Complexin

Overview
NameComplexin
Smed IDSMED30000242
Length (bp)785
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Complexin (SMED30000242) t-SNE clustered cells

Violin plots show distribution of expression levels for Complexin (SMED30000242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Complexin (SMED30000242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Complexin (SMED30000242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000242SMESG000017115.1 SmedASXL_003695SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30000242SMESG000023815.1 SMESG000017115.1 dd_Smed_v6_4479_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30000242SMESG000017115.1 OX_Smed_1.0.15654ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30000242SMESG000023815.1 SMESG000017115.1 OX_Smed_1.0.22388ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30000242SMESG000023815.1 SMESG000017115.1 dd_Smed_v4_4479_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000242SMESG000023815.1 SMESG000017115.1 dd_Smed_v4_4479_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Complexin vs. Ensembl Human
Match: CPLX1 (complexin 1 [Source:HGNC Symbol;Acc:HGNC:2309])

HSP 1 Score: 51.9878 bits (123), Expect = 5.425e-8
Identity = 36/75 (48.00%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  192 FIAKQLVGKQLDSVKGALG-DKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            F+ KQ +G     +   LG D+E      KKE   E + AL++AE+ R  K+ KME ERE +RQGIRDKYG+KKK
Sbjct:    3 FVMKQALGGATKDMGKMLGGDEEKDPDAAKKE--EERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKK 75          
BLAST of Complexin vs. Ensembl Human
Match: CPLX2 (complexin 2 [Source:HGNC Symbol;Acc:HGNC:2310])

HSP 1 Score: 50.447 bits (119), Expect = 6.587e-8
Identity = 34/76 (44.74%), Postives = 48/76 (63.16%), Query Frame = 3
Query:  192 FIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEE 419
            F+ KQ +G     +   LG +E    + +K+ + E + AL++ E+ R  KH +ME ERE +RQ IRDKYGLKKKEE
Sbjct:    3 FVMKQALGGATKDMGKMLGGEEEKDPDAQKK-EEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEE 77          
BLAST of Complexin vs. Ensembl Human
Match: CPLX1 (complexin 1 [Source:HGNC Symbol;Acc:HGNC:2309])

HSP 1 Score: 48.521 bits (114), Expect = 5.377e-7
Identity = 31/56 (55.36%), Postives = 39/56 (69.64%), Query Frame = 3
Query:  246 GDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            GD+E      KKE   E + AL++AE+ R  K+ KME ERE +RQGIRDKYG+KKK
Sbjct:    7 GDEEKDPDAAKKE--EERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKK 60          
BLAST of Complexin vs. Ensembl Celegans
Match: cpx-1 (Putative complexin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM7])

HSP 1 Score: 97.0561 bits (240), Expect = 4.243e-25
Identity = 58/101 (57.43%), Postives = 66/101 (65.35%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEFGNPDGNRLGRKRKTP 485
            MA F+ KQ+VG QL  V G LG K+    + +   DPEV AA  E E+RR EKHRKME ERE MRQGIRDKY +KKKEE  AMD F      R+G  RKTP
Sbjct:    1 MAGFLMKQMVGNQLSEVTGGLGMKDDGGEKTETGEDPEVIAARLEQEERRKEKHRKMENEREKMRQGIRDKYAIKKKEEGVAMD-FTE---GRIGGPRKTP 97          
BLAST of Complexin vs. Ensembl Fly
Match: cpx (gene:FBgn0041605 transcript:FBtr0078901)

HSP 1 Score: 87.8113 bits (216), Expect = 1.867e-21
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAA---LKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEA--SAMDEFGNPDGNRLGRKRKTP 485
            MA+FIAKQ+VG QL +VKGA+G   G   ++K++ + E       +KEAEDRR EKHRKMEEERE MRQ IRDKY +KKKEE   +A  E  NP    L RK+KTP
Sbjct:    1 MAAFIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNP----LMRKKKTP 102          
BLAST of Complexin vs. Ensembl Fly
Match: cpx (gene:FBgn0041605 transcript:FBtr0301769)

HSP 1 Score: 87.8113 bits (216), Expect = 1.867e-21
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAA---LKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEA--SAMDEFGNPDGNRLGRKRKTP 485
            MA+FIAKQ+VG QL +VKGA+G   G   ++K++ + E       +KEAEDRR EKHRKMEEERE MRQ IRDKY +KKKEE   +A  E  NP    L RK+KTP
Sbjct:    1 MAAFIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNP----LMRKKKTP 102          
BLAST of Complexin vs. Ensembl Fly
Match: cpx (gene:FBgn0041605 transcript:FBtr0301771)

HSP 1 Score: 87.8113 bits (216), Expect = 1.867e-21
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAA---LKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEA--SAMDEFGNPDGNRLGRKRKTP 485
            MA+FIAKQ+VG QL +VKGA+G   G   ++K++ + E       +KEAEDRR EKHRKMEEERE MRQ IRDKY +KKKEE   +A  E  NP    L RK+KTP
Sbjct:    1 MAAFIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNP----LMRKKKTP 102          
BLAST of Complexin vs. Ensembl Fly
Match: cpx (gene:FBgn0041605 transcript:FBtr0078899)

HSP 1 Score: 87.8113 bits (216), Expect = 1.867e-21
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAA---LKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEA--SAMDEFGNPDGNRLGRKRKTP 485
            MA+FIAKQ+VG QL +VKGA+G   G   ++K++ + E       +KEAEDRR EKHRKMEEERE MRQ IRDKY +KKKEE   +A  E  NP    L RK+KTP
Sbjct:    1 MAAFIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNP----LMRKKKTP 102          
BLAST of Complexin vs. Ensembl Fly
Match: cpx (gene:FBgn0041605 transcript:FBtr0078898)

HSP 1 Score: 87.8113 bits (216), Expect = 1.867e-21
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAA---LKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEA--SAMDEFGNPDGNRLGRKRKTP 485
            MA+FIAKQ+VG QL +VKGA+G   G   ++K++ + E       +KEAEDRR EKHRKMEEERE MRQ IRDKY +KKKEE   +A  E  NP    L RK+KTP
Sbjct:    1 MAAFIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNP----LMRKKKTP 102          
BLAST of Complexin vs. Ensembl Zebrafish
Match: cplx2l (complexin 2, like [Source:ZFIN;Acc:ZDB-GENE-040718-160])

HSP 1 Score: 47.7506 bits (112), Expect = 1.055e-6
Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            +F+ K  +G     V   LG +E    E +KE + E + AL++ E+ R  KH KME ERE +RQGIRDKYG+KK+
Sbjct:    2 NFLLKAAMGGGPPDVGKMLGGEEDKDPEAEKEKEEERQEALRQEEEERKAKHAKMEAERENIRQGIRDKYGIKKR 76          
BLAST of Complexin vs. Ensembl Zebrafish
Match: cplx2l (complexin 2, like [Source:ZFIN;Acc:ZDB-GENE-040718-160])

HSP 1 Score: 47.7506 bits (112), Expect = 1.055e-6
Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            +F+ K  +G     V   LG +E    E +KE + E + AL++ E+ R  KH KME ERE +RQGIRDKYG+KK+
Sbjct:    2 NFLLKAAMGGGPPDVGKMLGGEEDKDPEAEKEKEEERQEALRQEEEERKAKHAKMEAERENIRQGIRDKYGIKKR 76          
BLAST of Complexin vs. Ensembl Zebrafish
Match: cplx2l (complexin 2, like [Source:ZFIN;Acc:ZDB-GENE-040718-160])

HSP 1 Score: 47.7506 bits (112), Expect = 1.055e-6
Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            +F+ K  +G     V   LG +E    E +KE + E + AL++ E+ R  KH KME ERE +RQGIRDKYG+KK+
Sbjct:    2 NFLLKAAMGGGPPDVGKMLGGEEDKDPEAEKEKEEERQEALRQEEEERKAKHAKMEAERENIRQGIRDKYGIKKR 76          
BLAST of Complexin vs. Ensembl Zebrafish
Match: cplx2l (complexin 2, like [Source:ZFIN;Acc:ZDB-GENE-040718-160])

HSP 1 Score: 47.7506 bits (112), Expect = 1.055e-6
Identity = 34/75 (45.33%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            +F+ K  +G     V   LG +E    E +KE + E + AL++ E+ R  KH KME ERE +RQGIRDKYG+KK+
Sbjct:    2 NFLLKAAMGGGPPDVGKMLGGEEDKDPEAEKEKEEERQEALRQEEEERKAKHAKMEAERENIRQGIRDKYGIKKR 76          
BLAST of Complexin vs. Ensembl Zebrafish
Match: cplx2 (complexin 2 [Source:ZFIN;Acc:ZDB-GENE-081113-1])

HSP 1 Score: 46.9802 bits (110), Expect = 1.948e-6
Identity = 47/140 (33.57%), Postives = 72/140 (51.43%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVE-------AALKEAEDRRLEKHRKMEEERETMRQGIRDKYGL---KKKEEASAMDEFGNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANK 578
            +F+ KQ +G     +   LG +E        E DP+ E        AL++ E+ R  K+ KME ERE++RQGIRDKYG+   ++KE  +A       +G+    K+  PA    D    E   D+++ FLP  +++M NK
Sbjct:    2 NFVMKQALGGATKDMGKMLGGEE--------EKDPDAERKEEERQEALRQQEEERKAKYAKMEAERESVRQGIRDKYGIKKKEEKEAEAAAALEQAAEGSLTRPKKAIPAGCGDDEEEEESIVDTVMKFLPGPLQDMFNK 133          
BLAST of Complexin vs. Ensembl Xenopus
Match: cplx1 (complexin 1 [Source:NCBI gene;Acc:100124828])

HSP 1 Score: 52.373 bits (124), Expect = 3.347e-8
Identity = 31/71 (43.66%), Postives = 44/71 (61.97%), Query Frame = 3
Query:  192 FIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGL 404
            F+ KQ +G     +   LG  E    + +K+++ E + AL++ ED R  K+ KME ERE MRQGIRDKYG+
Sbjct:    3 FVMKQALGGATKDMGKMLGGDEEKDPDAQKKME-EAQEALRQQEDERKAKYAKMEAEREIMRQGIRDKYGI 72          
BLAST of Complexin vs. Ensembl Xenopus
Match: c18orf54 (chromosome 18 open reading frame 54 [Source:Xenbase;Acc:XB-GENE-1015211])

HSP 1 Score: 46.9802 bits (110), Expect = 3.151e-6
Identity = 30/71 (42.25%), Postives = 43/71 (60.56%), Query Frame = 3
Query:  192 FIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGL 404
            F+ KQ +G     +   LG +E    + +K+ + E + AL++ ED R  KH +ME ERE +RQ IRDKYGL
Sbjct:    3 FVMKQALGGATKDMGKMLGGEEEKDPDAQKK-EEERQEALRQQEDERKAKHARMEAEREKIRQQIRDKYGL 72          
BLAST of Complexin vs. Ensembl Mouse
Match: Cplx1 (complexin 1 [Source:MGI Symbol;Acc:MGI:104727])

HSP 1 Score: 54.299 bits (129), Expect = 6.459e-9
Identity = 37/75 (49.33%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  192 FIAKQLVGKQLDSVKGALG-DKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            F+ KQ +G     +   LG D+E      KKE   E + AL++AE+ R  K+ KME ERE MRQGIRDKYG+KKK
Sbjct:    3 FVMKQALGGATKDMGKMLGGDEEKDPDAAKKE--EERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGIKKK 75          
BLAST of Complexin vs. Ensembl Mouse
Match: Cplx1 (complexin 1 [Source:MGI Symbol;Acc:MGI:104727])

HSP 1 Score: 50.0618 bits (118), Expect = 6.017e-8
Identity = 32/56 (57.14%), Postives = 39/56 (69.64%), Query Frame = 3
Query:  246 GDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            GD+E      KKE   E + AL++AE+ R  K+ KME ERE MRQGIRDKYG+KKK
Sbjct:    7 GDEEKDPDAAKKE--EERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGIKKK 60          
BLAST of Complexin vs. UniProt/SwissProt
Match: sp|Q9GUM7|CPLX1_CAEEL (Putative complexin-1 OS=Caenorhabditis elegans OX=6239 GN=cpx-1 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 5.397e-24
Identity = 58/101 (57.43%), Postives = 66/101 (65.35%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEFGNPDGNRLGRKRKTP 485
            MA F+ KQ+VG QL  V G LG K+    + +   DPEV AA  E E+RR EKHRKME ERE MRQGIRDKY +KKKEE  AMD F      R+G  RKTP
Sbjct:    1 MAGFLMKQMVGNQLSEVTGGLGMKDDGGEKTETGEDPEVIAARLEQEERRKEKHRKMENEREKMRQGIRDKYAIKKKEEGVAMD-FTE---GRIGGPRKTP 97          
BLAST of Complexin vs. UniProt/SwissProt
Match: sp|Q60PP8|CPLX1_CAEBR (Putative complexin-1 OS=Caenorhabditis briggsae OX=6238 GN=cpx-1 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 9.907e-21
Identity = 58/101 (57.43%), Postives = 68/101 (67.33%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEFGNPDGNRLGRKRKTP 485
            MA F+ KQ+VG QL+ V G LG K+    + +   DPEV AA  E E+RR EKHRKME+ERE MRQGIRDKY +KKKEE  AMD F      R+G  RKTP
Sbjct:    1 MAGFLMKQMVGNQLNEVTGGLGLKDDGGEKTETGEDPEVVAARLEQEERRKEKHRKMEQEREKMRQGIRDKYAIKKKEEGVAMD-FTE---GRIGGPRKTP 97          
BLAST of Complexin vs. UniProt/SwissProt
Match: sp|Q8IPM8|CPLX_DROME (Complexin OS=Drosophila melanogaster OX=7227 GN=cpx PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.872e-20
Identity = 60/106 (56.60%), Postives = 73/106 (68.87%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAA---LKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEA--SAMDEFGNPDGNRLGRKRKTP 485
            MA+FIAKQ+VG QL +VKGA+G   G   ++K++ + E       +KEAEDRR EKHRKMEEERE MRQ IRDKY +KKKEE   +A  E  NP    L RK+KTP
Sbjct:    1 MAAFIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNP----LMRKKKTP 102          
BLAST of Complexin vs. UniProt/SwissProt
Match: sp|Q8I6U3|CPLX_HIRME (Complexin-1 OS=Hirudo medicinalis OX=6421 GN=cpx1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.510e-16
Identity = 55/120 (45.83%), Postives = 71/120 (59.17%), Query Frame = 3
Query:  291 PEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKE---EASAMDEFGNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANKVTEAPKQL---VSEATDKCKL 632
            PE+  A +EAE++R EK+RKMEEERE MRQGIRDKY ++KKE   E   ++        RLGRK+K+P E        +    S  GF P N+ ++  KV E P  +   VS ATDKC L
Sbjct:   33 PEIAEAKREAEEKRNEKYRKMEEEREVMRQGIRDKYHIQKKELPKEDPGLE-------GRLGRKKKSPDEAVEGGDPLQSSAQSS-GF-PKNLDDLTAKVKELPGTVMTTVSGATDKCNL 143          
BLAST of Complexin vs. UniProt/SwissProt
Match: sp|Q95PA1|CPLX_DORPE (Complexin OS=Doryteuthis pealeii OX=1051067 GN=cpx PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.207e-10
Identity = 69/157 (43.95%), Postives = 88/157 (56.05%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEK--HRKMEEERETMRQGIRDKYGLKK--KEEASAMDEFGNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANKVTEAPKQL---VSEATDKCKL 632
            MA+FIAKQ+VG QL SVK A+G  EG     +   +          E     K  HRKMEEERE MRQ IRDKYGLKK  KEE  A  +    D  R+GRK+KT  +    A A EEE+D      P ++ ++  KV+E P+++   V E T+KC L
Sbjct:    1 MAAFIAKQMVGDQLKSVK-AMGGDEGEKEGNENAEEEAAAIEEARREAEERRKEKHRKMEEEREEMRQTIRDKYGLKKKVKEEPEAEADL---DEGRVGRKKKT--KEELAAEANEEEDDDEFAKFPTDLSDLTTKVSELPQKMAASVGEVTEKCSL 151          
BLAST of Complexin vs. TrEMBL
Match: A0A0X3PQ40 (Putative complexin-1 OS=Schistocephalus solidus OX=70667 GN=CPLX1 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.966e-52
Identity = 106/152 (69.74%), Postives = 121/152 (79.61%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDK--EGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEFGNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANKVTEAPKQLVSEATDKCKL 632
            MA FIAKQL+G QL+SVKGALGDK  EG SS   K++DPEVE AL+EAE RR EKHRKMEEERE MRQ IRDKYG+KKKEE    +E    +  RLGRKRKTPAELAA+A  A E EDSILGFLP NVR +ANKVTEAP +L+SEA++KC +
Sbjct:    1 MAGFIAKQLIGNQLESVKGALGDKKDEGGSSG-AKQIDPEVEEALREAEQRRQEKHRKMEEEREVMRQDIRDKYGIKKKEEEINFEEIMMCNEGRLGRKRKTPAELAAEADKAAENEDSILGFLPENVRGIANKVTEAPSKLISEASEKCSI 151          
BLAST of Complexin vs. TrEMBL
Match: A0A0R3VUF5 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS950 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.262e-49
Identity = 104/153 (67.97%), Postives = 122/153 (79.74%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDK--EGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEF-GNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANKVTEAPKQLVSEATDKCKL 632
            MASFIAKQL+G QLDSVKGALGDK  EG SS   +E+DPEVE AL+EAE RR EKHRKMEEERE MRQ IRDKYG+KKKE     DE   + +G R+GRKRKTPAELAA+A  A  +EDS++G LP N+R +A+KVTEAP +L+SEAT+KC L
Sbjct:    1 MASFIAKQLIGNQLDSVKGALGDKKDEGGSSG-AREIDPEVEEALREAEQRRQEKHRKMEEEREAMRQDIRDKYGIKKKELEIDFDELMMSNEGGRVGRKRKTPAELAAEADRAAADEDSLIGMLPENMRGIASKVTEAPGKLISEATEKCTL 152          
BLAST of Complexin vs. TrEMBL
Match: A0A158QU97 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5936 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.474e-49
Identity = 104/153 (67.97%), Postives = 122/153 (79.74%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDK--EGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEF-GNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANKVTEAPKQLVSEATDKCKL 632
            MASFIAKQL+G QLDSVKGALGDK  EG SS   +E+DPEVE AL+EAE RR EKHRKMEEERE MRQ IRDKYG+KKKE     DE   N +G RLGRKRKTPAELAA+A  A  +EDS++G LP ++R +A+KVTEAP +L+SEA++KC L
Sbjct:    1 MASFIAKQLIGSQLDSVKGALGDKKDEGGSSG-AREIDPEVEEALREAEQRRQEKHRKMEEEREAMRQDIRDKYGIKKKEVEIDFDEIMMNNEGGRLGRKRKTPAELAAEADLAAADEDSLIGMLPESMRGIASKVTEAPGKLISEASEKCLL 152          
BLAST of Complexin vs. TrEMBL
Match: A0A5J4NU94 (Complexin-1/2 OS=Paragonimus westermani OX=34504 GN=DEA37_0015163 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.731e-49
Identity = 105/155 (67.74%), Postives = 127/155 (81.94%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDK---EGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMD-EFGNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANKVTEAPKQLVSEATDKCKLM 635
            MASFIAKQL+G QL+SVKGALGDK   +G S    K +DPEVEAAL+EAE+RR  KH+KMEEERE MRQGIRDKYG+KKKEE +  + +F +P+G RLGRKRKTPAELAA+A+AAEE E+S+   LP N+REMANKVTE P +L+SEA++KC  M
Sbjct:    1 MASFIAKQLIGNQLESVKGALGDKKDDDGGSG--AKMIDPEVEAALREAEERREAKHQKMEEEREVMRQGIRDKYGIKKKEEENTTEFDFSSPEG-RLGRKRKTPAELAAEASAAEEAENSLTSMLPENMREMANKVTEVPGKLMSEASEKCTAM 152          
BLAST of Complexin vs. TrEMBL
Match: Q5DA47 (Complexin (Synaphin) OS=Schistosoma japonicum OX=6182 GN=EWB00_006095 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 7.570e-49
Identity = 106/155 (68.39%), Postives = 124/155 (80.00%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDK--EGASS-EEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMD-EFGNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANKVTEAPKQLVSEATDKCKLM 635
            MASFIAKQL+G QLDSVKGALGDK  EG S    +KE+DPEVEAAL+EAE++R  KHRKMEEERE MRQGIRDKYG+KKKEE    D +F NP+G RLGRKRKTPAELAA+A  AE+E   +   LP N+R MANKVTE P +++SEA++KC LM
Sbjct:    1 MASFIAKQLIGNQLDSVKGALGDKKDEGDSVLGGRKEIDPEVEAALREAEEKREAKHRKMEEEREVMRQGIRDKYGIKKKEEEIPNDFDFSNPEG-RLGRKRKTPAELAAEANEAEDENI-LTSMLPENMRNMANKVTEVPGKIISEASEKCLLM 153          
BLAST of Complexin vs. Ensembl Cavefish
Match: CPLX1 (complexin 1 [Source:HGNC Symbol;Acc:HGNC:2309])

HSP 1 Score: 52.373 bits (124), Expect = 3.098e-8
Identity = 48/138 (34.78%), Postives = 74/138 (53.62%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSE-EKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGL---KKKEEASAMDEFGNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANKVTEA 590
            +F+ KQ +G     +   LG+KE    + EKKE   E + AL++ E+ R  K+ KME ERE++RQGIRDKYG+   ++KE  +        +G+    K+  PA    +    E   D+++ FLP  + +M NK T  
Sbjct:    2 NFVMKQALGGATKDMGKMLGEKEEKDPDAEKKE--EERQEALRQQEEERKAKYAKMEAERESIRQGIRDKYGIKKKEEKEAEAQAAMEQASEGSLTRPKKAVPAGCGDEEEEEESIVDTVMKFLPGPLVDMFNKNTSC 137          
BLAST of Complexin vs. Ensembl Cavefish
Match: CPLX1 (complexin 1 [Source:HGNC Symbol;Acc:HGNC:2309])

HSP 1 Score: 50.0618 bits (118), Expect = 1.579e-7
Identity = 33/73 (45.21%), Postives = 47/73 (64.38%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSE-EKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGL 404
            +F+ KQ +G     +   LG+KE    + EKKE   E + AL++ E+ R  K+ KME ERE++RQGIRDKYG+
Sbjct:    2 NFVMKQALGGATKDMGKMLGEKEEKDPDAEKKE--EERQEALRQQEEERKAKYAKMEAERESIRQGIRDKYGI 72          
BLAST of Complexin vs. Ensembl Cavefish
Match: cplx2 (complexin-2 [Source:NCBI gene;Acc:103025380])

HSP 1 Score: 45.0542 bits (105), Expect = 9.248e-6
Identity = 29/71 (40.85%), Postives = 43/71 (60.56%), Query Frame = 3
Query:  192 FIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGL 404
            F+ KQ +G     +   LG +E    + +K+ + E + AL++ E+ R  KH +ME ERE +RQ IRDKYGL
Sbjct:    3 FVMKQALGGATKDMGKMLGGEEEKDPDAQKK-EEERQEALRQQEEERKAKHARMEAEREKVRQTIRDKYGL 72          
BLAST of Complexin vs. Ensembl Cavefish
Match: cplx2 (complexin-2 [Source:NCBI gene;Acc:103025380])

HSP 1 Score: 45.0542 bits (105), Expect = 9.248e-6
Identity = 29/71 (40.85%), Postives = 43/71 (60.56%), Query Frame = 3
Query:  192 FIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGL 404
            F+ KQ +G     +   LG +E    + +K+ + E + AL++ E+ R  KH +ME ERE +RQ IRDKYGL
Sbjct:    3 FVMKQALGGATKDMGKMLGGEEEKDPDAQKK-EEERQEALRQQEEERKAKHARMEAEREKVRQTIRDKYGL 72          
BLAST of Complexin vs. Ensembl Medaka
Match: cplx2l (complexin-1 [Source:NCBI gene;Acc:110013827])

HSP 1 Score: 51.2174 bits (121), Expect = 5.201e-8
Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            +FI K  +G     V   LG +E     +  + + E + AL++ E+ R  K+ KME ERE MRQGIRDKYG+KK+
Sbjct:    2 NFIMKAAMGGGPPDVGKMLGGEEKEEDPDAAKKEEERQEALRQQEEERKAKYAKMEAEREVMRQGIRDKYGIKKR 76          
BLAST of Complexin vs. Ensembl Medaka
Match: cplx2l (complexin-1 [Source:NCBI gene;Acc:110013827])

HSP 1 Score: 51.2174 bits (121), Expect = 5.201e-8
Identity = 32/75 (42.67%), Postives = 45/75 (60.00%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK 413
            +FI K  +G     V   LG +E     +  + + E + AL++ E+ R  K+ KME ERE MRQGIRDKYG+KK+
Sbjct:    2 NFIMKAAMGGGPPDVGKMLGGEEKEEDPDAAKKEEERQEALRQQEEERKAKYAKMEAEREVMRQGIRDKYGIKKR 76          
BLAST of Complexin vs. Ensembl Medaka
Match: CPLX1 (complexin-1 [Source:NCBI gene;Acc:101172174])

HSP 1 Score: 48.9062 bits (115), Expect = 3.605e-7
Identity = 46/141 (32.62%), Postives = 72/141 (51.06%), Query Frame = 3
Query:  189 SFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKK-----------EEASAMDEFGNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANK 578
            +F+ KQ +G     +   LG +E    + +K+ + E + AL++ E+ R  K+ KME ERE +RQGIRDKYG+KKK           E+AS        +G+    K+  P     +    E   D+++ FLP  + +M NK
Sbjct:    2 NFVMKQALGGATKDMGKMLGGEEEKDPDAQKK-EEERQEALRQQEEERKAKYAKMEAERENLRQGIRDKYGIKKKEEKEAEAAAAMEQAS--------EGSLTRPKKAVPTGCGDEEEEEESIVDTVMKFLPAPLMDMFNK 133          
BLAST of Complexin vs. Planmine SMEST
Match: SMESG000017115.1 (SMESG000017115.1)

HSP 1 Score: 266.544 bits (680), Expect = 3.612e-91
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEFGNPDGNRLGRKRKTPXXXXXXXXXXXXXXXSILGFLPPNVREMANKVTEAPKQLVSEATDKCKLM 635
            MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEFGNPDGNRLGRKRKTPAELAADAAAAEEEEDSILGFLPPNVREMANKVTEAPKQLVSEATDKCKLM
Sbjct:    1 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEFGNPDGNRLGRKRKTPAELAADAAAAEEEEDSILGFLPPNVREMANKVTEAPKQLVSEATDKCKLM 151          
BLAST of Complexin vs. Planmine SMEST
Match: SMESG000012002.1 (SMESG000012002.1)

HSP 1 Score: 108.997 bits (271), Expect = 1.961e-30
Identity = 52/72 (72.22%), Postives = 63/72 (87.50%), Query Frame = 3
Query:  183 MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRRLEKHRKMEEERETMRQGIRDKY 398
            MA+FIAK LVGKQLDSVKGALGDK   +++ K E+DPE+EAA++E E++RL+KHRKMEEERE MRQGIRDK 
Sbjct:    1 MATFIAKHLVGKQLDSVKGALGDKGDNNNDSKNEIDPEIEAAIRENEEKRLDKHRKMEEERENMRQGIRDKV 72          
The following BLAST results are available for this feature:
BLAST of Complexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CPLX15.425e-848.00complexin 1 [Source:HGNC Symbol;Acc:HGNC:2309][more]
CPLX26.587e-844.74complexin 2 [Source:HGNC Symbol;Acc:HGNC:2310][more]
CPLX15.377e-755.36complexin 1 [Source:HGNC Symbol;Acc:HGNC:2309][more]
back to top
BLAST of Complexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cpx-14.243e-2557.43Putative complexin-1 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Complexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpx1.867e-2156.60gene:FBgn0041605 transcript:FBtr0078901[more]
cpx1.867e-2156.60gene:FBgn0041605 transcript:FBtr0301769[more]
cpx1.867e-2156.60gene:FBgn0041605 transcript:FBtr0301771[more]
cpx1.867e-2156.60gene:FBgn0041605 transcript:FBtr0078899[more]
cpx1.867e-2156.60gene:FBgn0041605 transcript:FBtr0078898[more]
back to top
BLAST of Complexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cplx2l1.055e-645.33complexin 2, like [Source:ZFIN;Acc:ZDB-GENE-040718... [more]
cplx2l1.055e-645.33complexin 2, like [Source:ZFIN;Acc:ZDB-GENE-040718... [more]
cplx2l1.055e-645.33complexin 2, like [Source:ZFIN;Acc:ZDB-GENE-040718... [more]
cplx2l1.055e-645.33complexin 2, like [Source:ZFIN;Acc:ZDB-GENE-040718... [more]
cplx21.948e-633.57complexin 2 [Source:ZFIN;Acc:ZDB-GENE-081113-1][more]
back to top
BLAST of Complexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cplx13.347e-843.66complexin 1 [Source:NCBI gene;Acc:100124828][more]
c18orf543.151e-642.25chromosome 18 open reading frame 54 [Source:Xenbas... [more]
back to top
BLAST of Complexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cplx16.459e-949.33complexin 1 [Source:MGI Symbol;Acc:MGI:104727][more]
Cplx16.017e-857.14complexin 1 [Source:MGI Symbol;Acc:MGI:104727][more]
back to top
BLAST of Complexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GUM7|CPLX1_CAEEL5.397e-2457.43Putative complexin-1 OS=Caenorhabditis elegans OX=... [more]
sp|Q60PP8|CPLX1_CAEBR9.907e-2157.43Putative complexin-1 OS=Caenorhabditis briggsae OX... [more]
sp|Q8IPM8|CPLX_DROME1.872e-2056.60Complexin OS=Drosophila melanogaster OX=7227 GN=cp... [more]
sp|Q8I6U3|CPLX_HIRME3.510e-1645.83Complexin-1 OS=Hirudo medicinalis OX=6421 GN=cpx1 ... [more]
sp|Q95PA1|CPLX_DORPE2.207e-1043.95Complexin OS=Doryteuthis pealeii OX=1051067 GN=cpx... [more]
back to top
BLAST of Complexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PQ401.966e-5269.74Putative complexin-1 OS=Schistocephalus solidus OX... [more]
A0A0R3VUF51.262e-4967.97Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A158QU972.474e-4967.97Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5J4NU942.731e-4967.74Complexin-1/2 OS=Paragonimus westermani OX=34504 G... [more]
Q5DA477.570e-4968.39Complexin (Synaphin) OS=Schistosoma japonicum OX=6... [more]
back to top
BLAST of Complexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CPLX13.098e-834.78complexin 1 [Source:HGNC Symbol;Acc:HGNC:2309][more]
CPLX11.579e-745.21complexin 1 [Source:HGNC Symbol;Acc:HGNC:2309][more]
cplx29.248e-640.85complexin-2 [Source:NCBI gene;Acc:103025380][more]
cplx29.248e-640.85complexin-2 [Source:NCBI gene;Acc:103025380][more]
back to top
BLAST of Complexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Complexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Complexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Complexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cplx2l5.201e-842.67complexin-1 [Source:NCBI gene;Acc:110013827][more]
cplx2l5.201e-842.67complexin-1 [Source:NCBI gene;Acc:110013827][more]
CPLX13.605e-732.62complexin-1 [Source:NCBI gene;Acc:101172174][more]
back to top
BLAST of Complexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017115.13.612e-91100.00SMESG000017115.1[more]
SMESG000012002.11.961e-3072.22SMESG000012002.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000242 ID=SMED30000242|Name=Complexin|organism=Schmidtea mediterranea sexual|type=transcript|length=785bp
GTTTATTGTGTTTTTTAATTGGATAACAATTATACGTTGAAATTTCCCCA
AAATCTGCATCGCGCTTCGTTCTTATTAAGTTGTTAGTGTGCTTCGATTT
CGTGTCTTATAAAGCAGACTCTCTCATTACTCGTGCTAATTGAAATTAGG
AACTTTGACAATTTTAATTCACAATATCAAACATGGCTAGCTTTATCGCC
AAACAATTGGTTGGGAAACAGCTGGATTCAGTGAAAGGGGCACTTGGGGA
TAAAGAAGGCGCCTCAAGTGAAGAAAAGAAAGAAGTAGATCCAGAAGTCG
AAGCAGCATTGAAAGAAGCAGAAGATCGAAGACTGGAAAAACATAGAAAA
ATGGAAGAAGAAAGAGAAACTATGAGACAGGGTATACGAGATAAATATGG
TCTCAAGAAAAAAGAAGAGGCCTCGGCAATGGATGAATTCGGAAATCCAG
ATGGAAATAGATTAGGACGTAAAAGAAAAACGCCAGCTGAATTAGCAGCC
GATGCCGCAGCCGCAGAAGAGGAAGAGGATTCAATATTAGGATTTCTGCC
TCCGAACGTCCGTGAAATGGCTAACAAGGTTACAGAAGCGCCAAAGCAAT
TAGTATCCGAAGCTACAGACAAATGCAAATTAATGTAGTTTCTTCGGATA
ATTTATGTGATGTAAATACACATGTTGTATGAAACCGTCAGCATGGACCT
TACTCTAGGGATGACAATAACATTTTATTATCACTATTCTGATTTTGATT
CTTGTTATTAGTATCATCATTATTATTATTATTAT
back to top

protein sequence of SMED30000242-orf-1

>SMED30000242-orf-1 ID=SMED30000242-orf-1|Name=SMED30000242-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MASFIAKQLVGKQLDSVKGALGDKEGASSEEKKEVDPEVEAALKEAEDRR
LEKHRKMEEERETMRQGIRDKYGLKKKEEASAMDEFGNPDGNRLGRKRKT
PAELAADAAAAEEEEDSILGFLPPNVREMANKVTEAPKQLVSEATDKCKL
M*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR008849Synaphin
Vocabulary: molecular function
TermDefinition
GO:0019905syntaxin binding
Vocabulary: biological process
TermDefinition
GO:0006836neurotransmitter transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 43..63
NoneNo IPR availableGENE3DG3DSA:1.20.5.580coord: 19..85
e-value: 1.4E-19
score: 71.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 15..116
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 24..103
NoneNo IPR availablePANTHERPTHR16705:SF4COMPLEXINcoord: 1..148
NoneNo IPR availableSUPERFAMILYSSF58038SNARE fusion complexcoord: 36..74
IPR008849SynaphinPFAMPF05835Synaphincoord: 2..137
e-value: 9.5E-41
score: 139.4
IPR008849SynaphinPANTHERPTHR16705COMPLEXINcoord: 1..148