Ubiquitin carboxyl-terminal hydrolase

Overview
NameUbiquitin carboxyl-terminal hydrolase
Smed IDSMED30000241
Length (bp)3217
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30000241) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30000241) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase (SMED30000241) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase (SMED30000241) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000241

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000241SMESG000020277.1 PL08001A1E07ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30000241SMESG000020277.1 dd_Smed_v4_6489_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000241SMESG000020277.1 dd_Smed_v4_6489_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP8 (ubiquitin specific peptidase 8 [Source:HGNC Symbol;Acc:HGNC:12631])

HSP 1 Score: 340.502 bits (872), Expect = 5.342e-100
Identity = 204/484 (42.15%), Postives = 280/484 (57.85%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINK-SMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP-CSTKT-FTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            P LP       D  T  + Y  +  N    YPP        E +       T   H A  +    +    S LKRS S P+++  +   +    T    +T        P +NR  KP C  K   +  SAS++ N NP +    P LTGLRN+GNTCYMNS++Q L N   L +Y   N YQ DINR N LG+ GE+  EF  ++ ALWTG YR +SP DFK  I   N+ F G  Q DSQE LLFL+DGLHEDLN+     +     N D + D + A  +W+ H  +N+S+IV +FQGQ++S V C  C   S TF+AFMYLSLPL A+ ++C+L+DCL+LF  EE++T  ++++C  C++ R++ KKI+IWKLPP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+L++VSNH+G ++ GHYT++CKN     W  +DD  V+ I    VK+ + YILFY S
Sbjct:  543 PGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPP--------EMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPT----VT--------PTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYK-EENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPL-ASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKK--YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTS 1002          

HSP 2 Score: 58.5362 bits (140), Expect = 7.608e-8
Identity = 78/278 (28.06%), Postives = 122/278 (43.88%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKAFSKDASYITSHFNTKTIDIAFEKAGKL-KASLEERYKCIPKIEEIPTVQVEITKDTITETP-KDNITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW-NSAETGRINL----VKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGP 899
            K LY+SS+L +L +K E         +K  +I  K YE  E               +R        KK   KD          K  +   E  G L K SLE       K     T +    K+   ET  K  IT +ELY ++  K  +L+I D R   ++ +S I +   +++P   +  G T   +   L   +DS   + W KR +   V+L+ W +SA+  +I      +KDA+ KW+++  ++N  +VLE G+ ++L  YP   TN+K   P
Sbjct:    9 KELYLSSSLKDLNKKTE---------VKPEKISTKRYEEAE---------------VR--------KKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDK-----TQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHS--LSVPEEAISPGVTASWIEAHLP--DDSK--DTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPP 243          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP8 (ubiquitin specific peptidase 8 [Source:HGNC Symbol;Acc:HGNC:12631])

HSP 1 Score: 340.502 bits (872), Expect = 3.023e-99
Identity = 204/484 (42.15%), Postives = 280/484 (57.85%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINK-SMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP-CSTKT-FTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            P LP       D  T  + Y  +  N    YPP        E +       T   H A  +    +    S LKRS S P+++  +   +    T    +T        P +NR  KP C  K   +  SAS++ N NP +    P LTGLRN+GNTCYMNS++Q L N   L +Y   N YQ DINR N LG+ GE+  EF  ++ ALWTG YR +SP DFK  I   N+ F G  Q DSQE LLFL+DGLHEDLN+     +     N D + D + A  +W+ H  +N+S+IV +FQGQ++S V C  C   S TF+AFMYLSLPL A+ ++C+L+DCL+LF  EE++T  ++++C  C++ R++ KKI+IWKLPP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+L++VSNH+G ++ GHYT++CKN     W  +DD  V+ I    VK+ + YILFY S
Sbjct:  649 PGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPP--------EMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPT----VT--------PTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYK-EENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPL-ASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKK--YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTS 1108          

HSP 2 Score: 83.5741 bits (205), Expect = 1.748e-15
Identity = 88/321 (27.41%), Postives = 149/321 (46.42%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMN--KIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYK---CIPKIEE------------------------IPTVQVEITKDTITETPKDN--------------ITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW-NSAETGRINL----VKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGP 899
            K LY+SS+L +L +K E+   KI   S + S     K+++  E   LD+DEE + +  M+++T+   +KK   F +   Y  S      I  A E+A +L  SL+ RY+      K+EE                        +    +E   D+  +T K N              IT +ELY ++  K  +L+I D R   ++ +S I +   +++P   +  G T   +   L   +DS   + W KR +   V+L+ W +SA+  +I      +KDA+ KW+++  ++N  +VLE G+ ++L  YP   TN+K   P
Sbjct:    9 KELYLSSSLKDLNKKTEVKPEKISTKSYVHSA---LKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHS--LSVPEEAISPGVTASWIEAHLP--DDSK--DTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPP 320          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP8 (ubiquitin specific peptidase 8 [Source:HGNC Symbol;Acc:HGNC:12631])

HSP 1 Score: 340.502 bits (872), Expect = 3.023e-99
Identity = 204/484 (42.15%), Postives = 280/484 (57.85%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINK-SMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP-CSTKT-FTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            P LP       D  T  + Y  +  N    YPP        E +       T   H A  +    +    S LKRS S P+++  +   +    T    +T        P +NR  KP C  K   +  SAS++ N NP +    P LTGLRN+GNTCYMNS++Q L N   L +Y   N YQ DINR N LG+ GE+  EF  ++ ALWTG YR +SP DFK  I   N+ F G  Q DSQE LLFL+DGLHEDLN+     +     N D + D + A  +W+ H  +N+S+IV +FQGQ++S V C  C   S TF+AFMYLSLPL A+ ++C+L+DCL+LF  EE++T  ++++C  C++ R++ KKI+IWKLPP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+L++VSNH+G ++ GHYT++CKN     W  +DD  V+ I    VK+ + YILFY S
Sbjct:  649 PGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPP--------EMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPT----VT--------PTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYK-EENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPL-ASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKK--YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTS 1108          

HSP 2 Score: 83.5741 bits (205), Expect = 1.748e-15
Identity = 88/321 (27.41%), Postives = 149/321 (46.42%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMN--KIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYK---CIPKIEE------------------------IPTVQVEITKDTITETPKDN--------------ITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW-NSAETGRINL----VKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGP 899
            K LY+SS+L +L +K E+   KI   S + S     K+++  E   LD+DEE + +  M+++T+   +KK   F +   Y  S      I  A E+A +L  SL+ RY+      K+EE                        +    +E   D+  +T K N              IT +ELY ++  K  +L+I D R   ++ +S I +   +++P   +  G T   +   L   +DS   + W KR +   V+L+ W +SA+  +I      +KDA+ KW+++  ++N  +VLE G+ ++L  YP   TN+K   P
Sbjct:    9 KELYLSSSLKDLNKKTEVKPEKISTKSYVHSA---LKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHS--LSVPEEAISPGVTASWIEAHLP--DDSK--DTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPP 320          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP2 (ubiquitin specific peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12618])

HSP 1 Score: 217.238 bits (552), Expect = 5.089e-62
Identity = 137/339 (40.41%), Postives = 195/339 (57.52%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREV-SPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVA-NHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT+ L +Y L   Y  D++  +       +V EFA LI  +WT +  +V SPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR + L   + P N D + D E+  Q W+ ++   DS I  +F GQ +S +TC  C   S  FD F  LSLP+    +   +L DC++LF  E+ + G  +  C +C+  +   KK  I + P  L++HLKRFS +     KL TFV+FP+     +D+ +   +   H  Y+LYAVSNH G    GHYT++C++    EWH ++D  VT +    V+T   Y+LFYE
Sbjct:   22 GLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLHHGS--NAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVT-LRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRD---LDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 354          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Match: USP2 (ubiquitin specific peptidase 2 [Source:HGNC Symbol;Acc:HGNC:12618])

HSP 1 Score: 216.853 bits (551), Expect = 1.557e-61
Identity = 137/339 (40.41%), Postives = 195/339 (57.52%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREV-SPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVA-NHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT+ L +Y L   Y  D++  +       +V EFA LI  +WT +  +V SPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR + L   + P N D + D E+  Q W+ ++   DS I  +F GQ +S +TC  C   S  FD F  LSLP+    +   +L DC++LF  E+ + G  +  C +C+  +   KK  I + P  L++HLKRFS +     KL TFV+FP+     +D+ +   +   H  Y+LYAVSNH G    GHYT++C++    EWH ++D  VT +    V+T   Y+LFYE
Sbjct:   56 GLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLHHGS--NAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVT-LRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRD---LDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 388          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-50 (Ubiquitin Specific Protease [Source:UniProtKB/TrEMBL;Acc:G5EBW2])

HSP 1 Score: 173.711 bits (439), Expect = 2.405e-44
Identity = 112/341 (32.84%), Postives = 172/341 (50.44%), Query Frame = 3
Query: 1956 TPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMI-DGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIER-ANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
             PG  GL NMGNTC+M++ +Q L  T  L        +   +N  + LG  G I   FA L   +W G +  + PS F ++  D   +      QHD+ EF +FLLD LHED N+  ++S      N      I + A    K H   + S + R+      S++ C  C  +S TF+    +S+ + +N + CSL+ CL+   ++ ++ G S+W CPKCK  R + +   +W+ PP ++IHLKRF+      +K    V F    F +   L H   P +   Y LYA + H+G + SGHYT+   ++++++W  +DD VVT      V     YILFY+
Sbjct:  474 VPGAVGLFNMGNTCFMSATLQCLFQTPGLAEVFTKKVFVSKVNTQSRLGSKGVISAGFASLSDMIWNGTFTAIRPSRFLQLFSDTVYQPLSDGRQHDASEFQIFLLDALHEDTNQAQRIS---FEQNYHGGAGIAKEAADFLKKHYQFSLSPVNRLLGSITVSEIRCLTCGASSATFEENTIISVEIPSNSS-CSLDMCLRSHFSQTKLDGDSRWNCPKCKEPRASTRTSKLWQPPPVMIIHLKRFALFNGDFEKNTAAVTFETARFDVRPYL-HEMAPAEKPVYKLYAATLHNGRLNSGHYTAVASHLRSDKWLRFDDSVVTPCENFKVDPSLAYILFYK 809          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: usp-50 (Ubiquitin Specific Protease [Source:UniProtKB/TrEMBL;Acc:G5EBW2])

HSP 1 Score: 173.711 bits (439), Expect = 2.405e-44
Identity = 112/341 (32.84%), Postives = 172/341 (50.44%), Query Frame = 3
Query: 1956 TPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMI-DGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIER-ANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
             PG  GL NMGNTC+M++ +Q L  T  L        +   +N  + LG  G I   FA L   +W G +  + PS F ++  D   +      QHD+ EF +FLLD LHED N+  ++S      N      I + A    K H   + S + R+      S++ C  C  +S TF+    +S+ + +N + CSL+ CL+   ++ ++ G S+W CPKCK  R + +   +W+ PP ++IHLKRF+      +K    V F    F +   L H   P +   Y LYA + H+G + SGHYT+   ++++++W  +DD VVT      V     YILFY+
Sbjct:  474 VPGAVGLFNMGNTCFMSATLQCLFQTPGLAEVFTKKVFVSKVNTQSRLGSKGVISAGFASLSDMIWNGTFTAIRPSRFLQLFSDTVYQPLSDGRQHDASEFQIFLLDALHEDTNQAQRIS---FEQNYHGGAGIAKEAADFLKKHYQFSLSPVNRLLGSITVSEIRCLTCGASSATFEENTIISVEIPSNSS-CSLDMCLRSHFSQTKLDGDSRWNCPKCKEPRASTRTSKLWQPPPVMIIHLKRFALFNGDFEKNTAAVTFETARFDVRPYL-HEMAPAEKPVYKLYAATLHNGRLNSGHYTAVASHLRSDKWLRFDDSVVTPCENFKVDPSLAYILFYK 809          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: F07A11.4 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:I2HA92])

HSP 1 Score: 142.895 bits (359), Expect = 2.790e-34
Identity = 85/196 (43.37%), Postives = 115/196 (58.67%), Query Frame = 3
Query: 1950 TVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSL 2537
             V  G TGLRN+GNTC+MN+V+Q L N   L  Y L N YQ +IN  NPLG  G +   FA  +  +W+G+ + + P+  K ++  K   F    QHD+ EFL FLLDGLHED+NR  K   +T  V      D++ +N++WK HI  NDS+ V +F GQ +S V C +C   S+TFD F+YL +P   N     L
Sbjct:  230 VVEQGYTGLRNIGNTCFMNAVLQMLVNNIELREYFLRNHYQPEINETNPLGSEGRLAKAFADFMHQMWSGHQKAIEPTQIKNIVAEKASQFANFAQHDAHEFLSFLLDGLHEDVNRVKK-KPLTGTVESHGRHDLDVSNEAWKNHILRNDSIFVDLFHGQLKSHVQCPNCDRVSITFDPFVYLPVPFPKNKQSTDL 424          

HSP 2 Score: 92.8189 bits (229), Expect = 7.432e-19
Identity = 54/159 (33.96%), Postives = 72/159 (45.28%), Query Frame = 3
Query: 2535 LEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTG-------QYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTS------FCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            L   L LF   ER+     W+C  CK N  A KK+ +++LPP L+I LKRF  T          R K    V++P+ES  +   L  T        Y L  V  H GN   GHY S      F  +    EW N+DD  V +     ++T   Y+LFY+
Sbjct:  763 LTQMLDLFSETERLKPEESWYCSTCKENVEATKKLQLYRLPPVLIIQLKRFVYTAFTYQSSMARRSKDTRSVEYPLESLDMSPFLAETSPHPNSTMYDLTGVVCHSGNSYFGHYISMGRLADFDSSKTKIEWRNFDDSTVARQSTSTLQTEDAYLLFYK 921          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: F07A11.4 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:I2HA92])

HSP 1 Score: 142.895 bits (359), Expect = 3.073e-34
Identity = 85/195 (43.59%), Postives = 115/195 (58.97%), Query Frame = 3
Query: 1953 VTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSL 2537
            V  G TGLRN+GNTC+MN+V+Q L N   L  Y L N YQ +IN  NPLG  G +   FA  +  +W+G+ + + P+  K ++  K   F    QHD+ EFL FLLDGLHED+NR  K   +T  V      D++ +N++WK HI  NDS+ V +F GQ +S V C +C   S+TFD F+YL +P   N     L
Sbjct:  418 VEQGYTGLRNIGNTCFMNAVLQMLVNNIELREYFLRNHYQPEINETNPLGSEGRLAKAFADFMHQMWSGHQKAIEPTQIKNIVAEKASQFANFAQHDAHEFLSFLLDGLHEDVNRVKK-KPLTGTVESHGRHDLDVSNEAWKNHILRNDSIFVDLFHGQLKSHVQCPNCDRVSITFDPFVYLPVPFPKNKQSTDL 611          

HSP 2 Score: 93.5893 bits (231), Expect = 4.450e-19
Identity = 57/171 (33.33%), Postives = 78/171 (45.61%), Query Frame = 3
Query: 2535 LEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTG-------QYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTS------FCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE--SYNLKQAGFK 3002
            L   L LF   ER+     W+C  CK N  A KK+ +++LPP L+I LKRF  T          R K    V++P+ES  +   L  T        Y L  V  H GN   GHY S      F  +    EW N+DD  V +     ++T   Y+LFY+    N+ ++ FK
Sbjct:  910 LTQMLDLFSETERLKPEESWYCSTCKENVEATKKLQLYRLPPVLIIQLKRFVYTAFTYQSSMARRSKDTRSVEYPLESLDMSPFLAETSPHPNSTMYDLTGVVCHSGNSYFGHYISMGRLADFDSSKTKIEWRNFDDSTVARQSTSTLQTEDAYLLFYKMRDQNVTRSIFK 1080          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Match: H34C03.2 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:Q9TYY8])

HSP 1 Score: 140.969 bits (354), Expect = 1.013e-33
Identity = 80/185 (43.24%), Postives = 109/185 (58.92%), Query Frame = 3
Query: 1956 TPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL 2510
            TPG  GL N+GNTC+M S  Q LSN   L  Y L N+YQ+DIN DNPLG  G + +    L+  +W+G+Y  ++P  FK +I      F G  Q D+ E + ++LDGLHEDLNR  K   +     + K+ + E A +SW+ +   NDS+IV    GQ +S + C  C+  S+ FD F YLSLPL
Sbjct:  271 TPGACGLSNLGNTCFMASAFQCLSNMPPLREYFLANTYQNDINEDNPLGTHGHLAMAVGELMKGMWSGDYASINPRKFKSIIGQFAPRFNGYSQQDAHELMAYVLDGLHEDLNRIKKKPYIEDSDEDAKLPEAEYAAKSWEVYKMRNDSIIVDTLHGQLKSTLICPVCEKISIKFDPFGYLSLPL 455          

HSP 2 Score: 97.0561 bits (240), Expect = 3.409e-20
Identity = 44/132 (33.33%), Postives = 73/132 (55.30%), Query Frame = 3
Query: 2511 VANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDD 2906
            V+   +  L++ L  F  +E++     W+CP+CK +  A K++ +WKLP  L++HLKRF  T   R+KL   V  P+    L D + +    +    Y L AVS H+G++  GHYT+   N +  +W +++D
Sbjct:  692 VSTRRKVLLQETLDWFTTKEQLGEQDSWYCPQCKKHERATKQLALWKLPEILILHLKRFQYTKWSREKLTWEVVIPVRGLDLTDKVANPNHEKA--IYDLIAVSRHYGSLSGGHYTAIGYNDREQKWFDFND 821          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp8 (gene:FBgn0038862 transcript:FBtr0084016)

HSP 1 Score: 262.307 bits (669), Expect = 2.271e-73
Identity = 151/379 (39.84%), Postives = 223/379 (58.84%), Query Frame = 3
Query: 1851 ELPALNRLTKPCSTKTFTEFSASRLNNFNPNY-RTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRF----SCTGQYRQKLNTFVDFPMESFSLVD-ILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
            E+P  +R  KP       E ++ R+ +F+P   + V  GLTGL+N+GNTCYMNS++Q LSNT  LT Y +++ Y++ I+R N     G+++ E A LI  LW G Y+ V+  D + ++    ++FRG +Q DS EFL  L+D LH      S L  + +P   + I+  E+A   W       +S+I+ +F GQ +S V C  C   S T+++F  LSL L  N N C L  C+ ++ + ER+ G   W CP CK+ R+A KK+DI KLPP L++HLKRF    S +G Y +K N ++ FP+E+  +   I +   +     TY LYAVSNH+G ME GHYT+FCK+    +W  +DD VV+ +   +V + + YILFY
Sbjct:  525 EIPTFDRAMKPQPRNV--ERTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNKTN--GQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLH------SDLQTLHVPRQREMISASEKA---WLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKKQN-YLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY 886          

HSP 2 Score: 69.707 bits (169), Expect = 1.251e-11
Identity = 75/305 (24.59%), Postives = 133/305 (43.61%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKAFSKDASYIT-------SHFNTKTIDIAFEKAGKLKASLEERYKCIPKIEEIPTVQVEITKDTITETPKDN-----ITVEELYKIIKKKENALVIDVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNS-----AETGRINLVKDAVCKWDAENSIKN-VVVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQP-DNIHYP 950
            K L++SS L +L + + +  +    +        KLY   E   LD DEEL+ I  M++  +LT + K     +   T       +  N + +D   E    L+    ++++    I            D+    P        IT ++LY+ +++K + LV+D RPS ++  SH++Y    N+P   +  G +       L++R  S     W  R     V+L+ WN+     A    I+ + D +  WD + + +  + ++E G+  F+  YPT  TN   + P +    N I+  D+I YP
Sbjct:    5 KKLHMSSNLDDLEKMSIIPDLRSKGMKILLNTARKLYMTAEEYRLDGDEELAYITYMKYFNMLTAIHKKSDYPSHKTTVRQMLGDTESNRRIMDTLEEIINSLRHRYAQQHQAPEPIAPDLVSNGRAGVDSPITQPTQYARLGLITCQDLYRRMQEK-SVLVMDCRPSADYEASHLTYYCAFNVPEELITPGMSAGR----LQARLSSSAKASWASRSVKDSVVLMDWNTKDAQPATNTAISTLLDILKNWDPDVTYRAPIQIVEGGYEYFIMMYPTHCTNPSVQAPQQN--NNDIETIDDIEYP 302          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp8 (gene:FBgn0038862 transcript:FBtr0304714)

HSP 1 Score: 247.669 bits (631), Expect = 4.211e-73
Identity = 141/341 (41.35%), Postives = 205/341 (60.12%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRF----SCTGQYRQKLNTFVDFPMESFSLVD-ILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
            GLTGL+N+GNTCYMNS++Q LSNT  LT Y +++ Y++ I+R N     G+++ E A LI  LW G Y+ V+  D + ++    ++FRG +Q DS EFL  L+D LH      S L  + +P   + I+  E+A   W       +S+I+ +F GQ +S V C  C   S T+++F  LSL L  N N C L  C+ ++ + ER+ G   W CP CK+ R+A KK+DI KLPP L++HLKRF    S +G Y +K N ++ FP+E+  +   I +   +     TY LYAVSNH+G ME GHYT+FCK+    +W  +DD VV+ +   +V + + YILFY
Sbjct:   32 GLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYISRSNKTN--GQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILMDWLH------SDLQTLHVPRQREMISASEKA---WLEFTKAKESMILHLFYGQMKSTVKCVACHKESATYESFSNLSLELPPNSNVCQLNQCMDMYFSGERIHG---WNCPSCKTKRDAIKKLDISKLPPVLVVHLKRFYADPSNSGSYMKKQN-YLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYGTMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFY 357          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0339506)

HSP 1 Score: 220.32 bits (560), Expect = 3.142e-61
Identity = 138/362 (38.12%), Postives = 210/362 (58.01%), Query Frame = 3
Query: 1911 SASRLNNFNPNYRTVTP-------GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVT-KIRECDVKTPSGYILFYE 2972
            S+S  +N +  Y+T +        GL GLRN+GNTC+MNSV+Q LS+T+ LT ++ ++     ++  +      +I+ EFA LI  +WT N   V+P + KR    K+ M+    Q D+QEFL F LD LH  LN G K   + +   +D ++D ++A+ +W+ +    +S++  +F GQ +S + C  C  TSVTFD F  LS+PL ++ +RC LE CL LF+ EE + G     C KCK+ R   K   I + P YL+IHLKRFS T     KL+  V+FP  S S +++  +      +  Y LYA+SNH G+   GHY + CK+  + +WH ++D++V+  + E  + + S YILFYE
Sbjct:  214 SSSLKHNSDDGYKTASSSRDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKDQ-----QILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNI---DDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSS-SRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRFSETRW--SKLSNIVEFPT-SDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYE 563          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0077346)

HSP 1 Score: 223.016 bits (567), Expect = 3.489e-60
Identity = 138/362 (38.12%), Postives = 210/362 (58.01%), Query Frame = 3
Query: 1911 SASRLNNFNPNYRTVTP-------GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVT-KIRECDVKTPSGYILFYE 2972
            S+S  +N +  Y+T +        GL GLRN+GNTC+MNSV+Q LS+T+ LT ++ ++     ++  +      +I+ EFA LI  +WT N   V+P + KR    K+ M+    Q D+QEFL F LD LH  LN G K   + +   +D ++D ++A+ +W+ +    +S++  +F GQ +S + C  C  TSVTFD F  LS+PL ++ +RC LE CL LF+ EE + G     C KCK+ R   K   I + P YL+IHLKRFS T     KL+  V+FP  S S +++  +      +  Y LYA+SNH G+   GHY + CK+  + +WH ++D++V+  + E  + + S YILFYE
Sbjct:  505 SSSLKHNSDDGYKTASSSRDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKDQ-----QILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNI---DDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSS-SRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRFSETRW--SKLSNIVEFPT-SDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYE 854          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Match: Usp2 (gene:FBgn0031187 transcript:FBtr0077348)

HSP 1 Score: 223.016 bits (567), Expect = 3.489e-60
Identity = 138/362 (38.12%), Postives = 210/362 (58.01%), Query Frame = 3
Query: 1911 SASRLNNFNPNYRTVTP-------GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVT-KIRECDVKTPSGYILFYE 2972
            S+S  +N +  Y+T +        GL GLRN+GNTC+MNSV+Q LS+T+ LT ++ ++     ++  +      +I+ EFA LI  +WT N   V+P + KR    K+ M+    Q D+QEFL F LD LH  LN G K   + +   +D ++D ++A+ +W+ +    +S++  +F GQ +S + C  C  TSVTFD F  LS+PL ++ +RC LE CL LF+ EE + G     C KCK+ R   K   I + P YL+IHLKRFS T     KL+  V+FP  S S +++  +      +  Y LYA+SNH G+   GHY + CK+  + +WH ++D++V+  + E  + + S YILFYE
Sbjct:  505 SSSLKHNSDDGYKTASSSRDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSLSTKDQ-----QILHEFAKLIQEMWTANVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNI---DDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSS-SRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRFSETRW--SKLSNIVEFPT-SDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYE 854          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp8 (ubiquitin specific peptidase 8 [Source:ZFIN;Acc:ZDB-GENE-030131-1949])

HSP 1 Score: 350.132 bits (897), Expect = 3.194e-103
Identity = 200/491 (40.73%), Postives = 282/491 (57.43%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTF-----TEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXN-----RGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            P LP       D  T  Y Y  +  N+   YPP EV                    +   +   ++   S LKRS S P++S +L +                +   +P++NR  KP +  T+     T  SA+++ N NP +    P LTGLRN+GNTCYMNS++Q L NT  + +Y   N YQ DINR N LG+ GE+  EF+ ++ ALW G Y+ +SP DFK  I   N  F   E  DSQE LLFL+DGLHEDLN     RG K  ++      + + D+  A+ +W  H  +N+S+IV +FQGQ++S V C  CQ  S TF+ FMYL+L + A+ ++CSL+DCLKLF  EER+T  ++++C  CK++R+A K++ IWKLPP LL+HLKRF   G++R+KL T VDFP+++  L   +   K   K   Y+LYAVSNH+G M+ GHYT++CKN     W  +DD  V++I    V++P+ YI FY S
Sbjct:  598 PGLPDGWMKFLDTVTGTYRYYHSPTNRVHLYPP-EVSTPQTPAKHTPPAQPAADTETEKQRQRDREREQSKLKRSYSSPDISQELSAE------------TRQRPAAVPSINRENKPLAASTYAKVEITRPSAAKIRNLNPVFGGQGPLLTGLRNLGNTCYMNSILQCLCNTVAMADYFNRNYYQDDINRANILGHKGEVAEEFSVVMKALWLGQYKMISPLDFKGTICKINSRFSSYEHQDSQELLLFLMDGLHEDLNKADKRRGYKEEEI------EHLDDVSAADLAWSKHKQLNESIIVALFQGQFKSTVQCMSCQHKSRTFETFMYLTLEMTAS-SKCSLQDCLKLFHKEERLTDGNRFYCRHCKTHRDAIKRMQIWKLPPILLVHLKRFKYEGRWREKLQTLVDFPLDNLDLSQYVIGPKNNLKK--YNLYAVSNHYGGMDGGHYTAYCKNPMKQRWFKFDDHEVSEISSSTVRSPAAYIFFYSS 1066          

HSP 2 Score: 99.3673 bits (246), Expect = 1.417e-20
Identity = 86/334 (25.75%), Postives = 154/334 (46.11%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYKCIP--------------------------KIEEIPTVQVEITKDTITETP--------KDNITVEELYKIIKKKE-NALVIDVRPSNEFLNSHISYGQ--VINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAET-----GRINLVKDAVCKWDAENSIKN-VVVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            K LY+S++L +L +KAE+ K + SS     +   K+++  E   LD+DEE + +  M++L++   +KK   F +   +  S     +   A E+A KL  SL+ RY+ +                           +       + + +K  + E P        K +I+ E L++++K    + LV+D RP+ +F  S IS      I++P   +  G T+  +   L + +    L+ W +R     V+L+ W S+ +       +  +KDA+ KWD    +++  +VL+ G+ S+L  YP   +N+K K P + T +   Q  N  YP  E
Sbjct:    9 KDLYLSTSLGDLNKKAEI-KPDKSSTRHYVQSACKIFKAAEECRLDRDEERAYVLYMKYLSVYDLIKKRPDFKQQQEFFLSMLGPTSFKKAIEEAEKLSESLKLRYEEVEVRKKLEEKERKEEKSRREERTEKKDGRASPQANTERKDSKKQVKEEPNNSKSVCDKGSISAEALFRLMKDSSISVLVMDARPALDFQESQISVPSQTCISVPEEAISPGVTVNQMELKLPAES----LSEWKRRGFVDYVVLLDWFSSVSDLRLGSTLQSLKDALYKWDNSTILRSEPLVLDGGYESWLLFYPMYTSNAKVKPPRQQTPSTLPQ-LNFTYPSLE 336          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp2b (ubiquitin specific peptidase 2b [Source:ZFIN;Acc:ZDB-GENE-100208-2])

HSP 1 Score: 231.106 bits (588), Expect = 1.011e-66
Identity = 138/339 (40.71%), Postives = 196/339 (57.82%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYRE-VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNE-DKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT  L +Y L N+++ D+N  N       ++ EFA L   +WT    E +SPSDFK  I      F G  Q D+QEFL FLLDGLH ++NR +  S+   PV + D +++ E+  + W  ++   DS +V +F GQ +S +TC  C   S  FD F  LSLP+       SL DCL+LF  E+ + G  +  C +CK+ R   KK  I K P  L++HLKRFS       KL+TFV+FP++    +D+ +       +  Y+LYAVSNH G    GHYT++C++    EW+ Y+D  V+ +    V +   Y+LFYE
Sbjct:   60 GLVGLRNLGNTCFMNSILQCLSNTHDLRDYCLRNTHRTDLN--NNCRAKAALMDEFAKLTQTIWTSASNEAISPSDFKMQIQKYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVKSRA--PVEDLDHLSEDEKGKRMWNKYLESEDSKVVDLFVGQLKSSLTCSECGFCSTVFDPFWDLSLPIAKTSGEVSLNDCLRLFTKEDVLDGNERPTCHRCKTRRKCTKKFTIQKFPKILVLHLKRFSECRVRTSKLSTFVNFPLKE---LDLREFASDNSVNAVYNLYAVSNHTGTSLGGHYTAYCRSPCTGEWYTYNDSRVSPMSSSQVCSSDAYVLFYE 391          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp2a (ubiquitin specific peptidase 2a [Source:ZFIN;Acc:ZDB-GENE-041212-59])

HSP 1 Score: 224.942 bits (572), Expect = 1.424e-64
Identity = 137/342 (40.06%), Postives = 194/342 (56.73%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPS-DFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNL 2984
            GL GLRN+GNTC+MNS++Q LSNT+ L +Y L NS++ D+N +N       ++ EFA LI  +WT +  E     +FK  I      F G  Q D+QEFL FLLDGLH ++NR +   +     + D + D E+  + W  ++   DS IV +F GQ +S +TC  C   S  FD F  LSLP+   +   SL DC++LF  E+ + G  +  C +CK+ R   KK  + K P  L++HLKRFS       KL+TFV+FPM+    +D+ +          Y+LYAVSNH G    GHYT++C N +  EW+ Y+D  VT +    V++   Y+LFYE   L
Sbjct:   59 GLVGLRNLGNTCFMNSILQCLSNTQSLRDYCLHNSHRRDLNNNNRTHTA--LMEEFAKLIQTMWTSSSSEAVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPRGNTE-DFDHLPDEEKGKKMWSKYLEREDSKIVDLFVGQLKSSLTCSECGYCSTVFDPFWDLSLPIAKGYGEVSLMDCMRLFTKEDVLDGDEKPTCYRCKARRRCTKKFTVQKFPKILVLHLKRFSEARIRTSKLSTFVNFPMKD---LDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYCCNPENGEWYTYNDSRVTPMSASQVRSSDAYVLFYERAGL 394          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp21 (ubiquitin specific peptidase 21 [Source:ZFIN;Acc:ZDB-GENE-100210-3])

HSP 1 Score: 170.629 bits (431), Expect = 1.522e-45
Identity = 121/346 (34.97%), Postives = 179/346 (51.73%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDN-PLGYGGEIVIEFAYLITALWTGNYRE--VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDI---ERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL--VANHNRC-SLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            G  GLRN+GNTC++N++VQ LS+T+ L +Y L  +Y  D + +  P+     ++ EF+ ++  LW  +  E  V+P  F R+       F G  Q D+QEFL FLLD LH ++NR        +   E   T     E A   W+ H+  +DS IV +F GQ RS + C  C   S TFD F  LSLP+   +++ R  +L +CL LF  EE++   +   C +C     + K++ I + P  L+IHL RF+ +     K    V FP+ +  L         P  +D   LYAV NH G +  GHYT+ C+  +   W  Y+D  V  I E  +++   Y+LFYE
Sbjct:   60 GQVGLRNVGNTCFLNAIVQCLSHTRSLRDYCLMRAYVQDKHSNQEPV-----LMDEFSKVLAGLWECDAGETTVNPGKFYRVFKESVPYFSGYSQQDAQEFLRFLLDRLHTEINRRPSKRPAVIERKEPAYTRFRISEEAFAMWQRHLDRDDSKIVDLFSGQLRSSLHCSVCSHYSNTFDVFCDLSLPIPKKSDYGRAVTLRECLDLFSQEEKLDKENSPMCERCNRRTESTKRLTIQRFPRVLVIHLNRFAMSRFSISKSTVPVSFPLTALDLGLFGPVDCGPVLYD---LYAVCNHSGTVNMGHYTAACREEEG--WCFYNDSCVDAISEEKLQSNQAYVLFYE 395          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Match: usp21 (ubiquitin specific peptidase 21 [Source:ZFIN;Acc:ZDB-GENE-100210-3])

HSP 1 Score: 170.629 bits (431), Expect = 1.522e-45
Identity = 121/346 (34.97%), Postives = 179/346 (51.73%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDN-PLGYGGEIVIEFAYLITALWTGNYRE--VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDI---ERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL--VANHNRC-SLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            G  GLRN+GNTC++N++VQ LS+T+ L +Y L  +Y  D + +  P+     ++ EF+ ++  LW  +  E  V+P  F R+       F G  Q D+QEFL FLLD LH ++NR        +   E   T     E A   W+ H+  +DS IV +F GQ RS + C  C   S TFD F  LSLP+   +++ R  +L +CL LF  EE++   +   C +C     + K++ I + P  L+IHL RF+ +     K    V FP+ +  L         P  +D   LYAV NH G +  GHYT+ C+  +   W  Y+D  V  I E  +++   Y+LFYE
Sbjct:   60 GQVGLRNVGNTCFLNAIVQCLSHTRSLRDYCLMRAYVQDKHSNQEPV-----LMDEFSKVLAGLWECDAGETTVNPGKFYRVFKESVPYFSGYSQQDAQEFLRFLLDRLHTEINRRPSKRPAVIERKEPAYTRFRISEEAFAMWQRHLDRDDSKIVDLFSGQLRSSLHCSVCSHYSNTFDVFCDLSLPIPKKSDYGRAVTLRECLDLFSQEEKLDKENSPMCERCNRRTESTKRLTIQRFPRVLVIHLNRFAMSRFSISKSTVPVSFPLTALDLGLFGPVDCGPVLYD---LYAVCNHSGTVNMGHYTAACREEEG--WCFYNDSCVDAISEEKLQSNQAYVLFYE 395          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: USP8 (ubiquitin specific peptidase 8 [Source:NCBI gene;Acc:100124309])

HSP 1 Score: 358.221 bits (918), Expect = 3.619e-107
Identity = 207/489 (42.33%), Postives = 291/489 (59.51%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECST--QRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP--CSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLK 2987
            P +P       +  T  Y Y  +  +    YPP E+  +S   +T  Q+  V+   D   I+K  +K      LKRS S P+L+                I +  K+  +P +NR  KP   +    T+  AS++ + NP +    P LTGLRN+GNTCYMNS++Q L NT  L  Y   N YQ  INR N LG+ GE+  EF  ++ ALWTG Y+ +SP DFK  I   NE F G    DSQE LLFL+DGLHEDLN+     K     N D ++D + A+ +W  H  +N+S+IV +FQGQ++S V C  CQ  S TF+AFMYLSLPL +  ++CSL+DC+K F  EE++T ++++ C  CK+ R A KKI+IWKLPP LL+HLKRFS  G++RQKL ++VDFP+ES   +D+ ++   P+   TY+L+ VSNH+G ++ GHYT++CKN     W  +DD  V++I    VKT + Y+LFY S + +
Sbjct:  462 PGMPEGWVKFLEPVTGTYRYYHSPTHTVHMYPP-EMAPSSTPSTTPAQKAKVQATTD---IDKEQTK------LKRSYSSPDLT--------------QAIKDEDKKKPMPHINRENKPSIVTKAEITKLPASKIRSLNPVFGGAGPALTGLRNLGNTCYMNSILQCLCNTPHLIEYFNNNFYQAHINRSNLLGHKGEVAEEFGCIMRALWTGQYKYISPKDFKITIGKINEQFAGYTHQDSQELLLFLMDGLHEDLNKADN-RKRQKEENNDHLSDSQAADSAWYKHKQLNESIIVALFQGQFKSTVQCLTCQKKSRTFEAFMYLSLPLPST-SKCSLQDCIKAFAKEEKLTDSNRFDCSNCKTQRVATKKIEIWKLPPILLVHLKRFSFEGRWRQKLQSYVDFPLES---LDLSQYVIGPKNVKTYNLFGVSNHYGGLDGGHYTAYCKNALKQRWFKFDDHDVSEISVSSVKTSAAYMLFYTSLDAR 921          

HSP 2 Score: 69.707 bits (169), Expect = 2.384e-11
Identity = 66/259 (25.48%), Postives = 123/259 (47.49%), Query Frame = 3
Query:  192 AKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKAFSKDASYITSHFNTKTIDIAFEK-----------AGKLKASLEERYKCIPKIEEIPTVQVEI-TKDTITETPKDNITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW----NSAETGR-INLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETT 911
             K++++ E   L+ DEE + ++ M++L +   +KK      + + S F   TI +  +K             +++  LEER     + E++   + ++  KD   + PK N   E L+++      +++I DVR + +F  SHI     I++P   +  G T   +   L   +  +    WNKR     +IL+ W    N+ + G  +  +KDA+ KW+ +  +++  +VLE G+ ++L  YP   TN K   P + T
Sbjct:   41 CKIFQKAEECRLEGDEEKAYVFYMKYLFVFELLKKRSDFKQNQVLSIFIYLTIYLILKKNPLLYLLKIYEEAEVRKKLEER----ERQEDLKKKEGKLFPKDFPEDVPKPNQN-EMLFEMTNDYNISIIIMDVRSTKDFQESHIRTS--ISVPEEAIIPGFTSSKIETNLPDTSKEM----WNKRGQVDFIILLDWFSSVNNLKVGTTLQSLKDALYKWETKTILRSEPLVLEGGYENWLLCYPMFTTNGKVTVPRKRT 288          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: USP8 (ubiquitin specific peptidase 8 [Source:NCBI gene;Acc:100124309])

HSP 1 Score: 358.607 bits (919), Expect = 2.808e-106
Identity = 207/489 (42.33%), Postives = 291/489 (59.51%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECST--QRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP--CSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLK 2987
            P +P       +  T  Y Y  +  +    YPP E+  +S   +T  Q+  V+   D   I+K  +K      LKRS S P+L+                I +  K+  +P +NR  KP   +    T+  AS++ + NP +    P LTGLRN+GNTCYMNS++Q L NT  L  Y   N YQ  INR N LG+ GE+  EF  ++ ALWTG Y+ +SP DFK  I   NE F G    DSQE LLFL+DGLHEDLN+     K     N D ++D + A+ +W  H  +N+S+IV +FQGQ++S V C  CQ  S TF+AFMYLSLPL +  ++CSL+DC+K F  EE++T ++++ C  CK+ R A KKI+IWKLPP LL+HLKRFS  G++RQKL ++VDFP+ES   +D+ ++   P+   TY+L+ VSNH+G ++ GHYT++CKN     W  +DD  V++I    VKT + Y+LFY S + +
Sbjct:  593 PGMPEGWVKFLEPVTGTYRYYHSPTHTVHMYPP-EMAPSSTPSTTPAQKAKVQATTD---IDKEQTK------LKRSYSSPDLT--------------QAIKDEDKKKPMPHINRENKPSIVTKAEITKLPASKIRSLNPVFGGAGPALTGLRNLGNTCYMNSILQCLCNTPHLIEYFNNNFYQAHINRSNLLGHKGEVAEEFGCIMRALWTGQYKYISPKDFKITIGKINEQFAGYTHQDSQELLLFLMDGLHEDLNKADN-RKRQKEENNDHLSDSQAADSAWYKHKQLNESIIVALFQGQFKSTVQCLTCQKKSRTFEAFMYLSLPLPST-SKCSLQDCIKAFAKEEKLTDSNRFDCSNCKTQRVATKKIEIWKLPPILLVHLKRFSFEGRWRQKLQSYVDFPLES---LDLSQYVIGPKNVKTYNLFGVSNHYGGLDGGHYTAYCKNALKQRWFKFDDHDVSEISVSSVKTSAAYMLFYTSLDAR 1052          

HSP 2 Score: 82.4185 bits (202), Expect = 2.946e-15
Identity = 78/300 (26.00%), Postives = 133/300 (44.33%), Query Frame = 3
Query:  195 KLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERY-----------------------KCIPK--IEEIPTV-----------QVEITKDTITETPKDNITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW----NSAETGR-INLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            K++++ E   L+ DEE + ++ M++L +   +KK   F ++  Y  S     TI  + E+A KL  SL+ RY                       K  PK   E++P             +V   +   T  P   ITVE+L+++      +++I DVR + +F  SHI     I++P   +  G T   +   L   +  +    WNKR     +IL+ W    N+ + G  +  +KDA+ KW+ +  +++  +VLE G+ ++L  YP   TN K   P + T  +     +  YP  E
Sbjct:   42 KIFQKAEECRLEGDEEKAYVFYMKYLFVFELLKKRSDFKQNQDYYKSLLGPSTILKSVEEAEKLSESLKNRYEEAEVRKKLEERERQEDLKKKEGKLFPKDFPEDVPKPNQNEMVNGEKNEVLSKRPEPTNVPHGAITVEKLFEMTNDYNISIIIMDVRSTKDFQESHIRTS--ISVPEEAIIPGFTSSKIETNLPDTSKEM----WNKRGQVDFIILLDWFSSVNNLKVGTTLQSLKDALYKWETKTILRSEPLVLEGGYENWLLCYPMFTTNGKVTVPRKRTQESVSLSLDFSYPSLE 335          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: USP8 (ubiquitin specific peptidase 8 [Source:NCBI gene;Acc:100124309])

HSP 1 Score: 283.108 bits (723), Expect = 5.281e-80
Identity = 200/551 (36.30%), Postives = 283/551 (51.36%), Query Frame = 3
Query: 1374 LESVDAVSDLNAPTETTPRLSNNSRTYHDRTNFTAKGGAKSIPPP---------TDVIESKKPDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECST--QRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP--CSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLK 2987
            LE    V     P ET  RL +N     DR     K G  S+ P          ++ +    P +P       +  T  Y Y  +  +    YPP E+  +S   +T  Q+  V+   D   I+K  +K      LKRS S P+L+                I +  K+  +P +NR  KP   +    T+  AS++ + NP +    P LTGLRN+GNTCYMNS++Q L NT  L  Y   N YQ  INR N LG+ GE+  EF  ++ ALWTG Y+ +SP DFK  I   NE F G    DSQE LLFL+DGLHEDLN+     K     N D ++D + A+ +W  H  +N+S+IV +FQGQ++S V C  CQ  S TF+AFMYLSLPL +  ++CSL+    +FL +                       +     P  +L   K FS  G++RQKL ++VDFP+ES   +D+ ++   P+   TY+L+ VSNH+G ++ GHYT++CKN     W  +DD  V++I    VKT + Y+LFY S + +
Sbjct:  447 LEKKQPVVAGKEPAETK-RLESNKPPPDDR----KKNGHSSVTPQEREPLVRARSEEMGRTVPGMPEGWVKFLEPVTGTYRYYHSPTHTVHMYPP-EMAPSSTPSTTPAQKAKVQATTD---IDKEQTK------LKRSYSSPDLTQ--------------AIKDEDKKKPMPHINRENKPSIVTKAEITKLPASKIRSLNPVFGGAGPALTGLRNLGNTCYMNSILQCLCNTPHLIEYFNNNFYQAHINRSNLLGHKGEVAEEFGCIMRALWTGQYKYISPKDFKITIGKINEQFAGYTHQDSQELLLFLMDGLHEDLNKADN-RKRQKEENNDHLSDSQAADSAWYKHKQLNESIIVALFQGQFKSTVQCLTCQKKSRTFEAFMYLSLPLPST-SKCSLQ-VSNMFLFQ-----------------------LSNISFP--VLFFTKSFSFEGRWRQKLQSYVDFPLES---LDLSQYVIGPKNVKTYNLFGVSNHYGGLDGGHYTAYCKNALKQRWFKFDDHDVSEISVSSVKTSAAYMLFYTSLDAR 937          

HSP 2 Score: 80.1073 bits (196), Expect = 1.701e-14
Identity = 68/264 (25.76%), Postives = 119/264 (45.08%), Query Frame = 3
Query:  195 KLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYKCIPKIEEIPTVQVEITKDTITETPKDNITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW----NSAETGR-INLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            K++++ E   L+ DEE + ++ M++L +   +KK   F ++  Y  S     TI  + E+A KL                             +E P   ITVE+L+++      +++I DVR + +F  SHI     I++P   +  G T   +   L   +  +    WNKR     +IL+ W    N+ + G  +  +KDA+ KW+ +  +++  +VLE G+ ++L  YP   TN K   P + T  +     +  YP  E
Sbjct:   42 KIFQKAEECRLEGDEEKAYVFYMKYLFVFELLKKRSDFKQNQDYYKSLLGPSTILKSVEEAEKL-----------------------------SEMPHGAITVEKLFEMTNDYNISIIIMDVRSTKDFQESHIRTS--ISVPEEAIIPGFTSSKIETNLPDTSKEM----WNKRGQVDFIILLDWFSSVNNLKVGTTLQSLKDALYKWETKTILRSEPLVLEGGYENWLLCYPMFTTNGKVTVPRKRTQESVSLSLDFSYPSLE 270          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: USP8 (ubiquitin specific peptidase 8 [Source:NCBI gene;Acc:100124309])

HSP 1 Score: 282.722 bits (722), Expect = 1.690e-79
Identity = 185/489 (37.83%), Postives = 263/489 (53.78%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECST--QRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP--CSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLK 2987
            P +P       +  T  Y Y  +  +    YPP E+  +S   +T  Q+  V+   D   I+K  +K      LKRS S P+L+                I +  K+  +P +NR  KP   +    T+  AS++ + NP +    P LTGLRN+GNTCYMNS++Q L NT  L  Y   N YQ  INR N LG+ GE+  EF  ++ ALWTG Y+ +SP DFK  I   NE F G    DSQE LLFL+DGLHEDLN+     K     N D ++D + A+ +W  H  +N+S+IV +FQGQ++S V C  CQ  S TF+AFMYLSLPL +  ++CSL+    +FL +                       +     P  +L   K FS  G++RQKL ++VDFP+ES   +D+ ++   P+   TY+L+ VSNH+G ++ GHYT++CKN     W  +DD  V++I    VKT + Y+LFY S + +
Sbjct:  561 PGMPEGWVKFLEPVTGTYRYYHSPTHTVHMYPP-EMAPSSTPSTTPAQKAKVQATTD---IDKEQTK------LKRSYSSPDLTQ--------------AIKDEDKKKPMPHINRENKPSIVTKAEITKLPASKIRSLNPVFGGAGPALTGLRNLGNTCYMNSILQCLCNTPHLIEYFNNNFYQAHINRSNLLGHKGEVAEEFGCIMRALWTGQYKYISPKDFKITIGKINEQFAGYTHQDSQELLLFLMDGLHEDLNKADN-RKRQKEENNDHLSDSQAADSAWYKHKQLNESIIVALFQGQFKSTVQCLTCQKKSRTFEAFMYLSLPLPST-SKCSLQ-VSNMFLFQ-----------------------LSNISFP--VLFFTKSFSFEGRWRQKLQSYVDFPLES---LDLSQYVIGPKNVKTYNLFGVSNHYGGLDGGHYTAYCKNALKQRWFKFDDHDVSEISVSSVKTSAAYMLFYTSLDAR 994          

HSP 2 Score: 81.2629 bits (199), Expect = 6.107e-15
Identity = 75/274 (27.37%), Postives = 129/274 (47.08%), Query Frame = 3
Query:  195 KLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYK---CIPKIEEIPTVQ-------VEITKDTITETPKDNITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW----NSAETGR-INLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            K++++ E   L+ DEE + ++ M++L +   +KK   F ++  Y  S     TI  + E+A KL  SL+ RY+      K+EE    +           KD   + PK N   E L+++      +++I DVR + +F  SHI     I++P   +  G T   +   L   +  +    WNKR     +IL+ W    N+ + G  +  +KDA+ KW+ +  +++  +VLE G+ ++L  YP   TN K   P + T  +     +  YP  E
Sbjct:   42 KIFQKAEECRLEGDEEKAYVFYMKYLFVFELLKKRSDFKQNQDYYKSLLGPSTILKSVEEAEKLSESLKNRYEEAEVRKKLEERERQEDLKKKEGKLFPKDFPEDVPKPNQN-EMLFEMTNDYNISIIIMDVRSTKDFQESHIRTS--ISVPEEAIIPGFTSSKIETNLPDTSKEM----WNKRGQVDFIILLDWFSSVNNLKVGTTLQSLKDALYKWETKTILRSEPLVLEGGYENWLLCYPMFTTNGKVTVPRKRTQESVSLSLDFSYPSLE 308          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Match: USP8 (ubiquitin specific peptidase 8 [Source:NCBI gene;Acc:100124309])

HSP 1 Score: 282.722 bits (722), Expect = 2.235e-79
Identity = 184/489 (37.63%), Postives = 262/489 (53.58%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECST--QRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP--CSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLK 2987
            P +P       +  T  Y Y  +  +    YPP E+  +S   +T  Q+  V+   D   I+K  +K      LKRS S P+L+                I +  K+  +P +NR  KP   +    T+  AS++ + NP +    P LTGLRN+GNTCYMNS++Q L NT  L  Y   N YQ  INR N LG+ GE+  EF  ++ ALWTG Y+ +SP DFK  I   NE F G    DSQE LLFL+DGLHEDLN+     K     N D ++D + A+ +W  H  +N+S+IV +FQGQ++S V C  CQ  S TF+AFMYLSLPL +  ++CSL+  +K       ++                         P  +L   K FS  G++RQKL ++VDFP+ES   +D+ ++   P+   TY+L+ VSNH+G ++ GHYT++CKN     W  +DD  V++I    VKT + Y+LFY S + +
Sbjct:  593 PGMPEGWVKFLEPVTGTYRYYHSPTHTVHMYPP-EMAPSSTPSTTPAQKAKVQATTD---IDKEQTK------LKRSYSSPDLT--------------QAIKDEDKKKPMPHINRENKPSIVTKAEITKLPASKIRSLNPVFGGAGPALTGLRNLGNTCYMNSILQCLCNTPHLIEYFNNNFYQAHINRSNLLGHKGEVAEEFGCIMRALWTGQYKYISPKDFKITIGKINEQFAGYTHQDSQELLLFLMDGLHEDLNKADN-RKRQKEENNDHLSDSQAADSAWYKHKQLNESIIVALFQGQFKSTVQCLTCQKKSRTFEAFMYLSLPLPST-SKCSLQ--IKFLFQLSNIS------------------------FP--VLFFTKSFSFEGRWRQKLQSYVDFPLES---LDLSQYVIGPKNVKTYNLFGVSNHYGGLDGGHYTAYCKNALKQRWFKFDDHDVSEISVSSVKTSAAYMLFYTSLDAR 1024          

HSP 2 Score: 82.8037 bits (203), Expect = 2.214e-15
Identity = 78/300 (26.00%), Postives = 133/300 (44.33%), Query Frame = 3
Query:  195 KLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERY-----------------------KCIPK--IEEIPTV-----------QVEITKDTITETPKDNITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW----NSAETGR-INLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            K++++ E   L+ DEE + ++ M++L +   +KK   F ++  Y  S     TI  + E+A KL  SL+ RY                       K  PK   E++P             +V   +   T  P   ITVE+L+++      +++I DVR + +F  SHI     I++P   +  G T   +   L   +  +    WNKR     +IL+ W    N+ + G  +  +KDA+ KW+ +  +++  +VLE G+ ++L  YP   TN K   P + T  +     +  YP  E
Sbjct:   42 KIFQKAEECRLEGDEEKAYVFYMKYLFVFELLKKRSDFKQNQDYYKSLLGPSTILKSVEEAEKLSESLKNRYEEAEVRKKLEERERQEDLKKKEGKLFPKDFPEDVPKPNQNEMVNGEKNEVLSKRPEPTNVPHGAITVEKLFEMTNDYNISIIIMDVRSTKDFQESHIRTS--ISVPEEAIIPGFTSSKIETNLPDTSKEM----WNKRGQVDFIILLDWFSSVNNLKVGTTLQSLKDALYKWETKTILRSEPLVLEGGYENWLLCYPMFTTNGKVTVPRKRTQESVSLSLDFSYPSLE 335          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp8 (ubiquitin specific peptidase 8 [Source:MGI Symbol;Acc:MGI:1934029])

HSP 1 Score: 342.428 bits (877), Expect = 2.718e-100
Identity = 191/416 (45.91%), Postives = 263/416 (63.22%), Query Frame = 3
Query: 1740 SSLKRSTSQPNLSDDLISH--KPPMSTDNSIITNTSKQYELPALNRLTKP-CSTKT-FTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            S LKRS S P+++  L     + P  T              P +NR  KP C  K   +  SAS++ N NP +    P LTGLRN+GNTCYMNS++Q L N   L +Y   N YQ DINR N LG+ GE+  EF  ++ ALWTG YR +SP DFK  I   N+ F GS Q DSQE LLFL+DGLHEDLN+     K     N + + D++ A  +W+ H  +N+S+IV +FQGQ++S V C  C+  S TF+AFMYLSLPL A+ ++C+L+DCL+LF  EE++T  ++++C  C++ R++ KKI+IWKLPP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+L++VSNH+G ++ GHYT++CKN     W  +DD  V+ I    V++ + YILFY S
Sbjct:  673 SKLKRSYSSPDITQALQEEEKRRPAVT--------------PMVNRENKPPCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKVTIGKINDQFAGSSQQDSQELLLFLMDGLHEDLNKADN-RKRHKEENNEHLDDLQAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCRRRSRTFEAFMYLSLPL-ASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNSLKK--YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVRSSAAYILFYTS 1070          

HSP 2 Score: 79.7221 bits (195), Expect = 1.825e-14
Identity = 87/339 (25.66%), Postives = 148/339 (43.66%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYK---CIPKIEE------------------------IPTVQVEITKDTITETPKDN--------------ITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAETG-----RINLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            K LY+SS+L +L +K E+ K E +S         K+++  E   LD+DEE + +  M+++ +   +KK   F +   Y  S      I  A E+A +L  SL+ RY+      ++EE                             VE   D+ T+T + N              IT +ELY ++  K  +L+I D R   ++ +S I     +++P   +  G T   +   L   +DS   + W KR S   V+L+ W S+         +  +KDA+ KW+++  +++  +VLE G+ ++L  YP   TN+K   P  +         +  YP  E
Sbjct:    9 KELYLSSSLKDLNKKTEV-KPEKTSTKNYIHSAQKIFKTAEECRLDRDEERAYVLYMKYVAVYNLIKKRPDFKQQQDYYLSILGPANIKKAIEEAERLSESLKLRYEEAEVRKQLEEKDRREEEQLQQQKRQEMGREDSGAAAKRSVENLLDSKTKTQRINGEKSEGAAAAERGAITAKELYTMMMDKNTSLIIMDARKIQDYQHSCIL--DSLSVPEEAISPGVTASWIEANLS--DDSK--DTWKKRGSVDYVVLLDWFSSAKDLLLGTTLRSLKDALFKWESKTVLRHEPLVLEGGYENWLLCYPQFTTNAKVTPPPRSRAEEVSVSLDFTYPSLE 340          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp8 (ubiquitin specific peptidase 8 [Source:MGI Symbol;Acc:MGI:1934029])

HSP 1 Score: 342.043 bits (876), Expect = 3.835e-100
Identity = 191/416 (45.91%), Postives = 263/416 (63.22%), Query Frame = 3
Query: 1740 SSLKRSTSQPNLSDDLISH--KPPMSTDNSIITNTSKQYELPALNRLTKP-CSTKT-FTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            S LKRS S P+++  L     + P  T              P +NR  KP C  K   +  SAS++ N NP +    P LTGLRN+GNTCYMNS++Q L N   L +Y   N YQ DINR N LG+ GE+  EF  ++ ALWTG YR +SP DFK  I   N+ F GS Q DSQE LLFL+DGLHEDLN+     K     N + + D++ A  +W+ H  +N+S+IV +FQGQ++S V C  C+  S TF+AFMYLSLPL A+ ++C+L+DCL+LF  EE++T  ++++C  C++ R++ KKI+IWKLPP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+L++VSNH+G ++ GHYT++CKN     W  +DD  V+ I    V++ + YILFY S
Sbjct:  684 SKLKRSYSSPDITQALQEEEKRRPAVT--------------PMVNRENKPPCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKVTIGKINDQFAGSSQQDSQELLLFLMDGLHEDLNKADN-RKRHKEENNEHLDDLQAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCRRRSRTFEAFMYLSLPL-ASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNSLKK--YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVRSSAAYILFYTS 1081          

HSP 2 Score: 77.0258 bits (188), Expect = 1.140e-13
Identity = 86/349 (24.64%), Postives = 148/349 (42.41%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMNK----------IELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYK---CIPKIEE------------------------IPTVQVEITKDTITETPKDN--------------ITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAETG-----RINLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            K LY+SS+L +L +K E+             + SS +       K+++  E   LD+DEE + +  M+++ +   +KK   F +   Y  S      I  A E+A +L  SL+ RY+      ++EE                             VE   D+ T+T + N              IT +ELY ++  K  +L+I D R   ++ +S I     +++P   +  G T   +   L   +DS   + W KR S   V+L+ W S+         +  +KDA+ KW+++  +++  +VLE G+ ++L  YP   TN+K   P  +         +  YP  E
Sbjct:    9 KELYLSSSLKDLNKKTEVKPEKTSTKNTKFCKFSSFLSYIHSAQKIFKTAEECRLDRDEERAYVLYMKYVAVYNLIKKRPDFKQQQDYYLSILGPANIKKAIEEAERLSESLKLRYEEAEVRKQLEEKDRREEEQLQQQKRQEMGREDSGAAAKRSVENLLDSKTKTQRINGEKSEGAAAAERGAITAKELYTMMMDKNTSLIIMDARKIQDYQHSCIL--DSLSVPEEAISPGVTASWIEANLS--DDSK--DTWKKRGSVDYVVLLDWFSSAKDLLLGTTLRSLKDALFKWESKTVLRHEPLVLEGGYENWLLCYPQFTTNAKVTPPPRSRAEEVSVSLDFTYPSLE 351          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp2 (ubiquitin specific peptidase 2 [Source:MGI Symbol;Acc:MGI:1858178])

HSP 1 Score: 216.468 bits (550), Expect = 1.864e-61
Identity = 134/339 (39.53%), Postives = 194/339 (57.23%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREV-SPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVA-NHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT+ L +Y L   Y  D+   +       ++ EFA LI  +WT +  +V SPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR +   K + P   D + D E+  Q W+ ++   DS I  +F GQ +S +TC  C   S  FD F  LSLP+    +   +L DC++LF  E+ + G  +  C +C++ +   KK  + + P  L++HLKRFS +     KL TFV+FP+     +D+ +   +   H  Y+LYAVSNH G    GHYT++C++    EWH ++D  VT +    V+T   Y+LFYE
Sbjct:   56 GLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLGHTS--SAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKAS-PETLDHLPDEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDILDGDEKPTCCRCRARKRCIKKFSVQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRD---LDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 388          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp2 (ubiquitin specific peptidase 2 [Source:MGI Symbol;Acc:MGI:1858178])

HSP 1 Score: 216.083 bits (549), Expect = 2.031e-61
Identity = 134/339 (39.53%), Postives = 194/339 (57.23%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREV-SPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVA-NHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT+ L +Y L   Y  D+   +       ++ EFA LI  +WT +  +V SPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR +   K + P   D + D E+  Q W+ ++   DS I  +F GQ +S +TC  C   S  FD F  LSLP+    +   +L DC++LF  E+ + G  +  C +C++ +   KK  + + P  L++HLKRFS +     KL TFV+FP+     +D+ +   +   H  Y+LYAVSNH G    GHYT++C++    EWH ++D  VT +    V+T   Y+LFYE
Sbjct:   53 GLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLGHTS--SAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKAS-PETLDHLPDEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDILDGDEKPTCCRCRARKRCIKKFSVQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRD---LDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 385          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Match: Usp2 (ubiquitin specific peptidase 2 [Source:MGI Symbol;Acc:MGI:1858178])

HSP 1 Score: 218.394 bits (555), Expect = 5.484e-60
Identity = 134/339 (39.53%), Postives = 194/339 (57.23%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREV-SPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVA-NHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT+ L +Y L   Y  D+   +       ++ EFA LI  +WT +  +V SPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR +   K + P   D + D E+  Q W+ ++   DS I  +F GQ +S +TC  C   S  FD F  LSLP+    +   +L DC++LF  E+ + G  +  C +C++ +   KK  + + P  L++HLKRFS +     KL TFV+FP+     +D+ +   +   H  Y+LYAVSNH G    GHYT++C++    EWH ++D  VT +    V+T   Y+LFYE
Sbjct:  279 GLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLGHTSSAHTA--LMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKAS-PETLDHLPDEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDILDGDEKPTCCRCRARKRCIKKFSVQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRD---LDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 611          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|Q80U87|UBP8_MOUSE (Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus OX=10090 GN=Usp8 PE=1 SV=2)

HSP 1 Score: 342.428 bits (877), Expect = 1.901e-99
Identity = 191/416 (45.91%), Postives = 263/416 (63.22%), Query Frame = 3
Query: 1740 SSLKRSTSQPNLSDDLISH--KPPMSTDNSIITNTSKQYELPALNRLTKP-CSTKT-FTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            S LKRS S P+++  L     + P  T              P +NR  KP C  K   +  SAS++ N NP +    P LTGLRN+GNTCYMNS++Q L N   L +Y   N YQ DINR N LG+ GE+  EF  ++ ALWTG YR +SP DFK  I   N+ F GS Q DSQE LLFL+DGLHEDLN+     K     N + + D++ A  +W+ H  +N+S+IV +FQGQ++S V C  C+  S TF+AFMYLSLPL A+ ++C+L+DCL+LF  EE++T  ++++C  C++ R++ KKI+IWKLPP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+L++VSNH+G ++ GHYT++CKN     W  +DD  V+ I    V++ + YILFY S
Sbjct:  673 SKLKRSYSSPDITQALQEEEKRRPAVT--------------PMVNRENKPPCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKVTIGKINDQFAGSSQQDSQELLLFLMDGLHEDLNKADN-RKRHKEENNEHLDDLQAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCRRRSRTFEAFMYLSLPL-ASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNSLKK--YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVRSSAAYILFYTS 1070          

HSP 2 Score: 79.7221 bits (195), Expect = 1.276e-13
Identity = 87/339 (25.66%), Postives = 148/339 (43.66%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYK---CIPKIEE------------------------IPTVQVEITKDTITETPKDN--------------ITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAETG-----RINLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            K LY+SS+L +L +K E+ K E +S         K+++  E   LD+DEE + +  M+++ +   +KK   F +   Y  S      I  A E+A +L  SL+ RY+      ++EE                             VE   D+ T+T + N              IT +ELY ++  K  +L+I D R   ++ +S I     +++P   +  G T   +   L   +DS   + W KR S   V+L+ W S+         +  +KDA+ KW+++  +++  +VLE G+ ++L  YP   TN+K   P  +         +  YP  E
Sbjct:    9 KELYLSSSLKDLNKKTEV-KPEKTSTKNYIHSAQKIFKTAEECRLDRDEERAYVLYMKYVAVYNLIKKRPDFKQQQDYYLSILGPANIKKAIEEAERLSESLKLRYEEAEVRKQLEEKDRREEEQLQQQKRQEMGREDSGAAAKRSVENLLDSKTKTQRINGEKSEGAAAAERGAITAKELYTMMMDKNTSLIIMDARKIQDYQHSCIL--DSLSVPEEAISPGVTASWIEANLS--DDSK--DTWKKRGSVDYVVLLDWFSSAKDLLLGTTLRSLKDALFKWESKTVLRHEPLVLEGGYENWLLCYPQFTTNAKVTPPPRSRAEEVSVSLDFTYPSLE 340          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|P40818|UBP8_HUMAN (Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 1.452e-98
Identity = 204/484 (42.15%), Postives = 280/484 (57.85%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINK-SMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP-CSTKT-FTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            P LP       D  T  + Y  +  N    YPP        E +       T   H A  +    +    S LKRS S P+++  +   +    T    +T        P +NR  KP C  K   +  SAS++ N NP +    P LTGLRN+GNTCYMNS++Q L N   L +Y   N YQ DINR N LG+ GE+  EF  ++ ALWTG YR +SP DFK  I   N+ F G  Q DSQE LLFL+DGLHEDLN+     +     N D + D + A  +W+ H  +N+S+IV +FQGQ++S V C  C   S TF+AFMYLSLPL A+ ++C+L+DCL+LF  EE++T  ++++C  C++ R++ KKI+IWKLPP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+L++VSNH+G ++ GHYT++CKN     W  +DD  V+ I    VK+ + YILFY S
Sbjct:  649 PGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPP--------EMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPT----VT--------PTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYK-EENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPL-ASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKK--YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTS 1108          

HSP 2 Score: 83.5741 bits (205), Expect = 8.394e-15
Identity = 88/321 (27.41%), Postives = 149/321 (46.42%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMN--KIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYK---CIPKIEE------------------------IPTVQVEITKDTITETPKDN--------------ITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW-NSAETGRINL----VKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGP 899
            K LY+SS+L +L +K E+   KI   S + S     K+++  E   LD+DEE + +  M+++T+   +KK   F +   Y  S      I  A E+A +L  SL+ RY+      K+EE                        +    +E   D+  +T K N              IT +ELY ++  K  +L+I D R   ++ +S I +   +++P   +  G T   +   L   +DS   + W KR +   V+L+ W +SA+  +I      +KDA+ KW+++  ++N  +VLE G+ ++L  YP   TN+K   P
Sbjct:    9 KELYLSSSLKDLNKKTEVKPEKISTKSYVHSA---LKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHS--LSVPEEAISPGVTASWIEAHLP--DDSK--DTWKKRGNVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPP 320          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|O57429|UBP2_CHICK (Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus OX=9031 GN=USP2 PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 1.262e-67
Identity = 143/347 (41.21%), Postives = 200/347 (57.64%), Query Frame = 3
Query: 1938 PNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYRE-VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL-VANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            P    V  GLTGLRN+GNTC+MNS++Q LSNTK L +Y L N Y  D+N ++ +     ++ EFA LI  LWT +  + VSPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR     +       D + D E++ Q W+ +    DS +  +F GQ +S +TC  C   S  FD F  LSLP+    +   +L DCL+LF  E+ + G  +  C +CK+     KK  I K P  L++HLKRFS       KL TFV+FP++    +D+ +   Q   H  Y+LYAVSNH G    GHYT++CK+  ++EWH+++D  VT +    V++   Y+LFYE
Sbjct:    9 PRSSKVVQGLTGLRNLGNTCFMNSILQCLSNTKELRDYCLQNQYLRDLNNNSRMRTA--LMSEFAKLIQLLWTSSPNDSVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHGEVNRVLVRPRANADT-LDHLPDDEKSRQMWRRYQEREDSRVSDLFVGQLKSSLTCSECGYCSTAFDPFWDLSLPIPKKGYGEVTLMDCLRLFTKEDVLDGDEKPTCCRCKARTRCTKKFSIQKFPKILVLHLKRFSEARIRASKLTTFVNFPLKD---LDLREFASQSCNHAVYNLYAVSNHSGTTMGGHYTAYCKSPISSEWHSFNDSRVTPMSSSHVRSSDAYLLFYE 349          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|O75604|UBP2_HUMAN (Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 1.672e-59
Identity = 137/339 (40.41%), Postives = 195/339 (57.52%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREV-SPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVA-NHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT+ L +Y L   Y  D++  +       +V EFA LI  +WT +  +V SPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR + L   + P N D + D E+  Q W+ ++   DS I  +F GQ +S +TC  C   S  FD F  LSLP+    +   +L DC++LF  E+ + G  +  C +C+  +   KK  I + P  L++HLKRFS +     KL TFV+FP+     +D+ +   +   H  Y+LYAVSNH G    GHYT++C++    EWH ++D  VT +    V+T   Y+LFYE
Sbjct:  265 GLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLHHGS--NAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVT-LRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRD---LDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 597          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Match: sp|O88623|UBP2_MOUSE (Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus OX=10090 GN=Usp2 PE=1 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 3.697e-59
Identity = 134/339 (39.53%), Postives = 194/339 (57.23%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREV-SPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVA-NHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT+ L +Y L   Y  D+   +       ++ EFA LI  +WT +  +V SPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR +   K + P   D + D E+  Q W+ ++   DS I  +F GQ +S +TC  C   S  FD F  LSLP+    +   +L DC++LF  E+ + G  +  C +C++ +   KK  + + P  L++HLKRFS +     KL TFV+FP+     +D+ +   +   H  Y+LYAVSNH G    GHYT++C++    EWH ++D  VT +    V+T   Y+LFYE
Sbjct:  273 GLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLGHTSSAHTA--LMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFLRFLLDGLHNEVNRVAARPKAS-PETLDHLPDEEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDILDGDEKPTCCRCRARKRCIKKFSVQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRD---LDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPVTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYE 605          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A0P7V4Q6 (Ubiquitin carboxyl-terminal hydrolase 8-like OS=Scleropages formosus OX=113540 GN=Z043_104193 PE=3 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 1.681e-129
Identity = 340/1048 (32.44%), Postives = 519/1048 (49.52%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEM--NKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKAFSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYKCIP---------KIEEIPTVQVEITKDTITETPKDNITVEE---LYKIIKKKE-NALVIDVRPSNEFLNSHISY--GQVINIPSNELQLGCTI--VNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAE-----TGRINLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWEAMXXXXXXXXXXXXXXXXXXXXXXXXXXSENRFNQPKSTNQT--SKPAINTNEIVPGVKSNLV--IDRSLKPMIPQLITS-------------QDEAVVPDETNKIRTLLVPKENVAVDPKKEKSLSTPDRSLKP-------------NVLREINIDPNQPLLD-----------EPKNLESVDAVSDLNAPTETTPRLSNNSRTYHDRTNFTAKGGAKSIPPPTDVIESKK----------------PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTE-----FSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            K LY+S++L +L +KAE+  +KI   S ++S     K+++  E   LD+DEE + +  M+FLT+   +KK    D     S   + ++  A E+A +L  SL+ RY+            + EE    + +  K T   + K+    E+   L+K++K +    +V+D R  ++F  S I     Q I +P   L+ G T+  + VN   ESR +      W  R  A  ++L+ W+S+         +  +KDA+ KWD++  + N  +VLE G+ ++L  YP   +N+K K P   T+ + I   N  YP  E  +     +   K +  Q N      +  +     P  T+QT   KP   ++   PG K+  V  IDR+ KP + +  +S             Q+  V+P+ + +I   + PK ++  + +K K    P ++L+                 R+I+ + ++ + D           + K LE   A  D +   E     +   R Y+D     AKG +     P  ++   K                P LP       D  T  Y Y  +  N+   YPP EV +               K      +++  +   + LKRS S P+++  L         D  +    +K    P +NR TKP     +T+      SA+++ N NP +  + P LTGLRN+GNTCYMNS++Q L NT  +  Y   N YQ DINR N LG+ GE+  EF  ++ ALW+G Y+ +SP DFK  I   NE F G EQ DSQE LLFL+DGLHEDLN+     +       D + D + A  +W  H  +N+S+IV +FQGQ++S V C  C   S TF+ FMYLSLPL + H RCSL+DCLKLF  EE++T +++ FC  CK++R++ KK++IWK+PP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   +   K   Y+L  VSNH+G ++ GHYT++CKN +   W  +DD  V  I    VKT + YI FY +
Sbjct:    9 KELYLSTSLGDLNKKAEIKPDKISTRSYVQSA---CKIFKAAEECRLDRDEEKAYVLYMKFLTVYDLIKK--RPDFQQQQSILGSSSLKKAVEEAERLSESLKLRYEEAEVRRNLDEKERQEENKRKEEKPEKGTDWGSSKEAGGAEKDKKLFKMMKDQSMRIIVMDARSRSDFEESRIQVPTQQCICVPEEVLRPGITVNQIEVNLPEESRGE------WECRGLADYIVLLDWSSSAKDLKLGSTLRSLKDALHKWDSKTVLHNEPLVLEGGYENWLLFYPMYTSNAKVKPPRLETV-DVIPKLNFSYPSLEEPKPLAPPEVIPKPEPMQVNGNLTNMEVKQVEAEGPAVTDQTLEEKPKKGSSS-QPGTKAKPVPQIDRTKKPTVKRSDSSKTISMTTKDQQPVQNGPVIPNHSAQIG--VGPKSSITTE-EKSKIQQEPVQALQKVEPERRRQGDNSNQEGRQIDKEDSEKIKDSRGEEKEERRQDKKRLERQKAAKDEH---EEEINEAKERRRYNDEGVDKAKGTSLESHVPKSIVNEIKREPLTRARSEEMGRSVPGLPDGWMKFLDTVTGTYRYYHSPTNRVHLYPP-EVSQTPPATPP------APKQKPGKGRTIEPESEHTKLKRSYSSPDITQSL--------QDEGV----TKLIATPFVNRDTKPPRVMPYTKAEITRLSAAKIRNLNPFFGGLGPSLTGLRNLGNTCYMNSILQCLCNTPAMAEYFNKNYYQEDINRANILGHKGEVAEEFGVIMKALWSGLYKYISPLDFKVTIGKINEQFAGYEQQDSQELLLFLMDGLHEDLNKADNRKRCKEETI-DHLDDFKAAELAWSKHKLLNESIIVALFQGQFKSTVQCLTCYRKSRTFETFMYLSLPLASAH-RCSLQDCLKLFSKEEKLTDSNRVFCRHCKAHRDSTKKLEIWKVPPILLVHLKRFSYEGRWKQKLQTAVDFPLENLDLTQYVIGPRHNLKK--YNLIGVSNHYGGLDGGHYTAYCKNAQKQRWFKFDDHEVLDISASSVKTSAAYIFFYSA 1014          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A3B3Q573 (USP domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=3 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 8.299e-123
Identity = 329/1074 (30.63%), Postives = 504/1074 (46.93%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEM--NKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYKCIPKIEEIPTVQVEITKDTITETP---------KDNITVEELYKIIK------KKENA------------------------LVIDVRPSNEFLNSHISY--GQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAETGRINL------VKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTI-----TNFIQPDNIHYPD------WEAMXXXXXXXXXXXXXXXXXXXXXXXXXXSENRFNQPKST------------NQTSKPAINTNEIV-----------PGVKSNLVIDRSLKPMIPQLITSQDEAVVPDETNKIRTLLVPKENVAVDPKKEKSLSTPDRSLKPNVLREINIDPNQPLLDEPKNLESVDAVSDLNAPTETTPRLSNNSRTYHDRTNFTAKGGAKSIPPPTDVIESKK----------------PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENS--------NECSTQRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTE-----FSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
            K LY+ ++L EL +KAE+  +K    S ++S     K+++  E   LD+DEE + +  M++LT+   +KK   F +   +  S   + ++  A E+A KL  SL+ RY+      ++   + +  K    E P         KD+   E+  K +K      KKENA                        +++D R   +F  S I     + I++P   +  G T   +    E++  +     W+ R  A  ++L+ W+S+  G + L      +KDA+ KWD++  +++  +VLE G+ ++L  YP   +N+K + P + T+      NF  P ++  PD       E+          +  +  +          S+ +  +  S             ++  KPAI  ++             P      + DRS+KP +    T++ E     +T+  + +   +E    + +KE S    +R  +  V  E   +  +    + K LE  +A  D     E   R   + R    ++   AK      P P  V+   K                P LP       D  T  Y Y  +  N+   YPP+  +  +         +   QR  VE   DH+              LKRS S P+++  L    P             K    P +NR  KP     + +      SA+++ N NP +  +   LTGLRN+GNTCYMNS++Q L NT  +  Y   N YQ DINR N LG+ GE+  EF  ++ ALW+G Y+ +SP DFK  I   NE F G EQ DSQE LLFL+DGLHEDLN+     +       D + D + A  +W  H  +N+SVIV +FQGQ++S V C  C   S TF+ FMYLSLPL A+ NRC+L+DCLKLF  EE++T +++  C +CK +R+A KK++IWK+PP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+L  VSNH+G ++ GHYT++CKN +   W  +DD  VT I    VK+ + YI FY
Sbjct:    9 KELYLCTSLGELNKKAEIKPDKTSTRSYVQSA---CKIFKAAEECRLDRDEEKAYVLYMKYLTVYDLIKKRPDFKQQQDFFQSILGSNSLKKAIEEAEKLSESLKLRYEEAEVRRKLEERERQEEKKRRGENPGQALGKGSLKDSAGAEKETKKLKWGKKDNKKENAAGASPGGVAPEQLFQMMRDQCLRIIIMDARSRKDFEESQIQVPTQRCISVPEEAISPGITASQI----EAKLPACSRGEWDHRGFADYIVLLDWSSS-AGDLKLGTTLCSLKDALYKWDSKTVLRSEPLVLEGGYENWLLFYPMYTSNAKVRPPRQETVDIIPKLNFNYP-SLEEPDPGEDAGEESPVQVNGDSGRMDDKGVEPKDLEASSIASQEKTKKGSSVHSGFRTKPIPQFDRAKKPAIKKSDGARSSNTLAKDQQPAQNGPAIPDRSVKPGLSPKQTTRAEERNHVQTDPSKPMQAKREE---ERQKEDSKKEGERGEEEEVADESRGEGKEERRQDRKRLERQEAAKD-EQEEEVVER--KDRRWKSSQSAEQAKNMPLDWPAPKSVVSEIKREPLTRARSEEMGRTVPGLPDGWMKFLDTVTGTYRYYHSPTNRVHLYPPEVSVSQTPPATPPTPKQKKVQRRAVEPDSDHA-------------KLKRSYSSPDITQSLQEEGP------------KKLPATPVINREIKPPRVTPYAKTEISWLSAAKIRNLNPMFGGLGVSLTGLRNLGNTCYMNSILQCLCNTPAMAEYFNKNYYQEDINRFNILGHKGEVAEEFGVVVKALWSGLYKYISPRDFKVTIGKINEQFAGYEQQDSQELLLFLMDGLHEDLNKADNRKRYKEETI-DHLDDFKAAELAWSKHKLLNESVIVALFQGQFKSTVQCLTCHRKSRTFETFMYLSLPL-ASTNRCTLQDCLKLFSKEEKLTDSNRVLCRQCKVHRDATKKLEIWKVPPILLVHLKRFSYEGRWKQKLQTSVDFPLENLDLAQYVIGPKHNLKK--YNLIGVSNHYGGLDGGHYTAYCKNAQKQRWFKFDDHEVTDIPASSVKSSAAYIFFY 1038          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A4W3K2D3 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=usp8 PE=3 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 3.258e-119
Identity = 324/1051 (30.83%), Postives = 504/1051 (47.95%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTL--LTKVKKAFSKDASYITSHFNTKTIDIAFEKAGKLKASLEERY-----------------------------------KCIPKIEEIPTVQVEITKDTITETPKDNITVEELYKIIKKKENALVI-DVRPSNEFLNSHISYGQ--VINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAW----NSAETGR-INLVKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWEAMXXXXXXXXXXXXXXXXXXXXXXXXXXSENRFNQPKSTNQTSKPAINTNEIVPGVKSNLVIDRSLK--PMIPQL-ITSQDEAVVPDETNKIRTLLVPKENVA-----VDPKKEKSLSTPDRS-----------------LKPNVLREINIDPNQPLLDEPKNLESVDA-VSDLNAPTETTPR----LSNNSRTYHDRTNFTAKGGAKSIP----------PPTDVIESKKPDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPC--STKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYN 2981
            K LY+S++L +L +KAE+   + ++         K+++  E   LD+DEE + +  M++L++  L + K  F +   Y TS     +   A E+A +L  SL+ RY                                   K + K      V V+     + + P   I  E L+ +++ +   ++I DVR   ++  SHI       I++P   +  G T+  +   L   + +     W  R+    ++L+ W    N  + G  +  +KDA+ KWD++  +++  ++LE G+ ++L  YP   TN K   P E      +   N  YP  E          +L +++  +  E   E++S+      K  N T   ++       GV S  V   +LK  P +P   +++Q E ++  E     +L     NV      +D  K+ SL  PDRS                 L P+   + +++    L DE +NL   +A +    A  E   R    L    R   +R     +   K+ P            ++ +    P LP       D  T  Y Y  +  N    YPP E++++    +T          H A   S++       LKRS S P+++  +   +  ++T  +           P +NR TKP   S    +  SAS++ N NP Y  +   LTGLRN+GNTCYMNS++Q LSNT  L  Y + N Y  DINR N LG+ GE+  EF  ++ +LW+G Y+ +SP +F+  I   N+ F GS   DSQE LLFL+DGLHEDLN+     +     N D + D + A  +W+ H  +N+S+IV +FQGQ++S V C  C   S TF+AFMYLSL L    N+CSL+DC+++F  EE++T  +++ C  CK++R+A KK++IWKLPP LLIHLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+LY+ SNH+G ME GHYT++C+N     W  +DD  V+      VK+ + YILFY S +
Sbjct:    9 KSLYLSTSLADLNKKAEVKPEKGTTTKNYVHSACKIFKAAEECRLDRDEEKAFVLYMKYLSVYELIRKKSDFKQQQEYYTSLLGPASFRKAIEEAERLSDSLKLRYEEAEVRKKLEEKERLEEEKQKQQEEAKRKGTDNTTKALTKNSLKDLVHVKKGSLKVADLPPGAIRAENLFAMLQDETTGVIIMDVRTYKDYQESHIHMADQCCISVPEEAINPGITVNQIELKLPEESKA----KWKNRQFIDYIVLLDWFSSINQVKLGTTLQSLKDALYKWDSQIILRSEPLILEGGYETWLLFYPMYTTNPKVIVPREEKPDTHLVSLNFSYPTLEESPPRPPPSSDLTERKVSQEIEACDEQDSQPE-KVAKRVNVTETASVPNGVTRQGV-SPAVQPTTLKAIPQVPSFFLSTQVEGLLSTEG----SLYHGDFNVCLCFEQIDRSKKPSLKMPDRSQSNSDVGVDSLPAHNGPLIPDRSTKPSLETQNSLTDEERNLIHAEAALIGEKARREKEHRDREKLLQEERRQKERGQSRRENLKKTKPRSKAKDSLTRARSEEMGRTVPGLPHGWMKFLDLVTGTYRYYHSPTNSVHLYPP-EMVQSITPPATP-------PTHKAKAPSLT-DTEAPKLKRSYSSPDITQAIQDEQSKVATKLA-----------PTINRETKPYNYSKAEISNPSASQIRNLNPVYGGLGRALTGLRNLGNTCYMNSILQCLSNTPSLAEYFIKNYYLQDINRANILGHKGEVAEEFGVVMKSLWSGQYKYISPREFRMRIVKINDRFAGSSHQDSQELLLFLMDGLHEDLNKADNRKRYK-EENIDGLDDFQAAELAWQKHKLLNESIIVALFQGQFKSTVQCLTCYKKSRTFEAFMYLSLSL-GTSNKCSLQDCVRMFSKEEKLTDDNRFHCSHCKTHRDATKKLEIWKLPPILLIHLKRFSFEGRWKQKLQTNVDFPLENLDLSPYVIGPKHNIKR--YNLYSASNHYGGMEGGHYTAYCRNPLNQRWFKFDDHDVSDFSTSSVKSAAAYILFYSSLD 1025          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A3B3Q5Q5 (USP domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=3 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 6.146e-117
Identity = 320/1053 (30.39%), Postives = 493/1053 (46.82%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEM--NKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYKCIPKIEEIPTVQVEITKDTITETP---------KDNITVEELYKIIK------KKENA------------------------LVIDVRPSNEFLNSHISY--GQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAETGRINL------VKDAVCKWDAENSIKNV-VVLEPGFHSFLTHYPTMVTNSKYKGPDETTI-----TNFIQPDNIHYPD------WEAMXXXXXXXXXXXXXXXXXXXXXXXXXXSENRFNQPKST------------NQTSKPAINTNEIV-----------PGVKSNLVIDRSLKPMIPQLITSQDEAVVPDETNKIRTLLVPKENVAVDPKKEKSLSTPDRSLKPNVLREINIDPNQPLLDEPKNLESVDAVSDLNAPTETTPRLSNNSRTYHDRTNFTAKGGAKSIPPPTDVIESKK----------------PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENS--------NECSTQRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTE-----FSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDD 2906
            K LY+ ++L EL +KAE+  +K    S ++S     K+++  E   LD+DEE + +  M++LT+   +KK   F +   +  S   + ++  A E+A KL  SL+ RY+      ++   + +  K    E P         KD+   E+  K +K      KKENA                        +++D R   +F  S I     + I++P   +  G T   +    E++  +     W+ R  A  ++L+ W+S+  G + L      +KDA+ KWD++  +++  +VLE G+ ++L  YP   +N+K + P + T+      NF  P ++  PD       E+          +  +  +          S+ +  +  S             ++  KPAI  ++             P      + DRS+KP +    T++ E     +T+  + +   +E    + +KE S    +R  +  V  E   +  +    + K LE  +A  D     E   R   + R    ++   AK      P P  V+   K                P LP       D  T  Y Y  +  N+   YPP+  +  +         +   QR  VE   DH+              LKRS S P+++  L    P             K    P +NR  KP     + +      SA+++ N NP +  +   LTGLRN+GNTCYMNS++Q L NT  +  Y   N YQ DINR N LG+ GE+  EF  ++ ALW+G Y+ +SP DFK  I   NE F G EQ DSQE LLFL+DGLHEDLN+     +       D + D + A  +W  H  +N+SVIV +FQGQ++S V C  C   S TF+ FMYLSLPL A+ NRC+L+DCLKLF  EE++T +++  C +CK +R+A KK++IWK+PP LL+HLKRFS  G+++QKL T VDFP+E+  L   +   K   K   Y+L  VSNH+G ++ GHYT++CKN +   W  +DD
Sbjct:   10 KELYLCTSLGELNKKAEIKPDKTSTRSYVQSA---CKIFKAAEECRLDRDEEKAYVLYMKYLTVYDLIKKRPDFKQQQDFFQSILGSNSLKKAIEEAEKLSESLKLRYEEAEVRRKLEERERQEEKKRRGENPGQALGKGSLKDSAGAEKETKKLKWGKKDNKKENAAGASPGGVAPEQLFQMMRDQCLRIIIMDARSRKDFEESQIQVPTQRCISVPEEAISPGITASQI----EAKLPACSRGEWDHRGFADYIVLLDWSSS-AGDLKLGTTLCSLKDALYKWDSKTVLRSEPLVLEGGYENWLLFYPMYTSNAKVRPPRQETVDIIPKLNFNYP-SLEEPDPGEDAGEESPVQVNGDSGRMDDKGVEPKDLEASSIASQEKTKKGSSVHSGFRTKPIPQFDRAKKPAIKKSDGARSSNTLAKDQQPAQNGPAIPDRSVKPGLSPKQTTRAEERNHVQTDPSKPMQAKREE---ERQKEDSKKEGERGEEEEVADESRGEGKEERRQDRKRLERQEAAKD-EQEEEVVER--KDRRWKSSQSAEQAKNMPLDWPAPKSVVSEIKREPLTRARSEEMGRTVPGLPDGWMKFLDTVTGTYRYYHSPTNRVHLYPPEVSVSQTPPATPPTPKQKKVQRRAVEPDSDHA-------------KLKRSYSSPDITQSLQEEGP------------KKLPATPVINREIKPPRVTPYAKTEISWLSAAKIRNLNPMFGGLGVSLTGLRNLGNTCYMNSILQCLCNTPAMAEYFNKNYYQEDINRFNILGHKGEVAEEFGVVVKALWSGLYKYISPRDFKVTIGKINEQFAGYEQQDSQELLLFLMDGLHEDLNKADNRKRYKEETI-DHLDDFKAAELAWSKHKLLNESVIVALFQGQFKSTVQCLTCHRKSRTFETFMYLSLPL-ASTNRCTLQDCLKLFSKEEKLTDSNRVLCRQCKVHRDATKKLEIWKVPPILLVHLKRFSYEGRWKQKLQTSVDFPLENLDLAQYVIGPKHNLK--KYNLIGVSNHYGGLDGGHYTAYCKNAQKQRWFKFDD 1018          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Match: A0A1I8I695 (Ubiquitin carboxyl-terminal hydrolase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 3.798e-109
Identity = 178/362 (49.17%), Postives = 247/362 (68.23%), Query Frame = 3
Query: 1890 TKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSC--TGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
             + F+ F A  LN   P Y +V  GLTGLRN+GNTCY+NS VQ LSNT  L +Y L  +++  +N+ NPLG+ G++  +F+ ++ ALW G Y  VSP DFK  I    E F G+EQ DSQEFLLFLLDGLHEDLNR  +        +++ + D+ERA ++W  H  IN+S++V +FQGQ++S + C+ C   S+TFDAFMYLSLP+V++   C L DCL+ FL  ER++G+S+WFCP+C+ +++A KKIDIW+LPPYLLIH KRFSC       +KLNT VD+P+ +  +        +P+    Y+LY VSNH G+ME GHYT+FC+N   N W  +DD+ VT++R  ++++ S YILFY
Sbjct:  118 VRPFSSFDAHTLNRMAPEYGSVPHGLTGLRNLGNTCYLNSTVQCLSNTPVLASYFLQGTFREHVNKSNPLGHQGDVAEQFSVVVQALWAGRYACVSPYDFKHTIGRHAEAFAGNEQQDSQEFLLFLLDGLHEDLNRARRRRPPPELEDKESLPDVERAKRAWARHCLINESIMVELFQGQFKSTLVCEQCHYKSITFDAFMYLSLPVVSD-TSCRLSDCLQAFLKPERLSGSSRWFCPRCRRDQSAVKKIDIWRLPPYLLIHFKRFSCDRLSSRGRKLNTLVDYPISNLDMSAYHSSEARPKHSLVYNLYGVSNHFGSMECGHYTAFCRNSNLNRWFKFDDETVTEMRSGEIRSVSNYILFY 478          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp8 (ubiquitin specific peptidase 8 [Source:ZFIN;Acc:ZDB-GENE-030131-1949])

HSP 1 Score: 337.035 bits (863), Expect = 1.243e-98
Identity = 193/475 (40.63%), Postives = 271/475 (57.05%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECST-------QRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTEF-----SASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTK 2921
            P LP       D  T  Y Y  +  N+   YPP+  +  +   +         R      +      +   ++   S LKRS S P++S +L    P             K    P +NR TKP +   + +      SA+++ N NP +  + P LTGLRN+GNTCYMNS++Q L NT  +  Y   N YQ DINR N LG+ GE+  EF  ++ ALW+G ++ +SP DFK  I   N+ F G EQ DSQE LLFL+DGLHEDLN+     +    VN D + D+  A+ +W  H  +N+S+IV +FQGQ++S + C  C   S  F+ FMYLSLPL ++ N+CSL+DCL+LF  EE+MTG  + +CP CK  R   KK++IWK+PP LL+HLKRF   G+++QKL T VDFP+E+  L   +   K   K   Y+LYAVSNH+G+++ GHYT++CKN     W  +DD  V++
Sbjct:  556 PGLPDGWMKFLDTVTGTYRYYHSPTNRVHLYPPEVSVPQTPPATPPMPKQKPARPVASEKEKEKEKEREREREREQSKLKRSYSSPDISQELNIEAP------------RKPAPTPTINRDTKPPTVTNYPKVEVARPSAAKIRNMNPVFGGLGPCLTGLRNLGNTCYMNSILQCLCNTPAMAEYFNRNLYQEDINRANFLGHKGEVAEEFGVIMKALWSGQFKFISPRDFKITISKINDQFSGCEQQDSQELLLFLMDGLHEDLNKADNRKRYKEEVN-DHLDDVSAADLAWGKHKLLNESIIVALFQGQFKSSLQCLSCHRKSRMFETFMYLSLPLPSS-NKCSLQDCLRLFSKEEKMTGNDKVYCPHCKGLREFTKKLEIWKVPPILLVHLKRFWYEGRWKQKLQTSVDFPLENLDLSQYVIGPKNALKR--YNLYAVSNHYGSLDGGHYTAYCKNTTRQHWFKFDDHEVSR 1014          

HSP 2 Score: 64.3142 bits (155), Expect = 6.595e-10
Identity = 48/170 (28.24%), Postives = 84/170 (49.41%), Query Frame = 3
Query:  477 PKDNITVEELYKIIKKKE-NALVIDVRPSNEFLNSH--ISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAETG-----RINLVKDAVCKWDAENSIKN-VVVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            P   +  ++LY +I+    + LV+D R   +F +SH  +     I++P   ++ G T   VN+I E +     L  W +R +   +IL+ W S  +       +  +K+A+ KWD+   +++  +VLE G+ ++L  YP   +N K K P + T+    Q  N  YP  E
Sbjct:  144 PSGGVGAQQLYNMIRDSSMSVLVMDARRLADFEDSHMMVPGHNCISVPEEAIKPGIT---VNQI-ELKLPGASLPQWKQRGNVDYIILLDWFSCVSDLKLGTTLQSLKEALFKWDSVTILRSEPMVLEGGYENWLLFYPMFTSNPKVKPPRQHTVNTLPQ-LNFSYPCLE 308          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103044554])

HSP 1 Score: 241.506 bits (615), Expect = 1.742e-70
Identity = 142/339 (41.89%), Postives = 199/339 (58.70%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYRE-VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNE-DKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT  L +Y L N+++ D+N  N       ++ EFA L   LWT    E +SPSDFK  I      F G  Q D+QEFL FLLDGLH ++NR S   +V  PV + D ++D E+A + W  ++   DS +V +F GQ +S +TC  C   S  FD F  LSLP+  +    +L DCL+LF  E+ + G  +  C +CK+ R   KK  I K P  L++HLKRFS       KL+TFV+FP++    +D+ +       +  Y+LYAVSNH G    GHYT++C+N    EW+ Y+D  V+ +    V++   Y+LFYE
Sbjct:   60 GLVGLRNLGNTCFMNSILQCLSNTHDLRDYCLRNTHRTDLN--NNCRANAALMEEFAKLTQILWTSASNEAISPSDFKTQIQKYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVSVRPRV--PVEDFDHLSDDEKAKRMWNKYLEREDSKVVDLFVGQLKSSLTCSECGFCSTVFDPFWDLSLPIAKSSGEVALIDCLRLFTKEDVLDGNEKPTCQRCKARRKCTKKFSIQKFPKVLVLHLKRFSEARVKTAKLSTFVNFPIKE---LDLREFASDNSMNAIYNLYAVSNHTGTTLGGHYTAYCRNPSTGEWYTYNDSRVSPMSSSQVRSSDAYVLFYE 391          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103044554])

HSP 1 Score: 238.039 bits (606), Expect = 1.412e-69
Identity = 142/339 (41.89%), Postives = 197/339 (58.11%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYRE-VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNE-DKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT  L +Y L N+++ D+N  N       ++ EFA L   LWT    E +SPSDFK  I      F G  Q D+QEFL FLLDGLH ++NR S   +V  PV + D ++D E+A + W  ++   DS +V +F GQ +S +TC  C   S  FD F  LSLP+  +    +L DCL+LF  E+ + G  +  C +CK+ R   KK  I K P  L++HLKRFS       KL+TFV+FP++       L+       +  Y+LYAVSNH G    GHYT++C+N    EW+ Y+D  V+ +    V++   Y+LFYE
Sbjct:   39 GLVGLRNLGNTCFMNSILQCLSNTHDLRDYCLRNTHRTDLN--NNCRANAALMEEFAKLTQILWTSASNEAISPSDFKTQIQKYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVSVRPRV--PVEDFDHLSDDEKAKRMWNKYLEREDSKVVDLFVGQLKSSLTCSECGFCSTVFDPFWDLSLPIAKSSGEVALIDCLRLFTKEDVLDGNEKPTCQRCKARRKCTKKFSIQKFPKVLVLHLKRFSEARVKTAKLSTFVNFPIKELD----LREFASDNMNAIYNLYAVSNHTGTTLGGHYTAYCRNPSTGEWYTYNDSRVSPMSSSQVRSSDAYVLFYE 369          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103044554])

HSP 1 Score: 241.121 bits (614), Expect = 6.080e-69
Identity = 142/339 (41.89%), Postives = 199/339 (58.70%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYRE-VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNE-DKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GLRN+GNTC+MNS++Q LSNT  L +Y L N+++ D+N  N       ++ EFA L   LWT    E +SPSDFK  I      F G  Q D+QEFL FLLDGLH ++NR S   +V  PV + D ++D E+A + W  ++   DS +V +F GQ +S +TC  C   S  FD F  LSLP+  +    +L DCL+LF  E+ + G  +  C +CK+ R   KK  I K P  L++HLKRFS       KL+TFV+FP++    +D+ +       +  Y+LYAVSNH G    GHYT++C+N    EW+ Y+D  V+ +    V++   Y+LFYE
Sbjct:  180 GLVGLRNLGNTCFMNSILQCLSNTHDLRDYCLRNTHRTDLN--NNCRANAALMEEFAKLTQILWTSASNEAISPSDFKTQIQKYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVSVRPRV--PVEDFDHLSDDEKAKRMWNKYLEREDSKVVDLFVGQLKSSLTCSECGFCSTVFDPFWDLSLPIAKSSGEVALIDCLRLFTKEDVLDGNEKPTCQRCKARRKCTKKFSIQKFPKVLVLHLKRFSEARVKTAKLSTFVNFPIKE---LDLREFASDNSMNAIYNLYAVSNHTGTTLGGHYTAYCRNPSTGEWYTYNDSRVSPMSSSQVRSSDAYVLFYE 511          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Match: usp2a (ubiquitin carboxyl-terminal hydrolase 2-like [Source:NCBI gene;Acc:103025848])

HSP 1 Score: 236.884 bits (603), Expect = 7.144e-69
Identity = 140/342 (40.94%), Postives = 197/342 (57.60%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYRE-VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNL 2984
            GL GL+N+GNTC+MNS++Q LSNT  L +Y L NS++ D+N ++       ++ EFA LI A+W  +  E VSPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR +   + T   + D + D E+  + W  ++   DS IV +F GQ +S +TC  C   S  FD F  LSLP+   +   SL DC++LF  E+ + G  +  C +CK+ R   KK  I + P  L++HLKRFS       KL+TFV+FPM+    +D+ +          Y+LYAVSNH G    GHYT++C N    EW+ Y+D  VT +    V++   Y+LFYE   L
Sbjct:   60 GLVGLKNLGNTCFMNSILQCLSNTHSLRDYCLHNSHRRDLNNNSRTNTA--LMEEFARLIQAMWMSSGSEAVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPRATTE-DFDHLPDEEKGKKMWSKYLEREDSKIVDLFVGQLKSSLTCTECGYCSTVFDPFWDLSLPIAKGYGEVSLMDCVRLFTKEDVLDGDEKPTCYRCKARRRCTKKFTIQRFPKILVLHLKRFSEARVRSSKLSTFVNFPMKD---LDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYCCNPATGEWYTYNDSRVTPMSSSQVRSSDAYVLFYERAGL 395          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008243.1 (pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 gene:ENSPMAG00000007452.1 transcript:ENSPMAT00000008243.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 311.227 bits (796), Expect = 3.551e-96
Identity = 172/380 (45.26%), Postives = 247/380 (65.00%), Query Frame = 3
Query: 1857 PALNRLTKPCSTKTFTEFSASRL--NNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDIN-RDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDK---ITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANH-NRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYES 2975
            P  +R +KP         S++ L   + NP Y  +   LTGLRN+GNTCYMNSVVQ LSNT  L  Y LT+ Y ++IN R+NPLG  G++V EFA ++ ALW+G YR ++P DFK MI   N+ F G+EQHDSQE L+FLLDGLHEDLN+  ++      V E+K   ++D   A  +W  +  IN+S++V +F GQ+RS + C  CQ  S TF+ FM L+L L ++  ++C+L+DCL++F   E+MT A+++ C  CK  R + K ++IWKLPP L+IHLKRFS +G+++QKL T V FP+ S  +   +    +  ++  Y+LYAVSNH+G+++ GHYT++  N   + W  +DD  V  I   +V T +GYILFY +
Sbjct:   57 PQFDRASKPVPVAAVRAQSSAILPMRHLNPTYGGMGRALTGLRNLGNTCYMNSVVQCLSNTTSLAEYFLTSQYVNNINSRNNPLGRKGQVVEEFAVIVRALWSGQYRSITPRDFKFMIGRLNDQFCGTEQHDSQELLIFLLDGLHEDLNQAKRVR-----VKEEKTEHLSDSMAAQLAWDAYKHINESILVTLFHGQFRSTIKCLTCQKVSRTFEVFMNLTLHLPSDTTSKCTLQDCLQMFSKPEKMTDANRYLCSHCKQRRESVKTMEIWKLPPVLIIHLKRFSYSGRWKQKLQTNVGFPLTSLDMKPYI--INKDNRYSEYNLYAVSNHYGSLDGGHYTAYTHNTVRDSWFKFDDHEVEFIYPKNVSTSAGYILFYSA 429          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp4 (ubiquitin specific peptidase 4 (proto-oncogene) [Source:ZFIN;Acc:ZDB-GENE-041008-187])

HSP 1 Score: 154.451 bits (389), Expect = 2.073e-38
Identity = 94/187 (50.27%), Postives = 115/187 (61.50%), Query Frame = 3
Query: 1950 TVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL 2510
            T TPGL GL N+GNTC+MNS +Q LSNT  LT Y L ++Y  ++NRDNPLG  GEI   +A LI  +W+G+Y    P  FK  +      F G +Q DSQE L FLLDGLHEDLNR  K   V L   E +  D   A ++W  H   NDS+IV IF G ++S + C  C   SVTFD F YL+LPL
Sbjct:  267 TSTPGLCGLSNLGNTCFMNSALQCLSNTPPLTTYFLEDAYLKELNRDNPLGMRGEIACAYADLIKQMWSGSYSSTVPRSFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRIRKKPYVELKDAEGR-DDKVVAQEAWDNHRKRNDSIIVDIFHGLFKSTLICPDCAKVSVTFDPFCYLTLPL 452          

HSP 2 Score: 129.028 bits (323), Expect = 1.639e-30
Identity = 67/167 (40.12%), Postives = 99/167 (59.28%), Query Frame = 3
Query: 2496 LSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESY-NLKQA 2993
            L+ PL    N   L++C++LF  +E +     W+CP CK ++ A KK D+W LP  L++HLKRFS    +R KL+T VDFP+    + + +  T+      TY L AVSNH+G M  GHYT++ KN   N W+ +DD  V+   E  + + + Y+LFY+   NLK+A
Sbjct:  765 LAQPL-KKKNPVKLKECIELFTTKEELAATDPWYCPNCKKHKQATKKFDLWALPKVLVVHLKRFSYNKYWRDKLDTLVDFPIRDLDMSEFVIGTQDVPC--TYDLIAVSNHYGGMGGGHYTAYAKNKGENSWYYFDDSSVSSSAEDQIVSKAAYVLFYQRRDNLKRA 928          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001826.1 (pep scaffold:Pmarinus_7.0:GL478831:2528:40053:1 gene:ENSPMAG00000001614.1 transcript:ENSPMAT00000001826.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 5.126e-37
Identity = 94/221 (42.53%), Postives = 123/221 (55.66%), Query Frame = 3
Query: 1866 NRLTKPCSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNR 2528
            NR     S+  +  +  S  +   P   T  PGL GL N+GNTC+MNS +Q LSNT  LT Y + N Y  ++N +NPLG  GEI   +A L   +W+G Y  V+P  FK  +      F G +Q DSQE L FLLDGLHEDLNR      V L   E +  ++  A ++W+ H   N+S+IV IF G ++S + C  C   SVTFD F YL+LPL     R
Sbjct:  142 NRFNPFNSSSGYNSYGYSSYDYREPGRGTSQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFVNNKYVSELNNENPLGMKGEIAKAYADLTKQIWSGRYSYVTPRAFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRILNKPYVELKDAEGRPDEV-VAREAWENHQKRNNSIIVDIFHGLFKSTLVCPECSKVSVTFDPFCYLTLPLPMKKER 361          

HSP 2 Score: 82.4185 bits (202), Expect = 3.304e-16
Identity = 34/69 (49.28%), Postives = 46/69 (66.67%), Query Frame = 3
Query: 2535 LEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPM 2741
            L DC++LF  +ER+     W+CP CK ++ A KK D+W LP  L++HLKRFS +   R KL+T VDFP 
Sbjct:  686 LRDCIELFTTKERLGVDDPWYCPSCKRHQQATKKFDLWSLPHILVVHLKRFSYSRYLRDKLDTLVDFPF 754          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003329.1 (pep scaffold:Pmarinus_7.0:GL476462:53018:71827:1 gene:ENSPMAG00000003036.1 transcript:ENSPMAT00000003329.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 1.123e-35
Identity = 89/193 (46.11%), Postives = 119/193 (61.66%), Query Frame = 3
Query: 1959 PGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNS-YQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKL-SKVTLPVNEDKITD-IER------ANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL 2510
            PG TGL N+GNTC+MNSV+QALSNT+ L +Y+  +S ++ DIN  N LG GG + + FA ++  LW G +   SPS  K ++  K   F G  QHD+QEFL FLLDGLHEDLN  +   +    P     ++D + R      A ++W  H A NDS IV +F G Y+SK+ C  C   S+TFD F+YL +PL
Sbjct:    1 PGFTGLVNLGNTCFMNSVIQALSNTRELRDYLHADSAFKADINYSNVLGTGGRLAVSFAIILRTLWKGTHYAFSPSKLKEIVSNKASQFSGFSQHDAQEFLAFLLDGLHEDLNLAANTPTPQQYPEPHGSLSDQVPRPSHNHMAERAWARHKAWNDSFIVHLFHGLYKSKLVCPVCGHVSITFDPFLYLPVPL 193          

HSP 2 Score: 112.464 bits (280), Expect = 1.252e-25
Identity = 58/174 (33.33%), Postives = 86/174 (49.43%), Query Frame = 3
Query: 2532 SLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFS-CTGQYRQKLNTFVDFPMESFSLVDIL------KHTKQPQKHDTYHLYAVSNHHGNMESGHYTSF----------CKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLKQAGFK 3002
            SL  CLKLF   E +T    W CP+C+  R A K++ +W+LPP L++ LKRFS C+  +R+K++  V FP+    L +                   Y LYA  NH+G +  GHYT++          C +M    W  +DD  VT + E  V +   Y+LFY   +   A ++
Sbjct:  481 SLHHCLKLFTKPETLTPEEAWLCPQCEQPREALKQLMLWRLPPVLVVQLKRFSFCSSVWREKISNLVTFPIRGLDLSEFCVEAASGGAGGDAGGAAVYDLYAAINHYGGLIGGHYTAYARLPCARNSQCSDMG---WRWFDDSTVTMVNESQVMSRHAYLLFYRRRDCPLAPYR 651          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Match: usp22 (ubiquitin specific peptidase 22 [Source:NCBI gene;Acc:692275])

HSP 1 Score: 131.339 bits (329), Expect = 1.871e-32
Identity = 112/390 (28.72%), Postives = 168/390 (43.08%), Query Frame = 3
Query: 1935 NPNYRTV----TPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSL-------------------------PLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPME----------SFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLK 2987
            NP  R +    T GL GL N+GNTC+MN +VQAL++T  L ++ L++  +H     +P      +V E   L   +  GN        F  +   + +  +  E   S                     S V  P      + I  AN     +    + +I +IF G  +S VTC  CQ  S T D F  +SL                         PL+      +L DCL+ F   E +  +++  C  C S + + K++ + KLP     HLKRF  + + R+K++T+V FP+E            S V+    T +    + Y L+AV NH G +ESGHYTSF + +  ++W   DD V+T     DV    GY+LFY    L+
Sbjct:  116 NPKRRKISANCTVGLRGLVNLGNTCFMNCIVQALTHTPLLRDFFLSD--RHRCGMPSPEAC---LVCEMCRLFQEV--GNPARCLAPPFCLVPIARCQCRKIMEFDLSMTLH-----------------SGVCWPF----FSCIGDANGKRSNNPNHCNCIIDQIFTGGLQSDVTCQVCQGVSTTIDPFWDISLDLPGSSSPFWPLSPTAESGIPNGGGPLIPA-GPTTLNDCLRRFTRPEHLGSSAKIKCNGCHSYQESTKQLTMRKLPIVACFHLKRFEHSARLRRKISTYVSFPLELDMTPFMNSSKDSRVNGQYQTGESTNENKYSLFAVVNHQGTLESGHYTSFIR-LHRDQWFKCDDAVITHASVTDVLDSEGYLLFYHKQILE 475          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP5 (Putative ubiquitin-specific protease; concentrates at the bud neck; UBP5 has a paralog, DOA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000946])

HSP 1 Score: 166.007 bits (419), Expect = 1.267e-42
Identity = 127/366 (34.70%), Postives = 182/366 (49.73%), Query Frame = 3
Query: 1965 LTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLIT------ALWTGNYRE--VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNR-GSKLSKVTLPVNEDKITD---IERANQ-SWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDT----------------YHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIR-ECDVKTPSGYILFYE 2972
            + GL N+GN CYMN ++Q L  T  L    L N+Y + IN D+  G  G +   FA L+       A    N R   V    FK++    N M+  S Q D QEF  FLLDGLHEDLN+ GSK     L   E+++ +   I +A+   W+  +  + S I+ +FQGQY S++ C  C+ TS T+  F  LS+P V     C++ DC + F   ER+    QW CPKC   + + K++ I +LP  L+I+LKRF        K N FV +P      +D+  +  +   H+                 Y LY V+ H G++  GHYTS+        W+ +DD +   I    +  TPS Y+LFYE
Sbjct:  445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVNNMHRHGAFTPPNVRTIPVQTIQFKKICGHINPMYSDSMQQDCQEFCQFLLDGLHEDLNQNGSKKHLKQLSDEEERMREKMSIRKASALEWERFLLTDFSAIIDLFQGQYASRLQCQVCEHTSTTYQTFSVLSVP-VPRVKTCNILDCFREFTKCERLGVDEQWSCPKCLKKQPSTKQLKITRLPKKLIINLKRFD---NQMNKNNVFVQYPYS----LDLTPYWARDFNHEAIVNEDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKGPKKGWYFFDDSLYRPITFSTEFITPSAYVLFYE 802          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: DOA4 (Ubiquitin hydrolase; deubiquitinates intralumenal vesicle (ILVs) cargo proteins; required for recycling ubiquitin from proteasome-bound ubiquitinated intermediates, acts at the late endosome/prevacuolar compartment to recover ubiquitin from ubiquitinated membrane proteins destined for the vacuole; DOA4 has a paralog, UBP5, that arose from the whole genome duplication [Source:SGD;Acc:S000002476])

HSP 1 Score: 158.303 bits (399), Expect = 5.724e-40
Identity = 121/367 (32.97%), Postives = 184/367 (50.14%), Query Frame = 3
Query: 1968 TGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWT----GNYR-EVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNR-GS-----KLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNR--CSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDI-------LKHTKQPQKHD------------TYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIR-ECDVKTPSGYILFY 2969
             GL N+GN+CYMN ++Q +  T  LT   L +SY   IN ++ LG  G +   FA L+  ++     G+ +  +SP  FK      N +F+ + Q D QEF  FLLDGLHEDLN+ GS     +LS+       +K++    ++  W+  +  + SVIV +FQGQY S++ C  C  TS T+  F  LS+P+   ++R   ++EDC + F   E +    QW CP C+  + + K++ I +LP  L++HLKRF        K N FV +P     L+D+             P  +D             Y LY V+ H G +  GHYT++ K      W  +DD     ++ + D    + Y+LFY
Sbjct:  562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMMYKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQEFCQFLLDGLHEDLNQCGSNPPLKELSQEA-EARREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLKCKVCSHTSTTYQPFTVLSIPIPKKNSRNNITIEDCFREFTKCENLEVDEQWLCPHCEKRQPSTKQLTITRLPRNLIVHLKRFD---NLLNKNNDFVIYPF----LLDLTPFWANDFDGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNKADAINSNAYVLFY 920          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP12 (Ubiquitin-specific protease; cleaves ubiquitin from ubiquitinated proteins; present in the nucleus and cytoplasm [Source:SGD;Acc:S000003733])

HSP 1 Score: 117.857 bits (294), Expect = 3.326e-27
Identity = 96/280 (34.29%), Postives = 135/280 (48.21%), Query Frame = 3
Query: 1785 LISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTEFSASRLNNFNPN-----------------------YRTVTP--GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVS------PSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLP-------VNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL 2510
             +S    ++TD+++ T  +  YE+  L  L  P       +   +RL+    N                       Y  + P  G TGL N+GNTCYMNS +Q L +   L +Y L + Y+ +IN +NPLGY G +   F+ L+  L+      +       PS FK  I   N MF G  Q DSQEFL FLLD LHEDLNR  K      P       VN+  +   + A+ +W+ H+  N SVI  +F G Y+S + C  CQ  S+TFD +  ++LPL
Sbjct:  278 FVSEGSDIATDSNVSTFLNSSYEITPLQFLELPIKKLLIPDMFENRLDKITSNPSDLVIEIKPIEGNHHWPSNYFAYNKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSDLVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNRIIKKEYTEKPSLSPGDDVNDWNVVK-KLADDTWEMHLKRNCSVITDLFVGMYKSTLYCPECQNVSITFDPYNDVTLPL 556          

HSP 2 Score: 117.087 bits (292), Expect = 6.692e-27
Identity = 58/152 (38.16%), Postives = 84/152 (55.26%), Query Frame = 3
Query: 2514 ANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
            A     +L+DCL+LF   E +     W+CP CK +R A K+I +W  P  LLIHLKRF     +  K++  V+FP+    L   + +   P+    Y LYAV NH+G +  GHYT++ KN   N+W+ +DD  VT+    +    S Y+LFY
Sbjct:  957 AKERTITLDDCLQLFSKPEILGLTDSWYCPTCKEHRQATKQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGL-IYDLYAVDNHYGGLGGGHYTAYVKNFADNKWYYFDDSRVTETAPENSIAGSAYLLFY 1107          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP8 (Ubiquitin-specific protease component of the SAGA acetylation complex; required for SAGA (Spt-Ada-Gcn5-Acetyltransferase)-mediated deubiquitination of histone H2B [Source:SGD;Acc:S000004836])

HSP 1 Score: 104.76 bits (260), Expect = 5.472e-24
Identity = 93/354 (26.27%), Postives = 170/354 (48.02%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAY-LITALWTGNYREVSPS-----DFKRMIDGK---NEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTS-VTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFS--CTGQYRQKLNTFVDFP----MESF-SLVDILKHTKQPQKHD-TYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
            GL+GL NMG+TC+M+S++Q L +  +   + ++  + ++    +P       + +  + L  AL T      S S      F  ++      N+   G  Q D+ EF  F                 +   +++  + D+  A +  + +    + ++  +F+G   S + C  CQ  S  T D F+ LSL +    ++  L +CL  F  +E++   + + C +C S ++A K++ I KLP  L++ LKRF     G  R KL+ F++FP    M+++ S  +  KH++  +  D  Y L  + +H G +  GHY +FCK +   +W  ++D +V+ I + +V     Y+LFY
Sbjct:  135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQF-----------------IINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDI---KDKKKLYECLDSFHKKEQLKDFN-YHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNR-KLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFCK-ISGGQWFKFNDSMVSSISQEEVLKEQAYLLFY 465          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Match: UBP11 (Ubiquitin-specific protease; cleaves ubiquitin from ubiquitinated proteins; UBP11 has a paralog, UBP7, that arose from the whole genome duplication [Source:SGD;Acc:S000001806])

HSP 1 Score: 105.531 bits (262), Expect = 1.156e-23
Identity = 113/424 (26.65%), Postives = 182/424 (42.92%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIE--FAYLITALWTGNYREVSPSDFKRMIDG-KNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQS----WKTHIAIND--SVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL--------VANHNRCSLEDCLKLFLAEERMTGASQWFCPKCK--------------------------------------------SNRNAKKK----------IDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANE-------WHNYDDDVVTKIR---------ECDVKTPSGYILFYE 2972
             +TGL+N  NTCY+NS++Q L  T    +  LT  Y+  +N +    Y  E+ +      L   ++    R + P+ F +M    + ++    +Q D+QEFLL +L  +HE+L+  + +      V+ D   +  + N S    W     I D  S I  I++GQ  + + C  C  +S ++  F  LSL +         +   +  LEDC+ LF  +E ++G + W CP C+                                            S +NAKK+          +D   LPP L+IHL RF       +K +T + +P+    L  ILK+ K  +    Y LY   NH GN+ +GHYTS     K++E       W  +DDD + + R         + ++ +   Y+LFYE
Sbjct:  296 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK---YPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKYYPDLVSYD--ANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTIFGFHSRSRSKSPHHHHHHHHSSDDSTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYY--DLTKKNSTVITYPL---ILNIILKNGKVIR----YKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYE 705          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO36301 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SIY1])

HSP 1 Score: 280.411 bits (716), Expect = 5.905e-85
Identity = 170/420 (40.48%), Postives = 244/420 (58.10%), Query Frame = 3
Query: 1728 QISGSSLKRSTSQPNLSD-DLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNL 2984
            Q + S+L+RS S PNL+  + +  +P ++     +  +    + P+  R TKP + K         L++ NP +  +  GLTGLRN+GNTCYMNSV+Q L NT  L  Y ++ +++ DIN++NPLG  G + ++F Y IT++    Y   SP  F          F G  Q D QEFL  ++D LHED+ +     K  L   +D I   E AN +W  H   N+S+++ +F G ++S V C  C   SVT++ F  L+LPL  N N CSL DC+KLF   ERM+G   W+CP+CK +R A K++ IW+LPP L++HLKRF   G +RQKL T V FP++    +D+  +   P K   YHLY VSNH+G M  GHYT+FCKN     W  +DD VVT++   D+ + + Y+LFY S+  
Sbjct:    9 QPTKSNLRRSLSSPNLAKLEDVPLRPEINRSAKPVEPSPVPAK-PSFTRSTKPVTLK---------LDSLNPIHGGLGCGLTGLRNLGNTCYMNSVLQCLFNTAPLAAYFVSGAFRDDINKENPLGTSG-MYLDF-YFITSINFSFYLTSSPEFFT--------TFEGVCQQDFQEFLALMMDKLHEDVCQIRH--KPYLKAPDDNIDPAEAANITWDNHRKRNESLMLNLFDGMFKSTVRCLVCAKDSVTYETFSNLTLPLPGNSNHCSLRDCIKLFTRAERMSGDDMWYCPRCKQHRVASKQLQIWRLPPILIVHLKRFQYDGMWRQKLQTAVSFPVDG---LDMSGYITGPTKRPAYHLYGVSNHYGTMHGGHYTAFCKNAHNQRWFKFDDQVVTEMSANDIVSSAAYLLFYTSFEF 403          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO34837 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SN67])

HSP 1 Score: 204.142 bits (518), Expect = 4.340e-58
Identity = 138/358 (38.55%), Postives = 200/358 (55.87%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYRE--VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL------------VANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLKQA 2993
            GL GLRN+GNTC+MNS++Q LS+T  LTN +L  +Y   IN  N     G +V  FA LI ++W  +  E  +S   FK  I      F G  Q D+QEFL FLL+GLH+DLN+  +  K  +   ++ ++D+E+A ++WK +I  ++S+I  +F G  +S + C  C   SVTFD F  LSLP+              +     + DC++LF  EE + G  +  C KCK  R + KK  + + P  L+IHLKRFS  G +R KL T V FP+ S   +          +   Y LYAVSNH G+   GHYT++CK+ ++ +WH ++D  V +I    V  P  YILF+E ++ K +
Sbjct:    4 GLVGLRNLGNTCFMNSILQCLSSTWLLTNIVLKGTYVSSIN--NKSSMKGRLVQAFADLIKSMWKHDATESAISAHAFKTQIQRFAPRFVGFNQQDAQEFLHFLLEGLHDDLNKVQEKPKYKMCEFDNSLSDLEKAKKAWKLYIERDNSLITDLFVGVLKSTLICLECGFKSVTFDPFWDLSLPIPRKSGSRYSSSRYTDGGDVDIRDCMELFTKEEVLDGDERPTCEKCKKKRKSTKKFTVQRFPRILVIHLKRFSGYG-FRSKLQTNVVFPVTSPQELGEFAADPSEGQSAVYSLYAVSNHSGSTYGGHYTAYCKHPQSRQWHCFNDSRVDQISSSRVTGPQAYILFFEKHDRKSS 358          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO37466 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SFT1])

HSP 1 Score: 144.05 bits (362), Expect = 1.158e-36
Identity = 111/360 (30.83%), Postives = 168/360 (46.67%), Query Frame = 3
Query: 1965 LTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRD-----NPL------GYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKI-TDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNR----------CSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSL--VDILKHTKQPQKHDTYHLYAVSNHHGN-MESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
            L GLRN+GNTC+MN+V+Q+LSN +  + Y   +    ++  D     NP          G +V E   ++ ALW GN    SP      +      FRG +Q D+ EF+ +L+                      D++ T++  + ++        D+++  IF G  +S+VTC  C   S   D F+ LSL +                C LEDC+K F+A E++  +  + C KCK    + KK  I +LP  L +HLKRF      R K++T+V FP+    +    +    K   K   Y L AV  HHG+ + +GHYT+F        W+N++D  V++I E  V    GYI FY
Sbjct:  107 LPGLRNLGNTCFMNAVLQSLSNIQTFSCY-FKDLPAFELRTDTSCEKNPYFTRSRKSDDGCLVEELRKVLCALWQGNCVSHSPEALFSTVWKVVPRFRGYQQQDAHEFMHYLM----------------------DRLHTELLLSQKA----CFGQDTIVTGIFGGILQSEVTCLTCMTESRKLDPFLDLSLEIPPEFQTRKAKSRENPFCQLEDCMKHFVALEKLAESELYMCLKCKKKEQSTKKFWIQRLPNVLCLHLKRFRFQAFLRSKIDTYVQFPIRGLDMSPYTLKGQEKGETKPVLYDLAAVVVHHGSGVSAGHYTTF--AFHDGAWYNFNDSSVSRIDEEMVAKCKGYIFFY 437          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO44454 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7RVV5])

HSP 1 Score: 144.05 bits (362), Expect = 6.100e-35
Identity = 93/204 (45.59%), Postives = 118/204 (57.84%), Query Frame = 3
Query: 1917 SRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNR 2528
            S L +   +YR  TPGLTGL N+GNTC+MNS +Q LSNT  LT Y L+  Y  ++N DNPLG  GEI   +A L+  +W+G    ++P  FK  +      F G +Q DS E L FLLDGLHEDLNR      + L  + D   D   A+++W  H   NDS+IV IF G ++S + C  C   SVTFD   YLSLPL     R
Sbjct:  275 SNLYDNKKSYRG-TPGLTGLANLGNTCFMNSGLQCLSNTMTLTKYFLSKEYVDELNTDNPLGMKGEIAKAYADLLNQIWSGQSSSIAPRQFKMQVGRFAPQFSGYQQQDSHELLAFLLDGLHEDLNRIKMKPYIELR-DADGRPDQVVASEAWHNHRQRNDSIIVDIFHGLFKSTLVCPECNKISVTFDPLCYLSLPLPVKKER 476          

HSP 2 Score: 132.88 bits (333), Expect = 2.108e-31
Identity = 61/146 (41.78%), Postives = 93/146 (63.70%), Query Frame = 3
Query: 2535 LEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            L DC++LFL  E++     W+CP+CK ++ A KK D+W LP  L+IHLKRFS T  +R K++T V+FP+    + D +     P     Y L  VSNH+G M  GHYT++C+N + + W++YDD  V++I E  + + + Y+LFY+
Sbjct:  783 LNDCIQLFLTREKLGANDPWYCPQCKKHQQASKKFDLWCLPEVLVIHLKRFSYTSLWRDKIDTLVNFPLCGLDMSDYVIGKDGPPP--LYDLIGVSNHYGGMGGGHYTAYCRNHEDDHWYSYDDSSVSQINEEQIVSKAAYVLFYK 926          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Match: EDO42651 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7S0W3])

HSP 1 Score: 135.191 bits (339), Expect = 1.345e-33
Identity = 107/339 (31.56%), Postives = 157/339 (46.31%), Query Frame = 3
Query: 1956 TPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            T GL GL N+GNTC+MN +VQAL++T  L +Y L++  QH+   D     G  +V E   L    ++G     SP     ++        G EQ D+ EF +  LD LH      +       P N ++                  + +I RIF G  +S V C  C   S T D F  +SL L    ++  +      F   E +   S+  C KC+S + + K++ + KLP  +  HLKRF    +  +K++T++ FP E    +D+      P     Y L+AV NH G +E GHYT+F +  + N W   DD  +TK    DV    GY+LFY 
Sbjct:  155 TIGLRGLINLGNTCFMNCIVQALTHTPLLRDYFLSD--QHNCKGDA----GTCLVCEMGLLFQEFYSGQKVPHSPFKLLHLVWTHARHLAGYEQQDAHEFFIAALDVLHNYCKEDAPDKLAVKPNNHNQC-----------------NCIIDRIFTGGLQSDVICQTCNCVSTTVDPFWDISLDLGHGDHKLVI---FCRFTRPESLGSESKIKCNKCQSYQESTKQLSMRKLPIVVCFHLKRFE-HSKKSKKISTYIPFPQE----LDM-----APFLSSKYSLFAVVNHSGTLEVGHYTAFIR--QQNNWFKCDDAWITKATIDDVLQSEGYLLFYH 455          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp8 (ubiquitin specific peptidase 8 [Source:NCBI gene;Acc:101172642])

HSP 1 Score: 356.681 bits (914), Expect = 1.414e-105
Identity = 202/484 (41.74%), Postives = 285/484 (58.88%), Query Frame = 3
Query: 1533 PDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTEF-----SASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
            P LP       D  T  Y Y  +  N+   YPP EV       ST     +     +  + S  ++   S LKRS S P++S DL       +T             +P +NR TKP + K +++      SA+++ + NP +  +   LTGLRN+GNTCYMNS++Q L NT  +  Y  +N Y  DINR N LG+ GE   EF  ++ ALW G Y+ +SP DFK  I   N+ F G +Q DSQE LLFL+DGLHEDLN+     +     N D + D   A+ +W  H  +N+S+IV +FQGQ++S V C  C   S TF+ FMYLSLPL A+ ++CSL+DCL+LF  EE++T  ++ FC  CK++R++ KK++IWK+PP LL+HLKRFS  G+++QKL T VDFP+++  L   +   KQ  K   Y+LY VSNH+G ++ GHYT++CKN     W+ +DD  V++I    VK+ + YILFY
Sbjct:  603 PGLPDGWMKFLDTVTGTYRYYHSPTNRVHLYPP-EVTVPQTPPSTPPTVKQKPPQPAEPDTSHEREQEQSKLKRSYSSPDISQDLREEAQKKATAPPTPAV------IPTINRDTKPVTAKVYSKVEIARPSAAKIRSLNPTFGGMGASLTGLRNLGNTCYMNSILQCLCNTPAMAEYFNSNYYLEDINRSNILGHKGEFAEEFGVIMKALWAGLYKCISPRDFKITIGKINDQFAGYDQQDSQELLLFLMDGLHEDLNKADNKKRYKEEEN-DHLDDQTAADLAWSKHKLLNESIIVALFQGQFKSTVQCSTCHRKSRTFETFMYLSLPL-ASTSKCSLQDCLRLFSKEEKLTDNNKVFCRHCKAHRDSTKKLEIWKVPPILLVHLKRFSYEGRWKQKLQTTVDFPLDNLDLTQYVIGPKQTLKR--YYLYGVSNHYGGLDGGHYTAYCKNATKQRWYKFDDHEVSEISTSSVKSSAAYILFY 1075          

HSP 2 Score: 100.908 bits (250), Expect = 3.932e-21
Identity = 96/340 (28.24%), Postives = 161/340 (47.35%), Query Frame = 3
Query:   93 KPLYVSSTLTELMEKAEM--NKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKA--FSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYK---------------------CIPKIEEI--PTVQVEITKDT-------------ITET--PKDNITVEELYKIIKKKENALVI-DVRPSNEFLNSHISY--GQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAETG-----RINLVKDAVCKWDAENSIKN-VVVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWE 959
            K LY+S++L EL +KAE+  +K    S ++S     KL++  E   LD+DEE + +  M++LT+   +KK   F +   Y  +     +   A E+A KL  SL+ RY+                      I K +++  P       KD+             IT+   P   IT E+L++++K +  ++V+ D R   ++  SHI       I++P   +  G T   VN+I E++  S+  + W KR     +IL+ W S+ +       +  +KDA+ KWD+   +++  +VLE G+ ++L  YP   TN+K + P ET +    Q  N  YP  E
Sbjct:    9 KELYLSTSLGELNKKAEIKPDKTSTRSYVQSA---CKLFKAAEECRLDRDEEKAYVLYMKYLTVYDIIKKRPDFKQQPEYYITLLGQNSFKKAIEEAEKLSESLKLRYEEAEVRKKLEEKERLEEKKKREDIEKKKDVGSPKASAANKKDSKKVRGEQNELKSVITKVVQPAGGITAEKLFQMMKDQTISMVVMDARSLKDYEESHIQVPAQTCISVPEEAISPGIT---VNQI-EAKLPSMSKDHWMKRGFVDYIILLDWFSSVSDLKLGTTLQSLKDALFKWDSMTILRSEPLVLEGGYENWLLFYPMYTTNAKVQPPRETMVNTLPQL-NFSYPSLE 340          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp2b (ubiquitin carboxyl-terminal hydrolase 2 [Source:NCBI gene;Acc:101165751])

HSP 1 Score: 242.662 bits (618), Expect = 8.598e-71
Identity = 146/371 (39.35%), Postives = 214/371 (57.68%), Query Frame = 3
Query: 1869 RLTKPCSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDIN-RDNPLGYGGEIVIEFAYLITALWTG-NYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANH-NRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            R ++     TF     ++  N +P       GL GLRN+GNTC+MNS++Q LSNT  L +Y L N ++ D+N R N       ++ EFA L  +LWT  N   +SPSDF+  I      F G  Q D+QEFL  LLDGLH ++NR +   + ++  + D  +D E++ + W  ++A  DS +V +F GQ +S +TC  C   S  FD F  LS+P+        +L+DCL+LF  E+ + G  +  C KCK+ R   K+  I K P  L+IHLKRFS +     KL+TFV+FP++    +D+ + +    +H  Y+LYAVSNH GN   GHYT++C+N    EW++Y+D  V+ I    V+T + Y+LFYE
Sbjct:   32 RFSRSVLVSTFMGLIINQAKNKSPQ------GLVGLRNLGNTCFMNSILQCLSNTSELRDYCLRNVHRLDVNNRTN-----AALMEEFAKLTQSLWTSVNIEAISPSDFRSEIQRVAPKFVGCNQQDAQEFLRSLLDGLHNEVNRVTVRPRSSVE-DFDHYSDEEKSKRMWNLYLAREDSKVVDLFVGQLKSSLTCTVCGFRSTMFDPFWDLSIPIAQERPGEVTLKDCLRLFTKEDVLDGEEKPTCNKCKARRKCTKRFSIQKFPQILVIHLKRFSDSNSRSSKLSTFVNFPLKE---LDLREFSADNSEHPVYNLYAVSNHTGNTLGGHYTAYCRNPALGEWYSYNDSRVSPISSGQVRTSNAYVLFYE 387          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp2a (ubiquitin carboxyl-terminal hydrolase 2 [Source:NCBI gene;Acc:101158874])

HSP 1 Score: 210.305 bits (534), Expect = 4.426e-57
Identity = 134/323 (41.49%), Postives = 192/323 (59.44%), Query Frame = 3
Query: 1956 TPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWT-GNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLV-ANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVT 2918
            T GL GL+N+GNTC+MNS++Q LSNT+ L +Y L N ++ D+N ++       ++ EFA LI  LWT  +   VSPS+FK  I      F G  Q D+QEFL FLLDGLH ++NR S   + T   + D + D E+  + W  ++   DS IV +F GQ +S +TC HC   S  FD F  LSLP+   ++   SL DC++LF  E+ + G  +  C +CK+ R   KK  I K P  L++HLKRFS   +   KL+TFV+FP++    +D+ +       +  Y+LYAVSNH G    GHYT++C+N  + EW+ ++D  VT
Sbjct:  254 TQGLVGLKNLGNTCFMNSILQCLSNTQSLRDYCLHNLHRRDLNNNSRTNTA--LMEEFAKLIQTLWTSSSSEAVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVSVRPRGTAE-DFDHLQDEEKGKKMWSKYVEREDSKIVDLFVGQLKSSLTCSHCGFCSTVFDPFWDLSLPISKKSYGEVSLMDCMRLFTKEDVLDGDEKPTCYRCKARRRCTKKFRIQKFPKILVLHLKRFS-EARRTSKLSTFVNFPLKD---LDLREFASGNSTNAMYNLYAVSNHSGTTMGGHYTAYCRNPNSGEWYTFNDSRVT 569          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: ENSORLT00000003855.2 (ubiquitin specific peptidase 50 [Source:NCBI gene;Acc:105356684])

HSP 1 Score: 170.244 bits (430), Expect = 3.010e-43
Identity = 113/355 (31.83%), Postives = 175/355 (49.30%), Query Frame = 3
Query: 1911 SASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKV--TLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
            S+S L  F    R   PG+ GL N GN+CY+N+V+Q L  T  L   +L    +  + R         +   F +L+  +W G+    SP + +  +      F    Q D+QE LL LL+ LH+D N+ ++   +  + P   ++I              + + +++ R+F+GQ      C HC   +    AF  LSLP+   + +CS++DCL LF  +  +TG  Q  C  C   R       + + P  L++HLKRF   G+ + KL T V F M+   L   L  +       +YHLYAV NH G++  GHYT+ C N  A  WH +DD  V +++E  V++P+ Y+LFY
Sbjct:  399 SSSLLLRFQKKCRR--PGVCGLENSGNSCYLNAVLQCLCATVPLVEQLLHWDTRKGLARSK-----CRVSEVFVHLLEKMWMGSGSSCSPLEVRSALCSVLPQFNNDSQQDAQELLLLLLNTLHDDFNKAAQRQALFSSQPARMEQIKGC-----------SPHSNLVTRLFEGQLSYMCICMHCHHQAHNTQAFTVLSLPVPKGNIKCSIQDCLALFFKQTVLTGGEQAMCSVCGLKRETAIVTCVDRTPEILVLHLKRFGSKGKSQVKLRTNVLFFMK-LDLSQFL--SGLVPNESSYHLYAVVNHTGHLNMGHYTALCYNSLAQTWHCFDDAAVCEVQEDRVQSPNAYLLFY 732          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Match: usp21 (ubiquitin carboxyl-terminal hydrolase 21 [Source:NCBI gene;Acc:101158356])

HSP 1 Score: 159.073 bits (401), Expect = 7.636e-42
Identity = 121/340 (35.59%), Postives = 174/340 (51.18%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYRE--VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDI-ERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            G  GLRN+GNTC++N+VVQ LS+T+ L NY L  SY+H+             ++EF+ +++ LW  N  +  V P  F  +       F G +Q D+QEFL FLLD LH ++NR   + K      +     I E A   WK H+  +DS+IV +F GQ RS + C  C   S TFD F  LSLP+       +L +CL LF  EE++   +   C +C  +    K++ I + P  L+I L RF+ +     K    V FP+ +  L         P     Y LYA+ NH G +  GHYT+ C  +  N W  Y +D VT + E  ++T   Y+LFY+
Sbjct:   52 GRVGLRNIGNTCFLNAVVQCLSHTRALRNYSLLKSYKHE-----KFSKEDAKLMEFSKVLSGLWDVNDGDTVVHPRKFYSIFKDAVPYFSGYQQ-DAQEFLRFLLDKLHTEINRRPNVRKTGKEPEQKYARFIAEEAAAMWKKHLERDDSIIV-LFSGQLRSSLHCSVCSHYSNTFDVFCDLSLPI--PKREVTLWECLDLFSQEEKLDKENSPMCERCNRHTECTKRLSIQRFPQVLVI-LNRFTTSRWSISKSTVHVSFPITNLDL-----GPYGPADPVLYDLYAICNHAGTVNMGHYTACC--LDENGWCFY-NDCVTALSENQLQTNQAYVLFYQ 373          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000020277.1 (SMESG000020277.1)

HSP 1 Score: 1916.74 bits (4964), Expect = 0.000e+0
Identity = 972/974 (99.79%), Postives = 973/974 (99.90%), Query Frame = 3
Query:   84 MDKKPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKAFSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYKCIPKIEEIPTVQVEITKDTITETPKDNITVEELYKIIKKKENALVIDVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSLELNIWNKRKSASLVILVAWNSAETGRINLVKDAVCKWDAENSIKNVVVLEPGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWEAMXXXXXXXXXXXXXXXXXXXXXXXXXXSENRFNQPKSTNQTSKPAINTNEIVPGVKSNLVIDRSLKPMIPQLITSQDEAVVPDETNKIRTLLVPKENVAVDPKKEKSLSTPDRSLKPNVLREINIDPNQPLLDEPKNLESVDAVSDLNAPTETTPRLSNNSRTYHDRTNFTAKGGAKSIPPPTDVIESKKPDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLKQAGFKS 3005
            MDKKPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKAFSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYKCIPKIEEIPTVQVEITKDTITETPKDNITVEELYKIIKKKENALVIDVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDS ELNIWNKRKSASLVILVAWNSAETGRINLVKDAVCKWDAENSIKNVVVLEPGFHSFLTHYPTMVTNSKYKGPDETTIT+FIQPDNIHYPDWEAMEAEKKRKKELKKQEEQKNTENQVEKESENRFNQPKSTNQTSKPAINTNEIVPGVKSNLVIDRSLKPMIPQLITSQDEAVVPDETNKIRTLLVPKENVAVDPKKEKSLSTPDRSLKPNVLREINIDPNQPLLDEPKNLESVDAVSDLNAPTETTPRLSNNSRTYHDRTNFTAKGGAKSIPPPTDVIESKKPDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQEFLLFLLDGLHEDLNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLKQAGFKS
Sbjct:    1 MDKKPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDKDEELSLIYVMRFLTLLTKVKKAFSKDASYITSHFNTKTIDIAFEKAGKLKASLEERYKCIPKIEEIPTVQVEITKDTITETPKDNITVEELYKIIKKKENALVIDVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSRELNIWNKRKSASLVILVAWNSAETGRINLVKDAVCKWDAENSIKNVVVLEPGFHSFLTHYPTMVTNSKYKGPDETTITDFIQPDNIHYPDWEAMEAEKKRKKELKKQEEQKNTENQVEKESENRFNQPKSTNQTSKPAINTNEIVPGVKSNLVIDRSLKPMIPQLITSQDEAVVPDETNKIRTLLVPKENVAVDPKKEKSLSTPDRSLKPNVLREINIDPNQPLLDEPKNLESVDAVSDLNAPTETTPRLSNNSRTYHDRTNFTAKGGAKSIPPPTDVIESKKPDLPPWITHVFDHATNEYYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINKSMSKQISGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKPCSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQEFLLFLLDGLHEDLNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLKQAGFKS 974          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000053081.1 (SMESG000053081.1)

HSP 1 Score: 243.817 bits (621), Expect = 4.995e-69
Identity = 142/342 (41.52%), Postives = 208/342 (60.82%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYRE-VSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNED---KITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL-VANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYE 2972
            GL GL N+GNTC+MNSV+Q LSN K L  Y L+N Y+ D+N ++     G +   +A L+ ++W  +    VSP  FKR+       F  + Q DSQEFL  +L+GLH+D+N+  + SK ++P+ ++   K++D E A   W  +I ++DS IV +F GQ +S + C+ C   S+TFD F  LSLP+   N N+ SL DCL LF +EE + G     C KCK+ R   K+  I K P  L+IHLKRFS   +YR K+++F++FP  + +L    +   +P    TY+LYAVSNH G ++ GHYT++C N  +  W+ YDD  V K+ E +V +   Y+LFY+
Sbjct:  278 GLVGLVNLGNTCFMNSVLQCLSNCKPLQEYCLSNKYEADLNPNSK--SNGSLFKSYAELMKSIWKSDSESYVSPDKFKRIFQKLAPAFHVTSQQDSQEFLRLMLEGLHQDVNKVRRKSK-SIPITDEESEKLSDKELAELYWGRYIKVDDSFIVDLFVGQLKSTLRCNKCGYRSITFDPFWDLSLPIPKINRNQISLTDCLSLFTSEEILDGDEMPKCFKCKTKRPCTKRFSIHKFPSVLVIHLKRFS-GDRYRSKISSFIEFPTRNLNL----QSYAEPSTFATYNLYAVSNHSGTVDGGHYTAYCCNPSSKNWYKYDDTRVYKVNETNVCSTEAYVLFYQ 611          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000039010.1 (SMESG000039010.1)

HSP 1 Score: 142.51 bits (358), Expect = 2.949e-34
Identity = 88/185 (47.57%), Postives = 112/185 (60.54%), Query Frame = 3
Query: 1956 TPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPL 2510
            TPG+ GL N+GNTC+MNS +Q +SN   +T+Y L NS+  D+N+DNPLG  G I   +A LI  +W+G      P +FK  +      F G  QHDSQE ++FLLDGLHEDLNR +    V    N+    D   A Q+W  H+  N+S+IV  F GQ +SKV C  C   SVTFD F  LSLPL
Sbjct:  260 TPGVCGLSNLGNTCFMNSAIQCISNVYPITDYFLRNSWTSDLNKDNPLGMEGRIATAYANLIREMWSGKVSYALPREFKYEVAQFAPQFCGYSQHDSQELMMFLLDGLHEDLNRITNKPYVEQK-NQTNQPDHILAEQNWDYHLRRNNSIIVDYFHGQLKSKVVCPDCNFVSVTFDPFASLSLPL 443          

HSP 2 Score: 132.109 bits (331), Expect = 5.141e-31
Identity = 61/148 (41.22%), Postives = 88/148 (59.46%), Query Frame = 3
Query: 2526 RCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQPQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFY 2969
            + ++EDCLK FL EE +     WFCPKCK +  A KK+DIW+LP  L++HLKRF  T  +  K+N  V FP+++ +L   +   K    +  Y L AVSNH G +  GHY +F KN   + W+ +DD   + + E ++ T S Y+L Y
Sbjct:  704 KLTIEDCLKQFLCEEHLGQKDLWFCPKCKKDEAASKKLDIWRLPKVLVLHLKRFKATSYFGDKINNEVLFPIKNLNLSQYVPKVKNENDY-IYDLVAVSNHMGCLAGGHYFAFAKNYLDSRWYKFDDSNTSCVDESEIVTKSAYVLVY 850          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000062710.1 (SMESG000062710.1)

HSP 1 Score: 135.576 bits (340), Expect = 7.421e-32
Identity = 83/217 (38.25%), Postives = 123/217 (56.68%), Query Frame = 3
Query: 1950 TVTPGLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFC 2600
            +V+ G+TGL N+GNTC+ NS +Q +SNT  LT Y + + +  +IN+ NP G  G + + +  LI  +WTG+   + P   K  +D   + F G++QHD+QE L  LLD LHEDLNR           + +   D E A ++W+ HIA N S++V +F G  +S V CD C+  SV FDA+  LSLP+    N+   E      L  ER++   + +C
Sbjct:  773 SVSKGVTGLSNIGNTCFFNSAIQCISNTNILTEYFIRDVHLCEINKTNPQGCQGIVALRYGELIKDIWTGSTNLIVPLKLKMTMDKYAKQFSGNQQHDAQELLSVLLDALHEDLNRIDAKPSYRELKDSNGRHDDEVAQEAWQAHIATNFSIVVDLFHGLLKSNVCCDICKTNSVRFDAYSMLSLPIPMQLNQ-DFE-----ILVFERLSAIPKKYC 983          

HSP 2 Score: 99.7525 bits (247), Expect = 7.386e-21
Identity = 53/175 (30.29%), Postives = 91/175 (52.00%), Query Frame = 3
Query: 2535 LEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILK----------------HTKQPQKHD----TYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLKQAGF 2999
            L  C++ F  +E +   + + C KCK  + A KK+D+W LPP L+IHLKRF    +  QK +  V +P+ +  L   ++                 T + Q  D     Y+LYA++ H G+++ GHY ++  N ++N+W+ ++D +  ++ E ++     Y+LFYE  NL    F
Sbjct: 1248 LIKCIESFTTQEMLDKDTLYQCFKCKKPQRAYKKLDLWTLPPILIIHLKRFQFLDKRWQKSHKTVRYPVRNLDLNKFIQRDNNNNVTNNSDHSSSETNRTQPGDENDAIYNLYAINCHLGSLQMGHYVTYALNKESNKWYLFNDSICKEVDEKEITMSCAYLLFYERANLNADTF 1422          
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Match: SMESG000021124.1 (SMESG000021124.1)

HSP 1 Score: 127.872 bits (320), Expect = 1.045e-29
Identity = 82/187 (43.85%), Postives = 108/187 (57.75%), Query Frame = 3
Query: 1962 GLTGLRNMGNTCYMNSVVQALSNTKFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPSDFKRMIDGKNEMFRGSEQHDSQXXXXXXXXXXXXXXNRGSKLSKVTLPVNEDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFDAFMYLSLPLVANH 2522
            G+ GL N+GNTC+MNS +Q +SN   LT Y +   ++ D+N  NPLG  G +   +  L+  +W        P DFK  +      F G  QHDSQE ++FLLDGLHEDLNR  K   +    ++D+    ++A ++WK H   NDSVIV  F G  +S V C  C+  SVTFDAF  LSLPLV  H
Sbjct:  224 GVCGLCNLGNTCFMNSAIQCISNVPPLTYYFIKTEWKKDLNTTNPLGMHGRLAERYHQLLEQMWVKGCNYTVPRDFKVEVAKFAPQFSGYAQHDSQELMMFLLDGLHEDLNRIQKKPYLESSDSDDQPVQ-KKAEEAWKYHKMRNDSVIVENFHGLLKSTVVCPDCKYVSVTFDAFGSLSLPLVLTH 409          

HSP 2 Score: 115.546 bits (288), Expect = 6.470e-26
Identity = 56/164 (34.15%), Postives = 88/164 (53.66%), Query Frame = 3
Query: 2520 HNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKKKIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHT-KQPQKH------DTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIRECDVKTPSGYILFYESYNLKQ 2990
            H    +E+C+  F+  E++     W+C  CK  + A KK D+W+LP  L++HLKRF      R K++TFV+FP+    L   +    +  + H      + Y L AVSNH G +  GHYT++  N   + W+ +DD   +KI    V+T + Y+L Y S ++ Q
Sbjct:  633 HRPLDVENCVNEFIRTEKLGINDLWYCKMCKDQKAATKKFDLWQLPKVLILHLKRFRSGSYRRDKIDTFVEFPLTDLDLSKFVSDAHRDAEDHNFQNGDEIYDLVAVSNHMGGLGGGHYTAYANNFIDSNWYLFDDSHTSKIASDSVQTKTAYVLVYVSKSVLQ 796          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP85.342e-10042.15ubiquitin specific peptidase 8 [Source:HGNC Symbol... [more]
USP83.023e-9942.15ubiquitin specific peptidase 8 [Source:HGNC Symbol... [more]
USP83.023e-9942.15ubiquitin specific peptidase 8 [Source:HGNC Symbol... [more]
USP25.089e-6240.41ubiquitin specific peptidase 2 [Source:HGNC Symbol... [more]
USP21.557e-6140.41ubiquitin specific peptidase 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp-502.405e-4432.84Ubiquitin Specific Protease [Source:UniProtKB/TrE... [more]
usp-502.405e-4432.84Ubiquitin Specific Protease [Source:UniProtKB/TrE... [more]
F07A11.42.790e-3443.37Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
F07A11.43.073e-3443.59Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
H34C03.21.013e-3343.24Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp82.271e-7339.84gene:FBgn0038862 transcript:FBtr0084016[more]
Usp84.211e-7341.35gene:FBgn0038862 transcript:FBtr0304714[more]
Usp23.142e-6138.12gene:FBgn0031187 transcript:FBtr0339506[more]
Usp23.489e-6038.12gene:FBgn0031187 transcript:FBtr0077346[more]
Usp23.489e-6038.12gene:FBgn0031187 transcript:FBtr0077348[more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp83.194e-10340.73ubiquitin specific peptidase 8 [Source:ZFIN;Acc:ZD... [more]
usp2b1.011e-6640.71ubiquitin specific peptidase 2b [Source:ZFIN;Acc:Z... [more]
usp2a1.424e-6440.06ubiquitin specific peptidase 2a [Source:ZFIN;Acc:Z... [more]
usp211.522e-4534.97ubiquitin specific peptidase 21 [Source:ZFIN;Acc:Z... [more]
usp211.522e-4534.97ubiquitin specific peptidase 21 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP83.619e-10742.33ubiquitin specific peptidase 8 [Source:NCBI gene;A... [more]
USP82.808e-10642.33ubiquitin specific peptidase 8 [Source:NCBI gene;A... [more]
USP85.281e-8036.30ubiquitin specific peptidase 8 [Source:NCBI gene;A... [more]
USP81.690e-7937.83ubiquitin specific peptidase 8 [Source:NCBI gene;A... [more]
USP82.235e-7937.63ubiquitin specific peptidase 8 [Source:NCBI gene;A... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp82.718e-10045.91ubiquitin specific peptidase 8 [Source:MGI Symbol;... [more]
Usp83.835e-10045.91ubiquitin specific peptidase 8 [Source:MGI Symbol;... [more]
Usp21.864e-6139.53ubiquitin specific peptidase 2 [Source:MGI Symbol;... [more]
Usp22.031e-6139.53ubiquitin specific peptidase 2 [Source:MGI Symbol;... [more]
Usp25.484e-6039.53ubiquitin specific peptidase 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80U87|UBP8_MOUSE1.901e-9945.91Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus mus... [more]
sp|P40818|UBP8_HUMAN1.452e-9842.15Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sa... [more]
sp|O57429|UBP2_CHICK1.262e-6741.21Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus ... [more]
sp|O75604|UBP2_HUMAN1.672e-5940.41Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sa... [more]
sp|O88623|UBP2_MOUSE3.697e-5939.53Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus mus... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P7V4Q61.681e-12932.44Ubiquitin carboxyl-terminal hydrolase 8-like OS=Sc... [more]
A0A3B3Q5738.299e-12330.63USP domain-containing protein OS=Paramormyrops kin... [more]
A0A4W3K2D33.258e-11930.83Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A3B3Q5Q56.146e-11730.39USP domain-containing protein OS=Paramormyrops kin... [more]
A0A1I8I6953.798e-10949.17Ubiquitin carboxyl-terminal hydrolase OS=Macrostom... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp81.243e-9840.63ubiquitin specific peptidase 8 [Source:ZFIN;Acc:ZD... [more]
usp2b1.742e-7041.89ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2b1.412e-6941.89ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2b6.080e-6941.89ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
usp2a7.144e-6940.94ubiquitin carboxyl-terminal hydrolase 2-like [Sour... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008243.13.551e-9645.26pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 ... [more]
usp42.073e-3850.27ubiquitin specific peptidase 4 (proto-oncogene) [S... [more]
ENSPMAT00000001826.15.126e-3742.53pep scaffold:Pmarinus_7.0:GL478831:2528:40053:1 ge... [more]
ENSPMAT00000003329.11.123e-3546.11pep scaffold:Pmarinus_7.0:GL476462:53018:71827:1 g... [more]
usp221.871e-3228.72ubiquitin specific peptidase 22 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBP51.267e-4234.70Putative ubiquitin-specific protease; concentrates... [more]
DOA45.724e-4032.97Ubiquitin hydrolase; deubiquitinates intralumenal ... [more]
UBP123.326e-2734.29Ubiquitin-specific protease; cleaves ubiquitin fro... [more]
UBP85.472e-2426.27Ubiquitin-specific protease component of the SAGA ... [more]
UBP111.156e-2326.65Ubiquitin-specific protease; cleaves ubiquitin fro... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO363015.905e-8540.48Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO348374.340e-5838.55Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO374661.158e-3630.83Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO444546.100e-3545.59Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO426511.345e-3331.56Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp81.414e-10541.74ubiquitin specific peptidase 8 [Source:NCBI gene;A... [more]
usp2b8.598e-7139.35ubiquitin carboxyl-terminal hydrolase 2 [Source:NC... [more]
usp2a4.426e-5741.49ubiquitin carboxyl-terminal hydrolase 2 [Source:NC... [more]
ENSORLT00000003855.23.010e-4331.83ubiquitin specific peptidase 50 [Source:NCBI gene;... [more]
usp217.636e-4235.59ubiquitin carboxyl-terminal hydrolase 21 [Source:N... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020277.10.000e+099.79SMESG000020277.1[more]
SMESG000053081.14.995e-6941.52SMESG000053081.1[more]
SMESG000039010.12.949e-3447.57SMESG000039010.1[more]
SMESG000062710.17.421e-3238.25SMESG000062710.1[more]
SMESG000021124.11.045e-2943.85SMESG000021124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000241 ID=SMED30000241|Name=Ubiquitin carboxyl-terminal hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=3217bp
CCTAATTTAAATATTTTTTTAATTGATATTTTTTAAAAATATCTTTCCTT
TAATTTATAGTCTAATGTCATAAGAATAGTAACATGGATAAAAAGCCACT
TTATGTAAGCTCAACTCTTACAGAACTTATGGAAAAGGCAGAGATGAATA
AAATAGAGTTGAGCAGCGTTATAAAATCATGTGAAATACTGGCAAAACTG
TATGAAAGATTTGAGCGGGCTTTACTTGATAAAGATGAAGAATTATCATT
GATATATGTTATGAGATTTTTGACACTGCTTACTAAAGTTAAAAAAGCAT
TTTCAAAAGATGCATCTTATATTACTTCACATTTTAACACTAAAACAATC
GATATTGCCTTTGAAAAAGCAGGTAAGCTAAAAGCAAGTCTTGAAGAGAG
ATATAAATGTATTCCGAAAATCGAAGAGATTCCTACTGTACAAGTAGAAA
TAACTAAAGATACTATAACAGAAACACCTAAAGATAATATAACAGTTGAA
GAGCTATATAAAATTATTAAAAAGAAGGAAAATGCTTTAGTTATTGACGT
GAGACCATCGAATGAATTTTTAAACAGTCATATTAGTTATGGTCAAGTCA
TAAACATTCCTTCAAATGAGTTGCAGCTTGGCTGCACAATCGTAAACGTC
AATAAAATTCTCGAATCTCGGAATGATTCTCTCGAATTAAACATCTGGAA
CAAGAGAAAGTCAGCCTCATTAGTTATACTAGTGGCATGGAATAGCGCTG
AGACTGGGAGGATCAATTTAGTGAAGGATGCTGTGTGTAAGTGGGACGCT
GAAAATTCAATAAAAAATGTAGTTGTTCTGGAACCTGGATTCCATTCATT
TTTGACCCATTATCCAACTATGGTAACGAATTCCAAATACAAAGGACCAG
ATGAAACCACCATAACGAATTTTATCCAACCAGATAATATCCACTATCCA
GACTGGGAAGCAATGGAAGCAGAAAAAAAGCGTAAAAAAGAATTGAAAAA
GCAAGAAGAACAAAAAAACACTGAAAACCAAGTTGAAAAAGAATCAGAAA
ATCGTTTTAATCAACCCAAATCTACAAATCAAACTTCAAAACCTGCAATT
AATACAAATGAAATCGTTCCCGGAGTGAAATCTAATCTTGTTATTGATCG
CTCGTTGAAACCAATGATACCGCAACTGATCACCAGTCAGGATGAAGCTG
TTGTACCAGACGAAACGAATAAAATTCGTACTTTACTTGTACCAAAAGAA
AATGTCGCTGTCGATCCTAAAAAAGAAAAATCATTATCCACACCAGATCG
ATCTTTGAAACCTAACGTTCTCCGAGAGATTAATATCGATCCAAATCAAC
CTCTTTTAGATGAGCCTAAGAATTTAGAAAGTGTTGATGCTGTTTCAGAT
TTAAATGCACCGACAGAAACCACTCCACGTCTTTCTAACAATTCTCGTAC
GTATCATGATCGGACGAATTTCACTGCAAAAGGTGGCGCAAAATCGATTC
CTCCTCCAACAGATGTGATCGAGTCCAAGAAACCCGACTTGCCTCCTTGG
ATTACTCACGTTTTCGATCATGCTACAAATGAATACTATTATATCGATAA
TAAAAACAACAAGAAATGGAGATATCCCCCCGATGAAGTAATTGAGAATA
GTAATGAGTGTTCTACACAACGCGATTGTGTCGAGACGCTGAAAGATCAC
TCGGCTATTAATAAATCAATGTCCAAACAGATTTCAGGAAGTTCTCTAAA
ACGATCAACGAGTCAACCGAATCTATCAGATGACTTGATTTCTCATAAAC
CACCAATGAGCACTGATAACTCCATAATCACTAACACATCAAAGCAGTAT
GAATTACCGGCACTCAATAGACTAACAAAACCATGTTCGACCAAGACATT
CACGGAATTCTCTGCTAGTCGTCTTAATAACTTTAATCCTAACTACAGAA
CAGTGACCCCTGGGTTAACTGGTCTGAGAAATATGGGCAACACTTGTTAC
ATGAACAGTGTTGTGCAAGCACTTAGCAATACGAAATTTCTCACCAATTA
TATTCTAACAAATAGTTACCAACACGATATCAACAGGGATAATCCATTGG
GATATGGAGGTGAAATCGTTATTGAATTTGCTTACTTAATAACTGCACTA
TGGACTGGAAATTATAGAGAAGTATCTCCATCAGATTTCAAACGTATGAT
TGATGGTAAAAATGAGATGTTTCGAGGAAGCGAACAACACGATAGTCAAG
AATTTTTATTATTTTTACTTGATGGTCTACATGAAGATTTAAATAGAGGA
AGTAAACTTTCAAAGGTAACTCTACCTGTCAATGAAGATAAGATCACTGA
TATTGAAAGAGCAAATCAGTCTTGGAAAACACACATAGCAATAAATGATT
CCGTGATTGTGCGAATATTTCAGGGACAATATCGTTCTAAAGTAACATGC
GACCATTGCCAAATGACGTCAGTAACTTTTGATGCATTTATGTATTTAAG
TCTTCCCCTCGTAGCTAATCATAATCGATGTTCTCTTGAGGATTGCTTGA
AGCTATTTCTAGCCGAGGAGAGAATGACTGGTGCAAGTCAGTGGTTCTGC
CCAAAATGTAAAAGCAATCGAAATGCCAAAAAGAAAATAGATATATGGAA
ATTACCACCTTATTTATTAATTCATCTAAAACGATTTTCTTGTACCGGAC
AATATCGTCAAAAATTGAATACTTTCGTTGACTTTCCAATGGAATCGTTT
TCGCTAGTTGACATTCTTAAGCATACAAAACAACCACAAAAGCATGACAC
TTATCATCTCTACGCTGTTTCGAATCATCATGGCAACATGGAATCTGGTC
ATTATACTTCATTTTGTAAAAATATGAAAGCTAACGAGTGGCACAATTAC
GATGACGATGTCGTAACAAAAATCAGAGAATGTGATGTTAAAACTCCGTC
TGGATATATTTTATTCTATGAAAGCTATAATTTGAAACAGGCTGGATTTA
AGAGTTAAATAACCATGTGAATATGAACATTATTATTATTATTATTATAG
TCATCTTTGCTGTTGTTATTATTCATCAATAAGTCACCACTGGGATGCTG
ATAATTAATGAGGGAAATTTCTGGTATTATTATTATTGTGTATTTATTAA
ATTTCAAAATCTGGAGCTGATTAAATGGAATTTATTATTCTGATTCTTTT
CCACTAGTGTTCTTCTA
back to top

protein sequence of SMED30000241-orf-1

>SMED30000241-orf-1 ID=SMED30000241-orf-1|Name=SMED30000241-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=975bp
MDKKPLYVSSTLTELMEKAEMNKIELSSVIKSCEILAKLYERFERALLDK
DEELSLIYVMRFLTLLTKVKKAFSKDASYITSHFNTKTIDIAFEKAGKLK
ASLEERYKCIPKIEEIPTVQVEITKDTITETPKDNITVEELYKIIKKKEN
ALVIDVRPSNEFLNSHISYGQVINIPSNELQLGCTIVNVNKILESRNDSL
ELNIWNKRKSASLVILVAWNSAETGRINLVKDAVCKWDAENSIKNVVVLE
PGFHSFLTHYPTMVTNSKYKGPDETTITNFIQPDNIHYPDWEAMEAEKKR
KKELKKQEEQKNTENQVEKESENRFNQPKSTNQTSKPAINTNEIVPGVKS
NLVIDRSLKPMIPQLITSQDEAVVPDETNKIRTLLVPKENVAVDPKKEKS
LSTPDRSLKPNVLREINIDPNQPLLDEPKNLESVDAVSDLNAPTETTPRL
SNNSRTYHDRTNFTAKGGAKSIPPPTDVIESKKPDLPPWITHVFDHATNE
YYYIDNKNNKKWRYPPDEVIENSNECSTQRDCVETLKDHSAINKSMSKQI
SGSSLKRSTSQPNLSDDLISHKPPMSTDNSIITNTSKQYELPALNRLTKP
CSTKTFTEFSASRLNNFNPNYRTVTPGLTGLRNMGNTCYMNSVVQALSNT
KFLTNYILTNSYQHDINRDNPLGYGGEIVIEFAYLITALWTGNYREVSPS
DFKRMIDGKNEMFRGSEQHDSQEFLLFLLDGLHEDLNRGSKLSKVTLPVN
EDKITDIERANQSWKTHIAINDSVIVRIFQGQYRSKVTCDHCQMTSVTFD
AFMYLSLPLVANHNRCSLEDCLKLFLAEERMTGASQWFCPKCKSNRNAKK
KIDIWKLPPYLLIHLKRFSCTGQYRQKLNTFVDFPMESFSLVDILKHTKQ
PQKHDTYHLYAVSNHHGNMESGHYTSFCKNMKANEWHNYDDDVVTKIREC
DVKTPSGYILFYESYNLKQAGFKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036873Rhodanese-like_dom_sf
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR001763Rhodanese-like_dom
IPR015063USP8_dimer
IPR018200USP_CS
IPR028889USP_dom
Vocabulary: biological process
TermDefinition
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006508proteolysis
GO:0007032endosome organization
GO:0007049cell cycle
GO:0007265Ras protein signal transduction
GO:0070536protein K63-linked deubiquitination
GO:0071108protein K48-linked deubiquitination
GO:0098609cell-cell adhesion
GO:0000281mitotic cytokinesis
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
GO:0017124SH3 domain binding
GO:0098641cadherin binding involved in cell-cell adhesion
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005913cell-cell adherens junction
GO:0010008endosome membrane
GO:0016020membrane
GO:0019897extrinsic component of plasma membrane
GO:0030496midbody
GO:0031313extrinsic component of endosome membrane
GO:0005622intracellular
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005768endosome
GO:0005769early endosome
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 291..324
NoneNo IPR availableGENE3DG3DSA:1.20.58.280coord: 9..134
e-value: 1.1E-14
score: 56.3
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 614..965
e-value: 3.8E-127
score: 426.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 298..325
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 298..339
NoneNo IPR availablePANTHERPTHR21646FAMILY NOT NAMEDcoord: 110..412
NoneNo IPR availablePANTHERPTHR21646FAMILY NOT NAMEDcoord: 294..968
NoneNo IPR availablePANTHERPTHR21646:SF27UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 8coord: 294..968
NoneNo IPR availablePANTHERPTHR21646:SF27UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 8coord: 110..412
NoneNo IPR availableCDDcd02674Peptidase_C19Rcoord: 630..963
e-value: 9.46903E-91
score: 286.491
NoneNo IPR availableSUPERFAMILYSSF140856USP8 N-terminal domain-likecoord: 2..119
IPR015063USP8 dimerisation domainPFAMPF08969USP8_dimercoord: 3..108
e-value: 1.5E-10
score: 41.3
IPR036873Rhodanese-like domain superfamilyGENE3DG3DSA:3.40.250.10coord: 135..269
e-value: 2.3E-25
score: 91.4
IPR036873Rhodanese-like domain superfamilySUPERFAMILYSSF52821Rhodanese/Cell cycle control phosphatasecoord: 135..273
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 629..962
e-value: 1.1E-72
score: 244.6
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00973USP_2coord: 907..924
IPR018200Ubiquitin specific protease, conserved sitePROSITEPS00972USP_1coord: 630..645
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 629..965
score: 56.526
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 622..963