCKECEKSFNYISHLKQHMRTHTGEKPFSCKECNKSFSHASTLKTHMRIHTGEKPFSCKECKKSFSHVSHLKTHMRTHTG---EKPFSCKECKKSFSRVSHLQTHMRTHTGEKPFSCKECDKSFRDVSTLKKHMRTHTGEKPFSCKECNKSFCDVSNLKSHMRTHTGEKPFSCKECNKSFCDVSNLKTHMRTH 371          

HSP 3 Score: 62.003 bits (149), Expect = 1.293e-9
Identity = 60/219 (27.40%), Postives = 96/219 (43.84%), Query Frame = 2
Query: 1595 KTFFCVTCNKTVRKRNE-KRHALTHLGNE--KCKDCGLVVNKNKICSHMKSHFK-------YICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISH---HLRTHE-ENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQ 2209
            K F C  CNK+    +  K H   H G +   CK+C    +     SH+K+H +       + C+ C +  +   + + H+  H   K   C ECD SF+ +  L +H+ + H   +P  + C  C K  C +S+   H+RTH  E P  C+ CN+   + S  K H+R H                  +  + FSC+ C+K+F  K    +H   H +
Sbjct:  207 KPFSCKECNKSFSHASTLKTHMRIHTGEKPFSCKECKKSFSH---VSHLKTHMRTHTGEKPFSCKECKKSFSRVSHLQTHMRTHTGEKPFSCKECDKSFRDVSTLKKHM-RTHTGEKP--FSCKECNKSFCDVSNLKSHMRTHTGEKPFSCKECNKSFCDVSNLKTHMRTH------------------TGEKPFSCKECKKSFKGKMFTPRHTNTHCE 401          
BLAST of Zinc finger protein 112-like vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 884.404 bits (2284), Expect = 0.000e+0
Identity = 437/445 (98.20%), Postives = 440/445 (98.88%), Query Frame = 2
Query: 1475 LGNWLSNKSTCCISDCISHSCNKTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 2809
            L   ++NKSTCCISDCISHS NKTYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC
Sbjct:    9 LAYCMTNKSTCCISDCISHSFNKTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 453          
BLAST of Zinc finger protein 112-like vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 436/441 (98.87%), Postives = 439/441 (99.55%), Query Frame = 2
Query: 1487 LSNKSTCCISDCISHSCNKTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 2809
            ++NKSTCCISDCISHS NKTYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC
Sbjct:    1 MTNKSTCCISDCISHSFNKTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 441          
BLAST of Zinc finger protein 112-like vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 853.203 bits (2203), Expect = 0.000e+0
Identity = 420/424 (99.06%), Postives = 423/424 (99.76%), Query Frame = 2
Query: 1538 NKTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 2809
            ++TYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC
Sbjct:    7 SRTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 430          
BLAST of Zinc finger protein 112-like vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 845.884 bits (2184), Expect = 0.000e+0
Identity = 411/423 (97.16%), Postives = 417/423 (98.58%), Query Frame = 2
Query: 1538 NKTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEI 2806
            ++TYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISK  +   +E+
Sbjct:    7 SRTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKRPTEAMLEL 429          
BLAST of Zinc finger protein 112-like vs. Planmine SMEST
Match: SMESG000072474.1 (SMESG000072474.1)

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 411/441 (93.20%), Postives = 412/441 (93.42%), Query Frame = 2
Query: 1487 LSNKSTCCISDCISHSCNKTYDNRAKYTITELNILIKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVELARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 2809
            L NKSTCCISDCISHS NKTYDNRAKYTITELNIL+KTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYL                          IVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQ FTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC
Sbjct:   11 LFNKSTCCISDCISHSFNKTYDNRAKYTITELNILVKTFFCVTCNKTVRKRNEKRHALTHLGNEKCKDCGLVVNKNKICSHMKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYL------------------------NPIVCAISHHLRTHEENPKQCERCNQVLSNYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAMFTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCDEIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTSLIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKKFFNPNSLVLHEQVHEKSSQRCSICYQSFTSHIRLMAHLKMFHKMAFSISKSCSRCRIEIC 427          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein 112-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF5461.247e-1525.91zinc finger protein 546 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5461.247e-1525.91zinc finger protein 546 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5461.783e-1525.91zinc finger protein 546 [Source:HGNC Symbol;Acc:HG... [more]
ZNF5461.783e-1525.91zinc finger protein 546 [Source:HGNC Symbol;Acc:HG... [more]
ZNF8081.306e-1425.58zinc finger protein 808 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crol9.227e-1223.41gene:FBgn0020309 transcript:FBtr0335473[more]
crol2.205e-1023.31gene:FBgn0020309 transcript:FBtr0335474[more]
crol3.927e-1023.71gene:FBgn0020309 transcript:FBtr0080263[more]
Meics1.446e-924.56gene:FBgn0025874 transcript:FBtr0333030[more]
crol1.450e-922.61gene:FBgn0020309 transcript:FBtr0080260[more]
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drll.31.616e-1925.46draculin-like, tandem duplicate 3 [Source:ZFIN;Acc... [more]
znf11431.762e-1725.23zinc finger protein 1143 [Source:ZFIN;Acc:ZDB-GENE... [more]
znf10572.937e-1724.77zinc finger protein 1057 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:ch73-367f21.51.274e-1627.61si:ch73-367f21.5 [Source:ZFIN;Acc:ZDB-GENE-120214-... [more]
znf10282.634e-1624.15zinc finger protein 1028 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000031570.13.292e-1624.38gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
abraxas11.853e-1525.93abraxas 1, BRCA1 A complex subunit [Source:Xenbase... [more]
stk313.759e-1526.22serine/threonine kinase 31 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000036804.16.699e-1523.29pep primary_assembly:Xenopus_tropicalis_v9.1:9:757... [more]
stk316.845e-1524.54serine/threonine kinase 31 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp266.191e-1625.56zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:... [more]
Zfp281.608e-1524.93zinc finger protein 28 [Source:MGI Symbol;Acc:MGI:... [more]
Zfp7085.871e-1424.43zinc finger protein 708 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7086.195e-1424.43zinc finger protein 708 [Source:MGI Symbol;Acc:MGI... [more]
Zfp7087.344e-1424.43zinc finger protein 708 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Zinc finger protein 112-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P10076|ZFP26_MOUSE2.401e-1525.56Zinc finger protein 26 OS=Mus musculus OX=10090 GN... [more]
sp|Q86UE3|ZN546_HUMAN8.561e-1525.91Zinc finger protein 546 OS=Homo sapiens OX=9606 GN... [more]
sp|P10078|ZFP28_MOUSE1.125e-1424.93Zinc finger protein 28 OS=Mus musculus OX=10090 GN... [more]
sp|Q9N003|ZN425_MACFA3.100e-1426.51Zinc finger protein 425 (Fragment) OS=Macaca fasci... [more]
sp|Q4V348|Z658B_HUMAN3.553e-1425.61Zinc finger protein 658B OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Zinc finger protein 112-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2CME33.327e-1725.41Uncharacterized protein OS=Cyprinodon variegatus O... [more]
A0A5F9C3R04.710e-1727.29Uncharacterized protein OS=Oryctolagus cuniculus O... [more]
A0A3B4U1324.899e-1726.75Uncharacterized protein OS=Seriola dumerili OX=414... [more]
A0A096MF066.221e-1725.62Uncharacterized protein OS=Poecilia formosa OX=486... [more]
A0A3B3VYT71.308e-1626.90Uncharacterized protein OS=Poecilia latipinna OX=4... [more]
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000040057.14.759e-1525.28gastrula zinc finger protein XlCGF57.1-like [Sourc... [more]
ENSAMXT00000011094.21.050e-1426.06pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000039103.11.572e-1422.77pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000022193.22.500e-1325.97zinc finger protein 501-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000039744.14.949e-1324.66pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdm52.423e-1024.41PR domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000003208.14.050e-1030.29pep scaffold:Pmarinus_7.0:GL477029:150127:219242:1... [more]
ENSPMAT00000000782.12.460e-922.32pep scaffold:Pmarinus_7.0:GL478091:36496:71460:1 g... [more]
ENSPMAT00000008822.12.278e-822.45pep scaffold:Pmarinus_7.0:GL477256:50027:56378:-1 ... [more]
ENSPMAT00000002487.12.430e-825.68pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488395.680e-1523.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350067.692e-1426.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410821.287e-1323.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318381.538e-1224.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268792.293e-1225.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger protein 112-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000322.26.814e-1726.79pep primary_assembly:ASM223467v1:2:5774736:5929187... [more]
ENSORLT00000038798.19.081e-1725.00pep primary_assembly:ASM223467v1:2:457216:544830:-... [more]
ENSORLT00000028583.15.670e-1625.92pep primary_assembly:ASM223467v1:2:6354181:6394595... [more]
ENSORLT00000042635.15.791e-1626.08pep primary_assembly:ASM223467v1:2:11817338:119314... [more]
ENSORLT00000017686.21.155e-1526.53pep primary_assembly:ASM223467v1:3:9540654:9578150... [more]
back to top
BLAST of Zinc finger protein 112-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072474.10.000e+098.20SMESG000072474.1[more]
SMESG000072474.10.000e+098.87SMESG000072474.1[more]
SMESG000072474.10.000e+099.06SMESG000072474.1[more]
SMESG000072474.10.000e+097.16SMESG000072474.1[more]
SMESG000072474.10.000e+093.20SMESG000072474.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000245 ID=SMED30000245|Name=Zinc finger protein 112-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2854bp
TTATCTTTGAACATTTTTAAAATAAACATTCGATGGAAACTGGATTTCAA
GTCAGAAAAAGAAAATTTTCTGTATGCAGTCCTATAAATGTTAATAACAT
GAAACGTTTCAAATCCGAAAAACTTGATAATTTTCCAAAATCTGATATAA
AAAATGAATCAAAAGGTGATTTGGAAATAGTTAAATTTGATATTTCAAAA
TCAATGTTTAAAGCTGATCATATATTATGTGAAATTTGTAAAAAACAAGT
TAAAAGTATTTATTACAGAAGTCATTTATCCCAACATGATAAAACAGAAA
AGTGCGAGCATTGTTTGAAAACTTTCACGGCTATTGGTATTCAACGACAT
TCATGTACTATTTTCTATTGTGAAACTTGTGGAAAGAAATACACAATTAG
AAGTAAATTTGAGTCTCATTTAAGGCATCATGCTCGTATCGAAGAAAGAA
AATCCTTGGTTGGTGTCCTAATGCAATTTTTTCATTAATTCTCAAATTTT
ACTGCACTGCGTACTTCTGAAGTGCGCCGATTATGACGTGATGGTTAACA
TTCAAGTATAATTTATTGATAATTATAAATAATAGATTAATTTAATTATC
GGGTAGTAAATCATAAAATTAAGAATTACAAAGGGACAATTTGATTTATT
AAGTAGTTAGTTTATAAAATAAATTCAAATTAGAAGTTTTTACCCGCTTC
CATAATGTAATATGTGAAATTTTATGTTAACAGTCAAAATATGGGAGGGA
TAGTTATCCCATTTCTTTAAATCGGCCTGTTAAAAATAATTGGTGGTTAT
GATTTCCATTTGTGATTTAACAAATTAATTTCAAGTATAAAGTGTAAAAT
TTGACATTGGGAAACACAAGCCTGGACAATTTCAATTAAAACTTTACAAG
CGAGGAAGCACCAAGAATATACAAAAAAAGTGAGAATACTTTTATGGGGT
CAGCTCATGAATTTTATTTTAACTATCACATTGGCTTACTGCATGACGTA
AAATATTCACACAAATTTAGTTTAGGGCAGCGTTTCTAACCTTTTTGTTG
GTGACTCAAGATAAAAAGAATTAACCTCTTACACCGACCGCGACATGTTT
AAAAAGTGACGCTAAAAAATAACAGATTTTCATTGAATTTTCTCGCCAAC
CATTTTTCTTATATTATATTCATTTGAGTACAATTAAAGTTCGAATTCTC
GTCCCCTAATATCAGATAACCTCCTTTACTTATATATAATAAATGATTTA
AAATCAATATTTATGAAAATATTCGGTGAAAGTATTGCAAACCTTTTGTA
TAATATCCTTTATCTTAATTTCTTATATGTGAATTGTGTAAAAAATCAAT
ATATTTCACTGATATATTGTTTGAAATTTTCCAAAAAGATGTTATAAATT
TATTTATTAAATTACTATTAAATTTGGGCCTATAATATAATATTCATTAA
AAATTTTTTATGGATTTCTGATTTCTTGGAAATTGGTTAAGTAATAAAAG
TACATGTTGCATCAGCGATTGTATTAGCCATTCTTGTAACAAAACTTATG
ACAATAGAGCAAAATATACAATTACGGAGTTAAACATTTTAATCAAAACA
TTTTTCTGTGTAACTTGCAATAAAACCGTCAGGAAAAGGAATGAAAAACG
GCACGCATTGACACATCTCGGCAATGAAAAATGTAAAGACTGTGGACTGG
TAGTGAACAAAAACAAAATTTGCTCTCATATGAAAAGTCATTTTAAATAC
ATTTGTGAAGTTTGTGGGAGAATCGACGCGTTTAAAGAAAACCACGAAAG
GCATATTTCGGTCCATGAAAAGGCTAAACGGAACCCGTGTCCAGAATGTG
ACGCCTCCTTTCAATATCTAGTTGAGTTAGCCCGACATATTACAAAGGCA
CATCGACAAATAGAACCCGGTAAATATGAATGTCCATTCTGTAAAAAGAT
CGTGTGTGCTATAAGTCACCATTTGAGAACCCACGAAGAAAATCCTAAAC
AATGCGAAAGATGCAATCAAGTTTTATCCAATTATTCAGCATATAAGGCA
CATATAAGATATCATAATATTTTATCGAGTAAAGGTCGCGATAGAACTAT
AACTCCAAGGCATTTAATTTCTAAATCAGAATGTTTTTCATGTCAAATTT
GCCAGAAAACTTTCAATTATAAAGCAATGTTTACCCAGCATTATAAATGC
CACGCACAATTTACTTGTTGTCCATATTGTCCAATCAATTCGCTCGAATC
AATTCCAGCGCTCCGGGAGCATATTAGTGCCGTTCATTTCTCATTGCATG
AAGGTCATACTAAATATGGCTTTTGTGATGAAATTGTCACTGACGTTTCC
GATAATATAAATATTTACAAATCAAAAACCTACTATTGTGAACTGTGCAG
AATTCCATTCCCAAACAAATTTGAACTCAACAAGCATCACAACAGGCGTC
ACAAGTTGAAACCAAGAAAAAAGACTAGTTTAATTATATTCATGAAAAAA
TATCGTCATCAGAAATTGAATTTCAAAAAAGTTTCATGCTTTGCCTGCAG
CCGGAAAATTCGTATTTCCCACATGAAATCTCATCTCTCTTCTCATCAAA
TATATCAGTGCATAAAGTGCCAGAAGAAATTTTTTAATCCAAATTCACTT
GTATTACACGAGCAAGTCCATGAGAAAAGTTCACAGAGATGTTCTATTTG
TTATCAATTTTTCACAAGTCACATCAGATTAATGGCACATTTGAAAATGT
TTCATAAAATGGCTTTTTCAATTTCTAAAAGTTGTTCCAGGTGCAGAATT
GAAATTTGTTGATATATTTGTTTGAAATAAATTATTTTTTGATTTAAAAA
AAAA
back to top

protein sequence of SMED30000245-orf-1

>SMED30000245-orf-1 ID=SMED30000245-orf-1|Name=SMED30000245-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
METGFQVRKRKFSVCSPINVNNMKRFKSEKLDNFPKSDIKNESKGDLEIV
KFDISKSMFKADHILCEICKKQVKSIYYRSHLSQHDKTEKCEHCLKTFTA
IGIQRHSCTIFYCETCGKKYTIRSKFESHLRHHARIEERKSLVGVLMQFF
H*
back to top

protein sequence of SMED30000245-orf-2

>SMED30000245-orf-2 ID=SMED30000245-orf-2|Name=SMED30000245-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MKSHFKYICEVCGRIDAFKENHERHISVHEKAKRNPCPECDASFQYLVEL
ARHITKAHRQIEPGKYECPFCKKIVCAISHHLRTHEENPKQCERCNQVLS
NYSAYKAHIRYHNILSSKGRDRTITPRHLISKSECFSCQICQKTFNYKAM
FTQHYKCHAQFTCCPYCPINSLESIPALREHISAVHFSLHEGHTKYGFCD
EIVTDVSDNINIYKSKTYYCELCRIPFPNKFELNKHHNRRHKLKPRKKTS
LIIFMKKYRHQKLNFKKVSCFACSRKIRISHMKSHLSSHQIYQCIKCQKK
FFNPNSLVLHEQVHEKSSQRCSICYQFFTSHIRLMAHLKMFHKMAFSISK
SCSRCRIEIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
IPR013087Znf_C2H2_type
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 319..342
e-value: 2.9
score: 16.9
coord: 35..58
e-value: 0.37
score: 19.8
coord: 7..29
e-value: 4.8
score: 16.1
coord: 292..314
e-value: 0.0039
score: 26.4
coord: 268..289
e-value: 110.0
score: 4.2
coord: 218..241
e-value: 0.2
score: 20.7
coord: 66..85
e-value: 29.0
score: 9.2
coord: 136..158
e-value: 0.093
score: 21.8
coord: 90..112
e-value: 1.1
score: 18.3
coord: 162..186
e-value: 14.0
score: 11.9
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 218..241
e-value: 0.011
score: 16.1
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 321..342
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 138..158
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 220..241
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 294..314
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 92..112
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 37..58
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 35..63
score: 9.39
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 136..159
score: 10.097
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 7..34
score: 8.704
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 292..319
score: 10.741
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 3..62
e-value: 1.7E-9
score: 39.6
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 292..343
e-value: 9.3E-7
score: 31.0
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 63..120
e-value: 1.3E-5
score: 27.1
NoneNo IPR availablePFAMPF12874zf-metcoord: 136..156
e-value: 0.0048
score: 17.2
NoneNo IPR availablePANTHERPTHR24376:SF107coord: 6..112
NoneNo IPR availablePANTHERPTHR24376:SF107coord: 78..356
NoneNo IPR availablePANTHERPTHR24376FAMILY NOT NAMEDcoord: 6..112
NoneNo IPR availablePANTHERPTHR24376FAMILY NOT NAMEDcoord: 78..356
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 289..329
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 7..54