Otoferlin

Overview
NameOtoferlin
Smed IDSMED30000223
Length (bp)6318
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Otoferlin (SMED30000223) t-SNE clustered cells

Violin plots show distribution of expression levels for Otoferlin (SMED30000223) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Otoferlin (SMED30000223) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Otoferlin (SMED30000223) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000223

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30000223SMESG000010367.1 dd_Smed_v4_5099_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000223SMESG000010367.1 dd_Smed_v4_3993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000223SMESG000010367.1 dd_Smed_v4_5099_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000223SMESG000010367.1 dd_Smed_v4_5099_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000223SMESG000010367.1 dd_Smed_v4_3993_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000223SMESG000010367.1 dd_Smed_v4_3993_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30000223SMESG000010367.1 dd_Smed_v4_3993_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000223SMESG000010367.1 dd_Smed_v4_3993_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30000223SMESG000010367.1 dd_Smed_v4_3993_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 597.43 bits (1539), Expect = 4.668e-178
Identity = 348/1032 (33.72%), Postives = 556/1032 (53.88%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIA-----IKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNG-KPLTFEMSIGITGNLLDDYAKVAS---EKEPTPENQY-------------------VHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +S   M + IIKI  +   N      + +G ++G F +D  +VY+   H F  KWA L DP   +SG KGYVK D++V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT++++N+K A  GE K L D YV+V FAG  G+T V   +Y P WN+Q++FT+ FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL++      + TS    +S   V V    P+S + AGK E + LFG   E ++I+    +NG KP+TFE++IG  GN +D  ++       KEP  E +                    V S    R   T D  YFH+PY  +KPC+++ +   D R R++  NI++ +  +L E +     +I  EK+   RR L+  +  L     + +S     +G + +T LD +  +    +LE M  + + L  ++KR  V +K+R C   ++ L     +PQ+ +PDIFI+M+  N RVAYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA++++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ IYRG   AG++LAAF+L+++          G     D+  +   ++ +R   M      +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:  244 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN-----LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVP-PERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDR---RNGDKPITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASDDEAGDAGDLASVSSTPPMRPQVT-DRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDIQEMIKTEKSYPERR-LRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQI----------GPAGKADLPPINGPVDVDRGPIMP-----VPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 1226          

HSP 2 Score: 476.863 bits (1226), Expect = 8.506e-137
Identity = 259/638 (40.60%), Postives = 389/638 (60.97%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEI-VPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            I+ + +YP ELE+  +F  F D   +F+L RGK  +D+D     +R  G FKG++C+Y +   +    +   +                                    T  +++ +   +P++ +VRVY+++A +LHP+D+NGK+DPYI ++LG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC++  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  +  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD SF+ FLNP  + +YF+ +  +W+L+K+ ++ + LL++ALF+Y+ PG +   I+
Sbjct: 1405 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDS-----------------------------------TYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGP-PGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKLLLLLLLLLLLALFLYSVPGYLVKKIL 1995          

HSP 3 Score: 61.2326 bits (147), Expect = 2.553e-8
Identity = 31/118 (26.27%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIY-FGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L ++LK +      GD+  K+ FR     S  L+   ++  F + F WP+A  +D+N++L ++ +N ++V  +KL+G  ++    ++ E  + V + L+D+   I    +  E+ Y
Sbjct:    1 MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRY 118          
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 597.045 bits (1538), Expect = 6.135e-178
Identity = 348/1032 (33.72%), Postives = 556/1032 (53.88%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIA-----IKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNG-KPLTFEMSIGITGNLLDDYAKVAS---EKEPTPENQY-------------------VHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +S   M + IIKI  +   N      + +G ++G F +D  +VY+   H F  KWA L DP   +SG KGYVK D++V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT++++N+K A  GE K L D YV+V FAG  G+T V   +Y P WN+Q++FT+ FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL++      + TS    +S   V V    P+S + AGK E + LFG   E ++I+    +NG KP+TFE++IG  GN +D  ++       KEP  E +                    V S    R   T D  YFH+PY  +KPC+++ +   D R R++  NI++ +  +L E +     +I  EK+   RR L+  +  L     + +S     +G + +T LD +  +    +LE M  + + L  ++KR  V +K+R C   ++ L     +PQ+ +PDIFI+M+  N RVAYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA++++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ IYRG   AG++LAAF+L+++          G     D+  +   ++ +R   M      +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:  244 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN-----LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVP-PERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDR---RNGDKPITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASDDEAGDAGDLASVSSTPPMRPQVT-DRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDIQEMIKTEKSYPERR-LRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQI----------GPAGKADLPPINGPVDVDRGPIMP-----VPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 1226          

HSP 2 Score: 485.337 bits (1248), Expect = 1.027e-139
Identity = 264/643 (41.06%), Postives = 389/643 (60.50%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEI-VPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            I+ + +YP ELE+  +F  F D   +F+L RGK  +D+D     +R  G FKG++C+Y +   +    +   +                                    T  +++ +   +P++ +VRVY+++A +LHP+D+NGK+DPYI ++LG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC++  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  +  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD +F+ FLNP  +IKY I  R KW++IKI +  + LL++ LF+Y+ PG     +V K+ G
Sbjct: 1405 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDS-----------------------------------TYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGP-PGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKIVLALLGLLMLGLFLYSLPG----YMVKKLLG 1996          

HSP 3 Score: 61.2326 bits (147), Expect = 2.663e-8
Identity = 31/118 (26.27%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIY-FGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L ++LK +      GD+  K+ FR     S  L+   ++  F + F WP+A  +D+N++L ++ +N ++V  +KL+G  ++    ++ E  + V + L+D+   I    +  E+ Y
Sbjct:    1 MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRY 118          
BLAST of Otoferlin vs. Ensembl Human
Match: FER1L6 (fer-1 like family member 6 [Source:HGNC Symbol;Acc:HGNC:28065])

HSP 1 Score: 531.946 bits (1369), Expect = 3.748e-156
Identity = 337/1081 (31.17%), Postives = 543/1081 (50.23%), Query Frame = 2
Query:  710 KLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPK-RPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTS---------------------------------YQPDSSKIGVDVRPCNPVSNT-------------VAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTP------------ENQYVHSMTQSRFAYTYDNK---------YFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRS-NVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVK--DIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQC 3727
            KL   I    ++ +++QI++TI EAR L G NI+P+  +  G +K+ + +K  TNSPFYNE+F FD    ++ + + IIKI       +V   ++    ++G F +D  +VY   GH F  KWA L DP    +G KGY+K DISV+  GD  K  P   D EE   IE NLLIP       R      V +Y+AE LP MN++I++N+  A  G+ K L D +VEVSFAG  GRT V      P W++Q+IF E FPP   R++I V D   + D  ++T FIDL+KI       ++GFLPT+GP+WINLYG+PR  +   L+   Q  N+   EGV++RGR+++ I                                     + D ++ G   +  N  ++T             V  K E +LLFG  +E T+I+  +G   KP++FE+SIG  GNL+D  +   S+K                +    H +     + T+  K         Y ++P++ KKPC++ I+   D   R+   N++EK+   L E I +   LI + +     + +KT + + I      +S  +       +T LD K   L   +LE M  + + +  + K+  +V E + E    V+ +   + +PQ+ +PD+FI+M+  N RVAYARI ++++++S +A + G  CG + T +LK       K    +++QA++ +YLWLG ++        LP GY  E  S       PP  + Y ++ +FQLR +++ AR +I +D +GLSDPFA++    H   + I +QT SP W++ L+ ++++ +     L  SPP VVVE++D D+    E+LG     P V +    Y   +L +  I+ G L+ G++LA F+L+++        ++GLP V+  DI ++                  +P  IRP LS +R E+L WGVR++++++++                 V++P+  I+  G  ++S  I  +   PNF       ++ LP +    PP++I   +   FG   +VG   I N +  + C
Sbjct:   68 KLLTKIHDGEVRSQNYQIAITITEARQLVGENIDPVVTIEIGDEKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKI-------SVFHHKLIGSVLIGSFKVDLGTVYNQPGHQFCNKWALLTDPGDIRTGTKGYLKCDISVMGKGDVLKTSPKTSDTEEP--IEKNLLIPNGFP-LERPWARFYVRLYKAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQMGRTTVQKNCADPVWHEQVIFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKIS-NEQDGDKGFLPTFGPAWINLYGSPRNHS---LMDDYQEMNEGFGEGVSFRGRILVEIAVEILSGRAQESKFSKALKELKLPSKDKDSKSSKGKDKADKTEDGKSQQASNKTNSTEVEVESFDVPPEIVPEKNEEFLLFGAFFEATMIDRKIGD--KPISFEVSIGNFGNLIDGGSHHGSKKSAESAEEDLLPLLHEGQGDVAHDVPIPMASTTHPEKPLVTEGNRNYNYLPFEAKKPCVYFISSWGDQTFRLHWSNMLEKMADFLEESIEEVRELIKISQEAPEEK-MKTVLSDFISRSSAFISEAEKKPKMLNQTTLDKKRLTLCWQELEAMCKEAKGIIQQQKKKLSVDEMIHEAQNFVEKIRFLVDEPQHTIPDVFIWMLSNNRRVAYARIASKDLLYSPVAGQMGKHCGKIKTHFLKPPG----KRPAGWSVQAKVDVYLWLGSIKHASAILDNLPVGYEAEMSSKGAGTNHPPSNLLYQEQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNDLVLHGDVKELAESPPLVVVELYDSDAVGKPEYLGATVAAPVVKLADQDYEPPRLCYHPIFCGNLSGGDLLAVFELLQVPPS----GLQGLPPVEPPDITQIYP----------------VPANIRPVLSKYRVEVLFWGVREMKKVQLLS----------------VDRPQALIECGGQGVKSCVIQSYKNNPNFSIQADAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTI-NYLKQFLC 1090          

HSP 2 Score: 455.292 bits (1170), Expect = 3.103e-130
Identity = 261/633 (41.23%), Postives = 370/633 (58.45%), Query Frame = 2
Query: 4334 IMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMI-EDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCD--PFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            + +Y  +LE+  +F  F D  K+F L+RGK  EDD   +  DR  G FKG+ CIY                                          Q+   E    LR+ + +   +PV  ++RVYI+ A NL P+D +GKSDPYI++KLG  E++DR+ YIPK LNPVFG+  E++ TFP+ES L + IYD D +  DDLIGET IDLENR+ S H+  CG+   Y   GY  W+D   PT IL  LC+++ +  P +     ++ I ++ F  +T+  E+D    ++S E LAL+VLH W +I   G +LVPE+IETRPLY  +KPG++QG L+MWVDM+P     P  P+DI+PR+  GYELR T+  TE V L + N FT +K+ DI+VK W+K  + D Q+TDVHY SL+G+G FNWRF++ F YL AE  +V T++ +++ +++ E KTP  L +QV D   + SD  +G  +  L+ FP+ AK  ++CD   F+ +    K ++F+ K+VRGWWP   + +               VE E  LVTAEEAE NPVG  R EP PL  P RPD SF  F++P+  + Y I    K  +I  F++ + ++ + LFIY  PG+IS  IV
Sbjct: 1277 LQIYDGDLES--EFNNFEDWVKTFELFRGKSTEDDHGLDG-DRVIGKFKGSFCIYK---------------------------------------SPQDSSSEDSGQLRIQQGIPPNHPVTVLIRVYIVAAFNLSPADPDGKSDPYIVIKLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFH--PGKIQIGNQVFSGKTIFTEEDTDETVESYEHLALKVLHSWEDIPEVGCRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDMPQPGPPVDISPRRPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGTLEMNLNSFPRAAKSAKACDLAKFENASEETKISIFQQKRVRGWWPFSKSKELTGK-----------VEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMSPFKCLYYLIWKNYKKYIIIAFILIILIIFLVLFIYTLPGAISRRIV 1854          
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 481.871 bits (1239), Expect = 2.603e-143
Identity = 264/643 (41.06%), Postives = 389/643 (60.50%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEI-VPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            I+ + +YP ELE+  +F  F D   +F+L RGK  +D+D     +R  G FKG++C+Y +   +    +   +                                    T  +++ +   +P++ +VRVY+++A +LHP+D+NGK+DPYI ++LG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC++  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  +  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD +F+ FLNP  +IKY I  R KW++IKI +  + LL++ LF+Y+ PG     +V K+ G
Sbjct:  638 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDS-----------------------------------TYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGP-PGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKIVLALLGLLMLGLFLYSLPGY----MVKKLLG 1229          

HSP 2 Score: 258.07 bits (658), Expect = 5.247e-69
Identity = 152/512 (29.69%), Postives = 266/512 (51.95%), Query Frame = 2
Query: 2201 LISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            +I  EK+   RR L+  +  L     + +S     +G + +T LD +  +    +LE M  + + L  ++KR  V +K+R C   ++ L     +PQ+ +PDIFI+M+  N RVAYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA++++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ IYRG   AG++LAAF+L+++          G     D+  +   ++ +R   M      +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:    1 MIKTEKSYPERR-LRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQI----------GPAGKADLPPINGPVDVDRGPIMP-----VPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 479          
BLAST of Otoferlin vs. Ensembl Human
Match: OTOF (otoferlin [Source:HGNC Symbol;Acc:HGNC:8515])

HSP 1 Score: 473.396 bits (1217), Expect = 2.113e-140
Identity = 259/638 (40.60%), Postives = 389/638 (60.97%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEI-VPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            I+ + +YP ELE+  +F  F D   +F+L RGK  +D+D     +R  G FKG++C+Y +   +    +   +                                    T  +++ +   +P++ +VRVY+++A +LHP+D+NGK+DPYI ++LG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC++  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  +  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD SF+ FLNP  + +YF+ +  +W+L+K+ ++ + LL++ALF+Y+ PG +   I+
Sbjct:  638 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDS-----------------------------------TYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGP-PGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKLLLLLLLLLLLALFLYSVPGYLVKKIL 1228          

HSP 2 Score: 258.455 bits (659), Expect = 4.681e-69
Identity = 152/512 (29.69%), Postives = 266/512 (51.95%), Query Frame = 2
Query: 2201 LISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            +I  EK+   RR L+  +  L     + +S     +G + +T LD +  +    +LE M  + + L  ++KR  V +K+R C   ++ L     +PQ+ +PDIFI+M+  N RVAYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA++++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ IYRG   AG++LAAF+L+++          G     D+  +   ++ +R   M      +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:    1 MIKTEKSYPERR-LRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQI----------GPAGKADLPPINGPVDVDRGPIMP-----VPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 479          
BLAST of Otoferlin vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 111.694 bits (278), Expect = 4.502e-24
Identity = 102/377 (27.06%), Postives = 156/377 (41.38%), Query Frame = 2
Query: 5186 GSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAG-TAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKF------PQPAKFYRS---------------------CDPFQLSEACA-------------------------KFNLFRNKKVRGWWPLIYN----------PKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPW------NTIKYFIKY 6109
            GSQ++++    L  ++          LVPE++E+RPL+  +    Q+G L M+VD++P    AIPAP +I PRK I Y+LR  V+       +  +F   E   D++VK+++        KTD H++ L G G FNWRF+ NFDY   E  +V   K+ +     E      L +++ D      D ++G  +  L  F      P     Y +                     C  F     C                            N+F ++ + GWWP++             K  D   +D + I G VE++M L+T +EA+  P G  R+EP       +PD    S+ N W        IKYF  Y
Sbjct: 1635 GSQLQTIALFILRQMN----------LVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRSF--AEPVSDLYVKAFINGM-TKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFCKPVEELVDPILVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKWIMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRK--SWANSWLVSRIKPCIKYFWHY 1996          

HSP 2 Score: 93.9745 bits (232), Expect = 1.186e-18
Identity = 52/151 (34.44%), Postives = 84/151 (55.63%), Query Frame = 2
Query: 4682 INPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLP-IYDKLTDR 5131
            + P   +VRVYII+A  L  +   G+ D Y+ +  G + V  ++NY  +  +P+FG+ +++ VT P E  L + +    R+  D  IG TTIDLENR L+  + + G+   +   G L+W+D   P  ILKS C +  + +P I  + T+R
Sbjct: 1378 VGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIESRQTER 1528          

HSP 3 Score: 92.8189 bits (229), Expect = 2.706e-18
Identity = 76/325 (23.38%), Postives = 140/325 (43.08%), Query Frame = 2
Query: 2828 FQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSI-YRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNF-EDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDY-------YQCDQVDNFREIDKTTIDE 3775
            +QLR Y+    +++    +  S  F RI  +++  ++ +   +++PIW+ET++  +++       +   PP V VE+    S+ +E  LG    +P V I G+       QW+ + +      G +LA F+L   +              KD+  +  +   N Y E  E    IP   RP    F  + L WGVR L                K+  +  V +P + + I         + D    PNF E  +VF ++ LP++ +  PP+ IN  ++  F  + +VG+C +++L  Y        + D  + + ++D    +E
Sbjct:  972 WQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNV-ICGNTDVRGTPQWFPLKFSNGRTRGAVLACFELYSEE-------------DKDLIPLEPKCKHN-YKERSE----IPTEFRPQFDKFHVQFLCWGVRNL----------------KKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYVSHIVPKVKSDHAERWEQLDLVITEE 1260          

HSP 4 Score: 75.0998 bits (183), Expect = 5.943e-13
Identity = 125/630 (19.84%), Postives = 246/630 (39.05%), Query Frame = 2
Query:  944 IKIRGLSK-SNNVVAQRIFTGKVLGEFSIDAKSVYTNE-----GHSFFRKWA----PLIDPKSPTS---GEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDL--PCMNTNIISNIK--HAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPV--SNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDN-KYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEII--------RQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTA-KKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMA-DPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYK 2743
            IK + L K +  V+  R+     LGE S+   S Y +E       S   KW     P +D + P        G++KV +SV    + P     DD +E     A+L+              + + ++  E L    +N   I   +  + +   G   T+  +E +F         V       + Q+I    ++P  ++ +  ++ D        I    + ++ I   G   E G+LPT+GP+++N++   R   ++   +  +G  Q+   G  + GRL IAI      + +   +     +P+  + ++    E Y  F  +    +IN     +  P+   MSIG  G+  +++    S   P   N              +D  KYF +P+ N +P   +    E    R+ + N++ K+   L  +I        +   H+ S+   ++A   L+      I S  K +  +      A  + +LD + +++++L   +   + +  +++     V  K+      ++ +  ++A D Q  +P + I M+     + +A+I   EI  S    + G  CG    + ++     + + N      A L   +W G    +  +K
Sbjct:  147 IKNQPLEKLAAKVLTLRLVRPTALGESSVGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKEQIWSGAHLID-----------YTLKIRVFSVEQLIRQMINERKIKKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVK------FEQEIYLPIQWPTVISEIIFSLFDKKGRGKTCIGKATLPMKMIYEPG---ETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRGSQQD---GSRFVGRLFIAIDCVEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFASD--PVCIMMSIGSFGSTSNEFRSCNSSTLPAEPN--------------WDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSV--GMEALECLEQQ----IDSASKYLGRINPVSSNALDRHILDYRKEKILKL---REHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQ-WPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWK 727          
BLAST of Otoferlin vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 111.694 bits (278), Expect = 5.170e-24
Identity = 102/377 (27.06%), Postives = 156/377 (41.38%), Query Frame = 2
Query: 5186 GSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAG-TAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKF------PQPAKFYRS---------------------CDPFQLSEACA-------------------------KFNLFRNKKVRGWWPLIYN----------PKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPW------NTIKYFIKY 6109
            GSQ++++    L  ++          LVPE++E+RPL+  +    Q+G L M+VD++P    AIPAP +I PRK I Y+LR  V+       +  +F   E   D++VK+++        KTD H++ L G G FNWRF+ NFDY   E  +V   K+ +     E      L +++ D      D ++G  +  L  F      P     Y +                     C  F     C                            N+F ++ + GWWP++             K  D   +D + I G VE++M L+T +EA+  P G  R+EP       +PD    S+ N W        IKYF  Y
Sbjct: 1508 GSQLQTIALFILRQMN----------LVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRSF--AEPVSDLYVKAFINGM-TKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFCKPVEELVDPILVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKWIMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRK--SWANSWLVSRIKPCIKYFWHY 1869          

HSP 2 Score: 93.9745 bits (232), Expect = 1.237e-18
Identity = 52/151 (34.44%), Postives = 84/151 (55.63%), Query Frame = 2
Query: 4682 INPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLP-IYDKLTDR 5131
            + P   +VRVYII+A  L  +   G+ D Y+ +  G + V  ++NY  +  +P+FG+ +++ VT P E  L + +    R+  D  IG TTIDLENR L+  + + G+   +   G L+W+D   P  ILKS C +  + +P I  + T+R
Sbjct: 1251 VGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIESRQTER 1401          

HSP 3 Score: 93.2041 bits (230), Expect = 2.212e-18
Identity = 76/325 (23.38%), Postives = 140/325 (43.08%), Query Frame = 2
Query: 2828 FQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSI-YRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNF-EDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDY-------YQCDQVDNFREIDKTTIDE 3775
            +QLR Y+    +++    +  S  F RI  +++  ++ +   +++PIW+ET++  +++       +   PP V VE+    S+ +E  LG    +P V I G+       QW+ + +      G +LA F+L   +              KD+  +  +   N Y E  E    IP   RP    F  + L WGVR L                K+  +  V +P + + I         + D    PNF E  +VF ++ LP++ +  PP+ IN  ++  F  + +VG+C +++L  Y        + D  + + ++D    +E
Sbjct:  845 WQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNV-ICGNTDVRGTPQWFPLKFSNGRTRGAVLACFELYSEE-------------DKDLIPLEPKCKHN-YKERSE----IPTEFRPQFDKFHVQFLCWGVRNL----------------KKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYVSHIVPKVKSDHAERWEQLDLVITEE 1133          

HSP 4 Score: 75.8702 bits (185), Expect = 3.952e-13
Identity = 125/630 (19.84%), Postives = 246/630 (39.05%), Query Frame = 2
Query:  944 IKIRGLSK-SNNVVAQRIFTGKVLGEFSIDAKSVYTNE-----GHSFFRKWA----PLIDPKSP---TSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDL--PCMNTNIISNIK--HAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPV--SNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDN-KYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEII--------RQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTA-KKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMA-DPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYK 2743
            IK + L K +  V+  R+     LGE S+   S Y +E       S   KW     P +D + P        G++KV +SV    + P     DD +E     A+L+              + + ++  E L    +N   I   +  + +   G   T+  +E +F         V       + Q+I    ++P  ++ +  ++ D        I    + ++ I   G   E G+LPT+GP+++N++   R   ++   +  +G  Q+   G  + GRL IAI      + +   +     +P+  + ++    E Y  F  +    +IN     +  P+   MSIG  G+  +++    S   P   N              +D  KYF +P+ N +P   +    E    R+ + N++ K+   L  +I        +   H+ S+   ++A   L+      I S  K +  +      A  + +LD + +++++L   +   + +  +++     V  K+      ++ +  ++A D Q  +P + I M+     + +A+I   EI  S    + G  CG    + ++     + + N      A L   +W G    +  +K
Sbjct:   20 IKNQPLEKLAAKVLTLRLVRPTALGESSVGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKEQIWSGAHLID-----------YTLKIRVFSVEQLIRQMINERKIKKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVK------FEQEIYLPIQWPTVISEIIFSLFDKKGRGKTCIGKATLPMKMIYEPG---ETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRGSQQD---GSRFVGRLFIAIDCVEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFASD--PVCIMMSIGSFGSTSNEFRSCNSSTLPAEPN--------------WDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSV--GMEALECLEQQ----IDSASKYLGRINPVSSNALDRHILDYRKEKILKL---REHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQ-WPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWK 600          
BLAST of Otoferlin vs. Ensembl Celegans
Match: fer-1 (Sperm vesicle fusion protein fer-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17388])

HSP 1 Score: 111.694 bits (278), Expect = 5.170e-24
Identity = 102/377 (27.06%), Postives = 156/377 (41.38%), Query Frame = 2
Query: 5186 GSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAG-TAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKF------PQPAKFYRS---------------------CDPFQLSEACA-------------------------KFNLFRNKKVRGWWPLIYN----------PKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPW------NTIKYFIKY 6109
            GSQ++++    L  ++          LVPE++E+RPL+  +    Q+G L M+VD++P    AIPAP +I PRK I Y+LR  V+       +  +F   E   D++VK+++        KTD H++ L G G FNWRF+ NFDY   E  +V   K+ +     E      L +++ D      D ++G  +  L  F      P     Y +                     C  F     C                            N+F ++ + GWWP++             K  D   +D + I G VE++M L+T +EA+  P G  R+EP       +PD    S+ N W        IKYF  Y
Sbjct: 1508 GSQLQTIALFILRQMN----------LVPEHVESRPLFSDKGGRTQKGELRMFVDIFPMEYGAIPAPFNIAPRKPINYQLRIAVMDVRGAIPVKRSF--AEPVSDLYVKAFINGM-TKGHKTDTHFRVLDGTGEFNWRFLLNFDYNPWEKKVVAYTKNRFFCKPVEELVDPILVIELWDKNKFRKDRLLGDIELDLLDFIEGIGSPSDVGVYSTKKRQRGVKCPKCCTRRGCLCKCCIFCFETKCLCGKRKVKKKPFPKPVLFVEPEGYDDTVNIFESRNLYGWWPMLTEEYPHEEPQNAKKKNDDVGKDPKWIMGLVEMDMLLLTKQEADQEPAGKKRSEPNHSPFLEKPDRK--SWANSWLVSRIKPCIKYFWHY 1869          

HSP 2 Score: 93.9745 bits (232), Expect = 1.237e-18
Identity = 52/151 (34.44%), Postives = 84/151 (55.63%), Query Frame = 2
Query: 4682 INPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLP-IYDKLTDR 5131
            + P   +VRVYII+A  L  +   G+ D Y+ +  G + V  ++NY  +  +P+FG+ +++ VT P E  L + +    R+  D  IG TTIDLENR L+  + + G+   +   G L+W+D   P  ILKS C +  + +P I  + T+R
Sbjct: 1251 VGPTRCLVRVYIIEANGLISNARKGRVDSYVKLHCGKQNVNLKKNYRSECCDPIFGERVDMTVTIPLEKDLKITVMGKRRILSDQEIGSTTIDLENRLLTKWRATGGLSGQFTVQGELQWRDQMTPMEILKSYCYKMMLSVPKIESRQTER 1401          

HSP 3 Score: 93.2041 bits (230), Expect = 2.212e-18
Identity = 76/325 (23.38%), Postives = 140/325 (43.08%), Query Frame = 2
Query: 2828 FQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSI-YRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNF-EDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDY-------YQCDQVDNFREIDKTTIDE 3775
            +QLR Y+    +++    +  S  F RI  +++  ++ +   +++PIW+ET++  +++       +   PP V VE+    S+ +E  LG    +P V I G+       QW+ + +      G +LA F+L   +              KD+  +  +   N Y E  E    IP   RP    F  + L WGVR L                K+  +  V +P + + I         + D    PNF E  +VF ++ LP++ +  PP+ IN  ++  F  + +VG+C +++L  Y        + D  + + ++D    +E
Sbjct:  845 WQLRCYIMWGNDLLPVVKNS-SRAFVRISFAQYSKQTLLVDNSQNPIWNETVMFKSVLIAGGTRDIMKYPPVVSVEVVGECSNNEEANLGHFETKPNV-ICGNTDVRGTPQWFPLKFSNGRTRGAVLACFELYSEE-------------DKDLIPLEPKCKHN-YKERSE----IPTEFRPQFDKFHVQFLCWGVRNL----------------KKHKLLAVRRPFVGLTIGDQEFTLQPLKDVRRDPNFPEPMIVFGEVILPSALELSPPLIINLFDARAFNRQPLVGSCLVSDLHKYVSHIVPKVKSDHAERWEQLDLVITEE 1133          

HSP 4 Score: 75.8702 bits (185), Expect = 3.952e-13
Identity = 125/630 (19.84%), Postives = 246/630 (39.05%), Query Frame = 2
Query:  944 IKIRGLSK-SNNVVAQRIFTGKVLGEFSIDAKSVYTNE-----GHSFFRKWA----PLIDPKSP---TSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDL--PCMNTNIISNIK--HAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPV--SNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDN-KYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEII--------RQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTA-KKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMA-DPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYK 2743
            IK + L K +  V+  R+     LGE S+   S Y +E       S   KW     P +D + P        G++KV +SV    + P     DD +E     A+L+              + + ++  E L    +N   I   +  + +   G   T+  +E +F         V       + Q+I    ++P  ++ +  ++ D        I    + ++ I   G   E G+LPT+GP+++N++   R   ++   +  +G  Q+   G  + GRL IAI      + +   +     +P+  + ++    E Y  F  +    +IN     +  P+   MSIG  G+  +++    S   P   N              +D  KYF +P+ N +P   +    E    R+ + N++ K+   L  +I        +   H+ S+   ++A   L+      I S  K +  +      A  + +LD + +++++L   +   + +  +++     V  K+      ++ +  ++A D Q  +P + I M+     + +A+I   EI  S    + G  CG    + ++     + + N      A L   +W G    +  +K
Sbjct:   20 IKNQPLEKLAAKVLTLRLVRPTALGESSVGEFSCYLSEVIHSPDRSVIAKWVALGFPGMDDEEPDDIAYENCGFLKVTLSVYRIDESPPTLIDDDGKEQIWSGAHLID-----------YTLKIRVFSVEQLIRQMINERKIKKKQRFYVMVQCGAHKTETTMESAFLDEDANIASVK------FEQEIYLPIQWPTVISEIIFSLFDKKGRGKTCIGKATLPMKMIYEPG---ETGYLPTFGPAFLNVFDCERVTRFSIFSRKMRGSQQD---GSRFVGRLFIAIDCVEYMEKANAQIMHLDHSPIMEAESICKNLEWYNCFCSMSGLNMINPQFASD--PVCIMMSIGSFGSTSNEFRSCNSSTLPAEPN--------------WDGCKYFTMPWGNLRPVAEVNAPWEVIEHRIEMSNVLMKMTNMLDTMIWEVRRIGNKAIDHVSSV--GMEALECLEQQ----IDSASKYLGRINPVSSNALDRHILDYRKEKILKL---REHFEKEAFSIDYSDGEVDAKLLRMLLKIRSMTLELAEDVQMTIPPVLIKMMSHGKLIGFAKIPISEIFQSDDEAQSGEWCGRTRAINIQ-WPTLVDQRNRKREHVAVLHAKMWFGRTDQLTKWK 600          
BLAST of Otoferlin vs. Ensembl Celegans
Match: snt-5 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700])

HSP 1 Score: 58.9214 bits (141), Expect = 2.873e-8
Identity = 30/84 (35.71%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 4709 VYIIKAINLHPSDLNGKSDPYILVK--LGDKEVRDRENYIPKT-LNPVFGKCIELEVTFPQ--ESFLLVQIYDWDRLTKDDLIG 4945
            + + KA NL P D+ G SDPY+ ++     K  + +++   +  LNPVF + +  ++   Q  E+ +L+Q+ DWDR+ KDDL+G
Sbjct:  286 INVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIPSSQIAETNILIQVMDWDRIGKDDLLG 369          
BLAST of Otoferlin vs. Ensembl Celegans
Match: snt-5 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700])

HSP 1 Score: 58.5362 bits (140), Expect = 3.068e-8
Identity = 30/84 (35.71%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 4709 VYIIKAINLHPSDLNGKSDPYILVK--LGDKEVRDRENYIPKT-LNPVFGKCIELEVTFPQ--ESFLLVQIYDWDRLTKDDLIG 4945
            + + KA NL P D+ G SDPY+ ++     K  + +++   +  LNPVF + +  ++   Q  E+ +L+Q+ DWDR+ KDDL+G
Sbjct:  251 INVSKAYNLRPMDITGASDPYVKIEQTFNGKRFKSKKSSTKRANLNPVFHETLVFDIPSSQIAETNILIQVMDWDRIGKDDLLG 334          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273291)

HSP 1 Score: 285.804 bits (730), Expect = 3.928e-82
Identity = 159/472 (33.69%), Postives = 257/472 (54.45%), Query Frame = 2
Query: 4691 VDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFI 6103
            V  +VRVY+++ + + P D+ G SD Y+ + LG K   DR ++ P   NPVFG+  E+E T P +  L V +YD D++ KD++IG+T IDLE+RW + H+ + G+   Y   GY  W D +LP+ IL  LC++  +  P Y    + +++D   F  ET+I  D+  Q    E L+L VL +  ++   G KLVPE++ETR L   + P ++QG L++W++++ A   +P+PIDITP     +E+R  V     ++  + N F  +   D++V  W +  D   Q TD+HY+S +G   FNWR V+   Y   ED +V  +K+   ++E E+K P  + +QV D  ++  D  +   +  LS    P    + C P+   +   + NLF+ K + GW+PL  N       +   +     ++L +E+ T  EA + P G G+  PM LE P RPD SF    +P  + ++ +
Sbjct:  153 VKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPY--PKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGK--MQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 610          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273287)

HSP 1 Score: 286.574 bits (732), Expect = 5.791e-78
Identity = 159/472 (33.69%), Postives = 257/472 (54.45%), Query Frame = 2
Query: 4691 VDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFI 6103
            V  +VRVY+++ + + P D+ G SD Y+ + LG K   DR ++ P   NPVFG+  E+E T P +  L V +YD D++ KD++IG+T IDLE+RW + H+ + G+   Y   GY  W D +LP+ IL  LC++  +  P Y    + +++D   F  ET+I  D+  Q    E L+L VL +  ++   G KLVPE++ETR L   + P ++QG L++W++++ A   +P+PIDITP     +E+R  V     ++  + N F  +   D++V  W +  D   Q TD+HY+S +G   FNWR V+   Y   ED +V  +K+   ++E E+K P  + +QV D  ++  D  +   +  LS    P    + C P+   +   + NLF+ K + GW+PL  N       +   +     ++L +E+ T  EA + P G G+  PM LE P RPD SF    +P  + ++ +
Sbjct:  856 VKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPY--PKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGK--MQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 1313          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273290)

HSP 1 Score: 285.804 bits (730), Expect = 1.408e-77
Identity = 159/472 (33.69%), Postives = 257/472 (54.45%), Query Frame = 2
Query: 4691 VDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFI 6103
            V  +VRVY+++ + + P D+ G SD Y+ + LG K   DR ++ P   NPVFG+  E+E T P +  L V +YD D++ KD++IG+T IDLE+RW + H+ + G+   Y   GY  W D +LP+ IL  LC++  +  P Y    + +++D   F  ET+I  D+  Q    E L+L VL +  ++   G KLVPE++ETR L   + P ++QG L++W++++ A   +P+PIDITP     +E+R  V     ++  + N F  +   D++V  W +  D   Q TD+HY+S +G   FNWR V+   Y   ED +V  +K+   ++E E+K P  + +QV D  ++  D  +   +  LS    P    + C P+   +   + NLF+ K + GW+PL  N       +   +     ++L +E+ T  EA + P G G+  PM LE P RPD SF    +P  + ++ +
Sbjct:  944 VKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPY--PKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGK--MQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 1401          

HSP 2 Score: 67.3958 bits (163), Expect = 1.533e-10
Identity = 111/594 (18.69%), Postives = 248/594 (41.75%), Query Frame = 2
Query: 1376 YVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSN-TVAGKREMYLLFGGIYETTLINEDLGKNGKP-LTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPR----MFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSG------VKSCRGT--AKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLE--DKMADPQYGLPDIFIYMIQENIRVAYARIKAREII---HSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGL-PEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLG 3097
            +++  F  + G+T VV    +P WN +I F   +P    R  I +  ++ ++ + ++   + L++I + G+       P+ GP++++LY                    +    + Y GRL++ ++       S++  D +P + +S+ TV G  E       +Y    + E L   G   LT   +  I+  L +  + V   +  TP +++  +M    F           P+++   C+F + +  D+R +     F+ +I+  ++ EL +  +       L+ + QA + LK  + N++  I++ +        V+  R T    + +  + Y   + L+L+ +K KL++  LE   +++ + + E   LV  +     MA  Q   P++ + +      V   R+ A+  +   +     ++  +C  + +   K    S    N      A +   L + + R+ + +   +  E  N E    ++ P      +++ F   VY+  A+   G +   + D   R++ ++   ++     T SPIW+  +  + +       +   +PP + +E ++ +    E+ +G
Sbjct:    4 FLKYRFHPFKGKTPVVKNTTTPVWNYEINFAWMYPSVAQRFLILIFAHEHLQWKCVAEFELCLEEIAFNGT-------PSLGPTYLHLY--------------------DPVNPMIYVGRLLMELR-------SEMLTDSQPTHTLSSKTVPGLDETRFWHDDVY----LIEFLPLMGHHILTSGTAYKISARLAEHTSNVLEGQLRTPLDRFKSAMNSKNFRR-------EAPFQS---CMFRV-RLPDNRAKYESDFFMLDIVNYMRSEL-DTFKLFQRKYPLQDDEQA-KCLKVIVNNILTRIKEGLDAHRFDHDVQPQRTTWDINRQLYLLDYFAKLPLELQNLKQKLRSCFLEHLDTSIGDVVNELQRLVAEIGSLSSMARTQDEWPELVLSLSASGKDVGVCRLNAKLFLNLRNQDADQDQETLCWRLKSFSFKSAGCSHTCPNCGCTT-AIVSGCLSIVVERERKRFLAVVNKEWANIEPMLWQLNP------EQTHFLCHVYIHQAKVRPGGEKKNICDSHLRVLFADQACETYTSPGTLSPIWNAVITFNWVSLPGGIGLYLKNPPLLSLEFYNSERSLPEDLVG 539          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273289)

HSP 1 Score: 286.574 bits (732), Expect = 1.872e-77
Identity = 159/472 (33.69%), Postives = 257/472 (54.45%), Query Frame = 2
Query: 4691 VDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFI 6103
            V  +VRVY+++ + + P D+ G SD Y+ + LG K   DR ++ P   NPVFG+  E+E T P +  L V +YD D++ KD++IG+T IDLE+RW + H+ + G+   Y   GY  W D +LP+ IL  LC++  +  P Y    + +++D   F  ET+I  D+  Q    E L+L VL +  ++   G KLVPE++ETR L   + P ++QG L++W++++ A   +P+PIDITP     +E+R  V     ++  + N F  +   D++V  W +  D   Q TD+HY+S +G   FNWR V+   Y   ED +V  +K+   ++E E+K P  + +QV D  ++  D  +   +  LS    P    + C P+   +   + NLF+ K + GW+PL  N       +   +     ++L +E+ T  EA + P G G+  PM LE P RPD SF    +P  + ++ +
Sbjct: 1152 VKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPY--PKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGK--MQLSIEVCTDVEAVNRPAGRGQDPPMALEPPYRPDSSFNPLTHPCKSFQHIL 1609          

HSP 2 Score: 108.997 bits (271), Expect = 3.610e-23
Identity = 163/829 (19.66%), Postives = 338/829 (40.77%), Query Frame = 2
Query:  749 EDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKI---RGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTS------GEKGYVKVDISVLCAGDKPKRPDADDNEENPN------------IEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNII--SNIKH--AIY-GEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSN-TVAGKREMYLLFGGIYETTLINEDLGKNGKP-LTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPR----MFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSG------VKSCRGT--AKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLE--DKMADPQYGLPDIFIYMIQENIRVAYARIKAREII---HSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGL-PEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLG 3097
            ++F I +T+ +A  +          +   K  ++T+    T +PF+NE+F F+   +  E++ L I     + ++   NVV         +GE  +D  SV+    H +F+KW  L  P              GY+++D++++            + ++  N            IE NLL                            N NI   SNI++  A Y G     ++  ++VSFAG+ G+T VV    +P WN +I F   +P    R  I +  ++ ++ + ++   + L++I + G+       P+ GP++++LY                    +    + Y GRL++ ++       S++  D +P + +S+ TV G  E       +Y    + E L   G   LT   +  I+  L +  + V   +  TP +++  +M    F           P+++   C+F + +  D+R +     F+ +I+  ++ EL +  +       L+ + QA + LK  + N++  I++ +        V+  R T    + +  + Y   + L+L+ +K KL++  LE   +++ + + E   LV  +     MA  Q   P++ + +      V   R+ A+  +   +     ++  +C  + +   K    S    N      A +   L + + R+ + +   +  E  N E    ++ P      +++ F   VY+  A+   G +   + D   R++ ++   ++     T SPIW+  +  + +       +   +PP + +E ++ +    E+ +G
Sbjct:   13 QEFLICITVHKAAQVGVTTGELYVRISLDKMTKSTKSFPNTENPFFNEYFVFEFHCTLTELLRLTILFELKKHMTYKKNVV---------VGELLVDLHSVWNQSNHGYFKKWGRLEAPIGENQTLENAVAPHGYLQLDLAIVSQHSPVSYALGSEEQDTQNLNKWTVDHDFDDIEKNLLT---------------------------NVNIFAPSNIRYFVAFYRGYFIKQSNYMIQVSFAGFNGKTPVVKNTTTPVWNYEINFAWMYPSVAQRFLILIFAHEHLQWKCVAEFELCLEEIAFNGT-------PSLGPTYLHLY--------------------DPVNPMIYVGRLLMELR-------SEMLTDSQPTHTLSSKTVPGLDETRFWHDDVY----LIEFLPLMGHHILTSGTAYKISARLAEHTSNVLEGQLRTPLDRFKSAMNSKNFRR-------EAPFQS---CMFRV-RLPDNRAKYESDFFMLDIVNYMRSEL-DTFKLFQRKYPLQDDEQA-KCLKVIVNNILTRIKEGLDAHRFDHDVQPQRTTWDINRQLYLLDYFAKLPLELQNLKQKLRSCFLEHLDTSIGDVVNELQRLVAEIGSLSSMARTQDEWPELVLSLSASGKDVGVCRLNAKLFLNLRNQDADQDQETLCWRLKSFSFKSAGCSHTCPNCGCTT-AIVSGCLSIVVERERKRFLAVVNKEWANIEPMLWQLNP------EQTHFLCHVYIHQAKVRPGGEKKNICDSHLRVLFADQACETYTSPGTLSPIWNAVITFNWVSLPGGIGLYLKNPPLLSLEFYNSERSLPEDLVG 747          
BLAST of Otoferlin vs. Ensembl Fly
Match: mfr (gene:FBgn0266757 transcript:FBtr0273285)

HSP 1 Score: 272.707 bits (696), Expect = 1.254e-74
Identity = 153/451 (33.92%), Postives = 246/451 (54.55%), Query Frame = 2
Query: 4691 VDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAP 6040
            V  +VRVY+++ + + P D+ G SD Y+ + LG K   DR ++ P   NPVFG+  E+E T P +  L V +YD D++ KD++IG+T IDLE+RW + H+ + G+   Y   GY  W D +LP+ IL  LC++  +  P Y    + +++D   F  ET+I  D+  Q    E L+L VL +  ++   G KLVPE++ETR L   + P ++QG L++W++++ A   +P+PIDITP     +E+R  V     ++  + N F  +   D++V  W +  D   Q TD+HY+S +G   FNWR V+   Y   ED +V  +K+   ++E E+K P  + +QV D  ++  D  +   +  LS    P    + C P+   +   + NLF+ K + GW+PL  N       +   +     ++L +E+ T  EA + P G G+  PM LE P
Sbjct:  609 VKLLVRVYVVQGVQMRPRDVKGDSDCYVKLFLGGKTFSDRAHFSPNHSNPVFGRLFEMEATLPGDHMLQVMVYDHDKI-KDEVIGQTNIDLEDRWRTRHRATVGLANEYTKSGYNHWHDVKLPSEILIDLCQKRGIQAPYY--YGNVIEVDGMLFGDETLISKDEELQ----ERLSLAVLKNMDKLPSFGYKLVPEHVETRSLCRDDFPNVEQGKLQLWIELFEANIYVPSPIDITPVPPADFEVRVVVKNLVGIQAGDKNIF-GKLMSDVYVIGWCEDED-KRQSTDIHYRSFAGDAAFNWRMVFGLKYSPNEDLMVIRRKAGL-LEEIEFKKPPIIYLQVWDKDVLTKDEYLAALELNLSNMYAPYPAAQLCKPY--PKKRKRINLFKRKVINGWFPLQSNAHPSQRSQAAVQNGK--MQLSIEVCTDVEAVNRPAGRGQDPPMALEPP 1045          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: otofa (otoferlin a [Source:NCBI gene;Acc:557476])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 354/1036 (34.17%), Postives = 562/1036 (54.25%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVA----------------------SEKEPTPENQYVHSM--TQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK---LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P S +  D+QISVT++EAR L G N++P+  V  G++K+ T +K  TN P+YNE+F FD  +    M + IIKI  +   N      + +G ++G F +D  +VYT   H F  KWA L DP   T+G KGYVK DI+V+  GD  K P      +  +IE NLL+P  V  + R+     V IY+AE LP MNT+I++N+K A  GE + L D YV V FAG  G+T V   +Y P WN+Q+IFTE FPP   RL++ +RD+D V D  I T FIDL+K+   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL+I+I      T+     S   V + P + +S +  GK E + LFG   E T+I+  +G   KP++FE++IG  GN +D  +K A                      S +E   ++  + S+  T        D  YFH+PY  KKPC+++ +  +D R R++  NI++K+  +L E +     +I  EK    RR L+  +  L  S  + V+     +  + +T LD +  +    ++E M  + + +  ++KR+ V +K++     ++ L     +PQ+ +PD+FI+MI  N R+AYARI +++I++S +  E G  CG +  V+L RL          + +QA+L++YLWLGL +  + + +GLP G+   +   G     +PP  + Y  + +FQLR +++ AR++  +D SGLSDPFAR+  S H   + + ++T  P WD+ L+ DN+        L+  PP +V+E++D D+    EF+GR F +P   +  + Y   +    L+++ IYRG  AAG++LAAF+L+++    +      LP +               G  D ++   L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+T L
Sbjct:  249 MEPSSGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEEKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKIIKISVIHSKN-----LLRSGTLVGTFKLDVGTVYTQPEHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKASEADEDDIEGNLLLPEGVP-SERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTSVQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDK---GFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISIAVEILDTTSAEIMSSTEVHMEPVSNISESATGKMEEFFLFGSFLEATMIDRKIGD--KPISFEVTIGNYGNQIDGVSKPALAKKKKEGGGESEEEESELIHNSSEEEAEDDGDLTSVPSTPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAYPERR-LRGVLEELSTSCSRFVTLANKDQNLSGRTKLDRERLKSCMREMESMGQQAKTIRTQVKRNTVRDKLKLVLNFLQRLRFLADEPQHSIPDVFIWMISNNKRIAYARIPSKDILYSIVDEEMGKDCGKVKAVFL-RLPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLIGLPSGFEENKAVKGIGIQAVPPISLVYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEAGELRDDPPIIVIELYDQDTVGKAEFIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCAAGDLLAAFELLQIGPAGR----AALPPID--------------GPTDSDRGPILPVPLGIRPVLSRYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGSHAVTTL 1234          

HSP 2 Score: 503.827 bits (1296), Expect = 4.031e-146
Identity = 275/641 (42.90%), Postives = 393/641 (61.31%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDD-NFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            ++ +M+Y  ELE+  +FG F D   +F+LYRGK  +DDD N  + DR  G FKG++C+Y +   +    +   +                                     + +++++   +P++ +VR+YII+A +LHP+D+NGK+DPYI++KLG  ++RD+ENYI K LNPVFGK  ++E TFP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D + P  IL  LC+E  +  P Y     RV + +R F   T IED+ G + ++ E LAL VL HW EI   G KL+PE++ETRPL  P+KPGI+QG +EMWVDM+P     P P IDI+PRK   YELR  +  T++V L + ++FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRFV+ FDYL AE+ IV ++K S++  DE EYK P  L +QV D+    +D  +G  +  L+KFP+ AK  + C  D           ++F+ K+V+GWWP +   ++++ +          VE E+ L+TAEEAE +PVGLGR +P PLE P RPD +FL FL+P   I+Y I  R KW++IKI +  + L+++ LF+Y+ PG     +V K+ G
Sbjct: 1399 VDELMVYNKELES--EFGSFEDWLHTFNLYRGKAGDDDDHNVVDEDRIVGRFKGSLCMYKLPLSEEITREAGFDP-----------------------------------NMGMFQSIPHNDPINVLVRIYIIRATDLHPADINGKADPYIVIKLGKSDIRDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSVHGYNVWRDPQKPAQILAKLCKEGKLDGPHYGP-GGRVKVANRIFLGPTEIEDESGLKKQTEEHLALTVLRHWEEIPRVGCKLIPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDVPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNKFPRGAKTAKQCSLDMVLKEHELPTISIFKQKRVKGWWPFVAQNENDEFELTGK------VEAELHLLTAEEAEKSPVGLGRNDPEPLEKPNRPDTTFLWFLSPLKAIRYLICNRYKWLIIKIVLALLLLIMVGLFLYSMPG----YLVKKLLG 1991          

HSP 3 Score: 58.5362 bits (140), Expect = 1.033e-7
Identity = 31/118 (26.27%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSAN-IYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L V+LK +      GD+  K+ FR +   S  L+   +   F Q F WPI  ++D +++L ++ +N ++V  ++L+G  ++    ++ E  + V + L+D+        ++ EI+Y
Sbjct:    1 MALVVHLKTVTELRGKGDRIAKVTFRGLSFFSRVLENCEDEARFEQAFRWPIGSQVDGDEMLEIQVFNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTTISIEIKY 118          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: otofa (otoferlin a [Source:NCBI gene;Acc:557476])

HSP 1 Score: 604.749 bits (1558), Expect = 0.000e+0
Identity = 354/1036 (34.17%), Postives = 562/1036 (54.25%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVA----------------------SEKEPTPENQYVHSM--TQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK---LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P S +  D+QISVT++EAR L G N++P+  V  G++K+ T +K  TN P+YNE+F FD  +    M + IIKI  +   N      + +G ++G F +D  +VYT   H F  KWA L DP   T+G KGYVK DI+V+  GD  K P      +  +IE NLL+P  V  + R+     V IY+AE LP MNT+I++N+K A  GE + L D YV V FAG  G+T V   +Y P WN+Q+IFTE FPP   RL++ +RD+D V D  I T FIDL+K+   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL+I+I      T+     S   V + P + +S +  GK E + LFG   E T+I+  +G   KP++FE++IG  GN +D  +K A                      S +E   ++  + S+  T        D  YFH+PY  KKPC+++ +  +D R R++  NI++K+  +L E +     +I  EK    RR L+  +  L  S  + V+     +  + +T LD +  +    ++E M  + + +  ++KR+ V +K++     ++ L     +PQ+ +PD+FI+MI  N R+AYARI +++I++S +  E G  CG +  V+L RL          + +QA+L++YLWLGL +  + + +GLP G+   +   G     +PP  + Y  + +FQLR +++ AR++  +D SGLSDPFAR+  S H   + + ++T  P WD+ L+ DN+        L+  PP +V+E++D D+    EF+GR F +P   +  + Y   +    L+++ IYRG  AAG++LAAF+L+++    +      LP +               G  D ++   L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+T L
Sbjct:  249 MEPSSGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEEKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKIIKISVIHSKN-----LLRSGTLVGTFKLDVGTVYTQPEHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKASEADEDDIEGNLLLPEGVP-SERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTSVQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDK---GFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISIAVEILDTTSAEIMSSTEVHMEPVSNISESATGKMEEFFLFGSFLEATMIDRKIGD--KPISFEVTIGNYGNQIDGVSKPALAKKKKEGGGESEEEESELIHNSSEEEAEDDGDLTSVPSTPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAYPERR-LRGVLEELSTSCSRFVTLANKDQNLSGRTKLDRERLKSCMREMESMGQQAKTIRTQVKRNTVRDKLKLVLNFLQRLRFLADEPQHSIPDVFIWMISNNKRIAYARIPSKDILYSIVDEEMGKDCGKVKAVFL-RLPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLIGLPSGFEENKAVKGIGIQAVPPISLVYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEAGELRDDPPIIVIELYDQDTVGKAEFIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCAAGDLLAAFELLQIGPAGR----AALPPID--------------GPTDSDRGPILPVPLGIRPVLSRYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGSHAVTTL 1234          

HSP 2 Score: 498.049 bits (1281), Expect = 3.949e-144
Identity = 272/641 (42.43%), Postives = 393/641 (61.31%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDD-NFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            ++ +M+Y  ELE+  +FG F D   +F+LYRGK  +DDD N  + DR  G FKG++C+Y +   +    +   +                                     + +++++   +P++ +VR+YII+A +LHP+D+NGK+DPYI++KLG  ++RD+ENYI K LNPVFGK  ++E TFP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D + P  IL  LC+E  +  P Y     RV + +R F   T IED+ G + ++ E LAL VL HW EI   G KL+PE++ETRPL  P+KPGI+QG +EMWVDM+P     P P IDI+PRK   YELR  +  T++V L + ++FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRFV+ FDYL AE+ IV ++K S++  DE EYK P  L +QV D+    +D  +G  +  L+KFP+ AK  + C  D           ++F+ K+V+GWWP +   ++++ +          VE E+ L+TAEEAE +PVGLGR +P PLE P RPD S + F+NP  +I+YFI +  +W+++K   + + LL++ LF+Y+ PG     +V K+ G
Sbjct: 1399 VDELMVYNKELES--EFGSFEDWLHTFNLYRGKAGDDDDHNVVDEDRIVGRFKGSLCMYKLPLSEEITREAGFDP-----------------------------------NMGMFQSIPHNDPINVLVRIYIIRATDLHPADINGKADPYIVIKLGKSDIRDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSVHGYNVWRDPQKPAQILAKLCKEGKLDGPHYGP-GGRVKVANRIFLGPTEIEDESGLKKQTEEHLALTVLRHWEEIPRVGCKLIPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDVPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNKFPRGAKTAKQCSLDMVLKEHELPTISIFKQKRVKGWWPFVAQNENDEFELTGK------VEAELHLLTAEEAEKSPVGLGRNDPEPLEKPNRPDTSLMWFMNPLRSIRYFIWHNYRWLILKALALLLLLLLVGLFLYSIPG----YLVKKLLG 1991          

HSP 3 Score: 58.5362 bits (140), Expect = 1.050e-7
Identity = 31/118 (26.27%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSAN-IYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L V+LK +      GD+  K+ FR +   S  L+   +   F Q F WPI  ++D +++L ++ +N ++V  ++L+G  ++    ++ E  + V + L+D+        ++ EI+Y
Sbjct:    1 MALVVHLKTVTELRGKGDRIAKVTFRGLSFFSRVLENCEDEARFEQAFRWPIGSQVDGDEMLEIQVFNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTTISIEIKY 118          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 354/1032 (34.30%), Postives = 561/1032 (54.36%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEP----TPENQYVH----------------SMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK---LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            I+P + +  DFQ+SVT++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +    M + I+K+  +   N      + +G ++G F +D  ++YT   H FF KWA L DP+  T+G KGYVK DI+V+  GD  K P   +  +  +IE+NLL+P  V    R+     + IY+AE LP MNT+I++N+K A  GE K L D YV+V FAG  G+T +   +Y P WN+QI+FTE+FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R++T   L+   Q  N+ L EGV++R RL+I++      TS     S   V V     +S+   GK E + LFG   E T+I+  +G   KP+ FE++IG  G+ LD   K  S+K+       E++ +H                S T        D  YFH+PY  +KPC+++ +  +D R R++  N+++K+  +L E +     +I  EK    RR L+  +  L  S    VS   + +  A +T LD +  +L   ++E M  + + +  ++K+SNV ++++     +  L     +PQ+ +PDI+I+MI  N R+AYAR+ +++I++SS+  E G  CG + T++ K L          + +QA+ ++YLWLGL R  + Y  GLP G+   +   G      PP  + Y  + +FQLRV+++ AR++  +D +GLSDPFARI  S H   + +  +T  P WD+ L+ D++        L+  PP +V+EI+D D+    +F+GR F +P   +  + Y   +    L+++ IYRG   AGE+LAAF+L+++    K      LP +               G  D ++   L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+T L
Sbjct:   58 IEPSAGRPMDFQVSVTVIEARQLVGLNMDPVVCVEIGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKN-----LLRSGTLVGSFKLDVGTIYTQPDHQFFHKWATLCDPEDITAGLKGYVKCDIAVVAKGDTIKTPHKANENDEDDIESNLLLPEDVP-AERQWARFYLKIYRAEGLPKMNTSIMANVKKAFIGENKDLVDPYVQVLFAGQKGKTSIQKSSYEPIWNEQIVFTEQFPPLCRRMKLQIRDSDKVNDVAIGTHFIDLRKIANDGDK---GFLPTLGPAWVNMYGSTRSYT---LMDEYQDLNEGLGEGVSFRARLLISLAVEILDTSSPEVMSSTEVQVEGIPNISDNATGKVEEFFLFGSFLEATMIDRKIGD--KPINFEVTIGNYGSELDTPTKPKSKKKKGDGDDEESELIHGSSDEEVDDGGDVTSVSTTPPMKPVITDRNYFHLPYFERKPCIYIYSWWQDQRRRLYNANVLDKMADKLEEGLNDVQEIIKTEKAYPERR-LRGVLEELSNSCSTFVSLANNDQNQAGRTKLDKERVKLCMQEVESMGQQAKTMRSQVKKSNVKDRIKLAQNFLHKLRFLSDEPQHSVPDIYIWMISNNKRIAYARVPSKDILYSSVEEECGKDCGKVQTIFFK-LPGKKSFGPAGWTVQAKTELYLWLGLNRQRKDYLCGLPNGFEENKAVKGPGVQSSPPISLMYTMKQIFQLRVHMYQARSLFAADSTGLSDPFARIFFSTHSQVTEVLNETLCPTWDQLLVFDHVELYGEAGELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQIYRGNCTAGEMLAAFELLQIGPGGK----ADLPPID--------------GPTDIDRGPILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTTL 1039          

HSP 2 Score: 477.248 bits (1227), Expect = 3.682e-138
Identity = 263/643 (40.90%), Postives = 388/643 (60.34%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEED---DDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLS--EACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            IE   +Y  ELE   ++  F D   +F+L+RGK  +D   D N  + DR  G FKG++CIY +  +D       +                                      + +++N+   +P++ +VR+Y+++A +LHP+D+NGK+DPYI +KLG  E++D+ENYI K LNPVFGK  ++E T P +S L V IYDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC++  +  P Y     RV + +R +   T +ED++G + ++ E LAL VL+HW +I   G KLVPE++ETRPL  P+KPGI+QG +EMWVDM+P   + P P +DI+PRK   +ELR  V  T++V L + + FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRF+Y FDYL+AE+ IV ++K S++  DE EYK P  LN+QV D+    +D  +G  +  L++FP+ AK  + C    ++        N+F+ K+++GWWP +   ++++ +          VE E++L+T EEAE +PVG GR EP PLE P RPD +FL F+ P   I++ +  + KW++IKI V  + L ++ LF+Y+ PG     +V K+ G
Sbjct: 1179 IEEFKVYNRELE--YEYNQFEDWLHTFNLHRGKCSDDADVDQNAADEDRLIGKFKGSLCIYKVSSDDMSRDMGFDS------------------------------------NMGMFQNIPHNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKSEIKDKENYISKQLNPVFGKSFDVEATLPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGISSTYAIHGYNVWRDPLKPSHILAKLCKDGKIDAPQYGP-GGRVKVTNRVYTGPTEVEDENGLKKQTDEHLALAVLNHWEDIPRIGCKLVPEHMETRPLLNPDKPGIEQGRIEMWVDMFPKDMSAPGPALDISPRKPKKFELRVIVWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLQAEEKIVISKKESMFSWDETEYKIPARLNLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIEMVTNENEMPMVNIFKQKRIKGWWPFVARDENDELEITGK------VEAELQLLTGEEAEKSPVGEGRNEPEPLEKPNRPDTAFLWFMMPLKAIRHLVCNQYKWLVIKIVVALLLLAMLGLFLYSMPG----YMVKKLLG 1772          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: fer1l6 (fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-312])

HSP 1 Score: 500.36 bits (1287), Expect = 8.196e-146
Identity = 329/1051 (31.30%), Postives = 517/1051 (49.19%), Query Frame = 2
Query:  743 KIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGD-KPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK---------------TSYQP-----------------DSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKE-----------PTPENQYVHSMTQSRFAYTYDNK--YFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHL--------ISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSN--VYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGK----MPPKYIDYLDES-MFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLV 3712
            K ++FQIS+ I E R L G+NI+P   +  G  K+ T +K  TN+PFYNE+F FD+  ++    + +IK+       +V+  +I     +G F ID  +VY+  GH F  KWA L DP     G KGY+K DISV   GD  P      D EE   I+ +LL+P  + N  R      V++Y+AE LP +N++I++N+  A  G+  AL D YVEVSF G  GRT     +  P WN+Q++F E FPP   RL+I V D   + D  I T +IDL  I    +  + GFLPT+GP+WINLYG+ R  T   L+   Q  N+ + EGV+YRGRL I +                + + P                  S  IG +V P  P         E +LLFG ++E ++I+  +G   +P+T E +IG  GNL+D  A   S+K+            T       S T        D +  Y H+P   +KPC+++ +  ED   R+   N+++ +     E + + + L         SL  +V   R  +      I   EK V G       +  T+LD K   + + +LE M  ++    LE KR +  V E + E   + K L   + +PQ+ LPD+F+ ++  N RVAYARI AR+++ S    ++G  CG + T++LK      +K    + +QA+L ++LWLG   +       LP G+     S +     PP+Y+ Y  ++ MF+LR +++ AR +I +D++GLSDPFA +    H   + I  QT +P W++ + + N+        +   PP +V+E++D D     E+LG     P V +  +QY+  +LQ+  ++ G+L+ G+IL AF+L++    +       LP +                E D   + +P +IRP L  +R E+L WG+R+L++++++                 V++P++ I  AG  + S  I  +   PNF   +   D+ LP      PP+ +   +   FG   +VG+  I NL 
Sbjct:  102 KPQNFQISINITEIRQLVGDNIDPSVVIEIGDDKKQTSVKEGTNAPFYNEYFVFDIYCNQDIFFDKVIKL-------SVMHSKIMKSYCVGTFKIDVGTVYSQPGHQFINKWATLTDPADIRVGVKGYLKCDISVSGKGDVAPPSQKFSDAEEQ--IDKHLLLPEGL-NPERPWARFYVIVYRAEGLPRINSSIMANVTKAFVGDTTALIDPYVEVSFFGQVGRTSTQKSSADPVWNEQVVFKEMFPPLCQRLKIRVLDEGSMNDVAIGTHYIDLHTIS-NDTDGDNGFLPTFGPAWINLYGSLRNST---LVDDSQELNEGVGEGVSYRGRLYIELSVEILSGGAAESKSLLSKFSPKDAKGGKTGTGAGGEEEKSKMIGPEVIPVEPPQKMRDEDMETFLLFGCVFEASMIDRKIGD--RPVTLEFTIGNFGNLIDGAAPPPSKKKLEDVSVTAPLLDTTATMPCKSTTTPERPIFGDAQRHYMHLPIAAQKPCVYVYSSWEDRAYRLHHANMLDTIALMFEEGVAKVTELDKMLSPEAWSLMHHV--LREFRRDAKEFIAFAEKKVKG-------SNLTLLDKKRLTMCKQELESM-TEMAGGLLEPKRRSLTVKEMLLEAQKIKKKLRFLVEEPQHTLPDVFVCLVSNNKRVAYARIPARDLLFSESPEQRGRDCGKIKTLFLK----PPVKRAPGWTVQAKLDVFLWLGTCAESSRMLDNLPSGFELVSTSFEDRTGAPPEYLLYTGKTHMFELRAHMYQARGLIAADNTGLSDPFAWVSFLSHSQCTGIIKQTLTPTWNQVIKMTNMSLYGGLYDIAQEPPLIVIEVYD-DDAVGSEYLGSTVAVPVVKLSEEQYSPPQLQYSPLFCGSLSGGDILGAFELIQSGEHS-------LPVLD---------------EPDGVVIPVPSYIRPVLCKYRIEVLFWGLRELKKVQLLS----------------VDRPQVFIKCAGSGVNSSVIQSYKKNPNFTIIVDAFDVELPEDEHLLPPLTLTVVDWRAFGRSTLVGSHVINNLA 1083          

HSP 2 Score: 451.055 bits (1159), Expect = 2.753e-129
Identity = 267/669 (39.91%), Postives = 372/669 (55.61%), Query Frame = 2
Query: 4232 NPFQPSTKELFLKEEPDNLRMESEYVTDNSWIER-----IMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGK-KLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            NPF        L E    +R   + V   S IE+     + +Y  ELE   +FG F D  K+F L+RGK  E+D +    +RF G FKG  C+Y +   D E  +   +                                      ++ + +     V+ ++RVYI+ A NLHP+D +GK+DPYI++KLG  E++DR+NYIPK LNPVFG+  E + TFP+ES L + IYD+D +  DDLIGET IDLENR+ S H+ +C +   Y   GY  W+D   P  +L  LC+E+ +  P +     R+ I ++ F  +T+  D+D   ++S E LAL+VLH W E+  G  KLVPE+IETR LY+ +KPGI QG L+MWVD++P     P  P+DI+PRK  GYELR  +  TE V L + NF T +++ DI+VK W+K  + D Q+TDVHY SL+G+G FNWRFV+ F YL AE  +V  ++ S+Y +D+ E K P  L MQV D   + SD  +G  +  L  FP+ AK  ++C    L+E     ++F+ K+ +GWWP I   +               VE E  LVTAEEAE NPVG  R EP PLE P RPD SF  F+NP+    + I    K  +I   V+ +  L + L  Y  PG++S  IV
Sbjct: 1178 NPFP------LLFENTSGMRDRKKEVNYKSVIEQPRLATLQVYDKELE--AEFGPFDDWVKTFELFRGKANEEDGSAY--ERFVGKFKGRFCLYKLPEADGEAEEGYVDSGQ----------------------------------FKINQGIPPNTAVNVLIRVYIVAAFNLHPADPDGKADPYIVLKLGKTEIKDRDNYIPKQLNPVFGRSFEFQATFPKESLLTILIYDYDLVGGDDLIGETQIDLENRFYSRHRATCSLPTEYAIEGYNAWRDCMKPVDLLIKLCKENRLDNPQFS--PGRITIGNKVFMGKTVFPDED-QMVESYEHLALKVLHRWSEMPNGGCKLVPEHIETRALYLKDKPGIDQGHLQMWVDIFPLDMPHPGPPVDISPRKPKGYELRIIIWNTEDVILEDTNFITGQQSSDIYVKGWLKGLEDDGQETDVHYNSLTGEGNFNWRFVFPFSYLPAEKVVVVQKRESIYSLDKTEQKMPAVLVMQVWDFERLSSDDFLGSVELDLHGFPRGAKSAKACKMEMLTELTENISIFQQKRSKGWWPFIKAGELTGK-----------VEAEFHLVTAEEAEKNPVGRARKEPEPLEKPNRPDTSFSWFMNPFKCFFHLIWGNYKKYIIAGLVLLILTLFLVLLFYTLPGALSTKIV 1788          
BLAST of Otoferlin vs. Ensembl Zebrafish
Match: fer1l4 (fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GENE-130530-815])

HSP 1 Score: 497.278 bits (1279), Expect = 8.376e-144
Identity = 348/1183 (29.42%), Postives = 568/1183 (48.01%), Query Frame = 2
Query:  758 QISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPD-ADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLM--IAIKTSYQP------------------------------------------------DSSKIGVDV--------RPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAK---------VASEKEP-----------TPENQYVHSMTQSRFAY--TYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYN---RECFSGK-----MPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTI 4039
            Q++V ++EA+ L G NINP   V  G +K++T  +  TN PFYNE F F+   ++  + + +I+I  + K   V+A   F    +G F ID  +VY    H F++KWAPL DPK   SG KGYVK  +SV+  GD       A    +N +IE NLL+P  + +  R   +  + IY+AE LP MN+  +  I      + K   D YV+V+FAG  G T V +   +P+WN+QI F E+FPP   R++I + D+  + D  ++T F+DL +I    +    GF PT+GP+W+NLYG+P+  T   +    +  N+ L++G+ YRGR++  ++++  + P                                                +S  +G +V           +P+     G+++ +LLF   +E T+I+  +G   KP+TFE+SIG  G   +   K         +A +++P            P N    S+T  R      YD  +  IP   +KPC+F+ +  EDH  R    N + K+   L   I +   L+   K ++A+  L   ++    S ++  S ++  R   ++  LD     LI+ ++  +  +   +   + R+ V +++ +   + K L     +PQ  LPD+F++M+    RVAYARI A  ++ S +  EKG  CG +  VY+K     + +      I A+L++Y+WLG+ +  +     LP  +     +  SG      MPP  +   D   FQLR +++ AR +I +DD+GLSDPFA+++ S     + +  +T SP W E L  D ++   + D  +  PP V++ I+D++     + LGR F +P++    + Y   +LQ++ I +G   AGEILAA +L+E+D  +       LP   D KK        +Y E +E    IPE +RP L  +R E+L WG+R L+R+                 +F V +P++ ++ AG  IES++I  + + PNF D +   D+ LP      PP+ I       FG   +VG   + NLV +   DQ +   E ++    +   KS  L    N   G L           IN L           VT+P+   ++K + +  +  E E  DWW++YYA++ +L    I
Sbjct:  224 QVNVNVIEAQKLVGVNINPAVYVTVGDEKKHTATQKSTNCPFYNENFMFEFQETQDVLFDKVIEISVVHK--KVLA---FLMTHIGSFKIDISTVYQQPDHRFYQKWAPLTDPKDTRSGIKGYVKCTVSVVMKGDPMGMASLAPAGSQNDDIEKNLLLPKRMPSE-RPWAKFILKIYRAEGLPSMNSGFMGKIMR----DKKVFLDPYVQVTFAGQQGETSVDSNTNAPEWNEQISFIEQFPPLARRIKIQILDDANIGDVAVATHFLDLLQI---SNPNRNGFNPTFGPAWVNLYGSPQNSTLRDI---HRDLNEGLSDGIFYRGRILLSLSVEVYFSPTAVVTESKAIANVKSTISRLNLKRRSRKSKEKKTGRKEGMQSPSGPAEESEDVGAEVPAAVTVEVEEVHPLPENFTGEKDEFLLFASFFEVTMIDPSIG--SKPVTFELSIGNYGKTAEVVVKSSKSGSQENLAEDRQPLLESDDELERDEPVNPRDQSITAPRRPQPTEYDRSFSCIPLFREKPCIFVWSYFEDHTFRFHNSNWLSKMADRLEYGIDEVEMLLKRSK-IKAKERLVDVVLEFFSSCKQYSSNLERKR-NPRQNNLDKCRVGLIKRNIVLLAKQTLRVRKRVTRNTVKDRLADLRNITKRLRFLAIEPQSTLPDVFLWMLSGGRRVAYARIPAPSVLFSLVEEEKGKDCGKITAVYMKTPGGPVGE------IFAKLEVYMWLGITKYAKNCVTSLPAEFRPIYEDATSGASIPRNMPPTKLAVEDSRYFQLRAHIYQARGIIAADDNGLSDPFAKVVFSTQCQVTRVMEETLSPTWCELLFYDQVLMEGSKDEYREDPPVVIINIYDYNKLGSPQALGRAFARPELKFVEEPYKKPQLQFFEITKGKSKAGEILAALELIELDYSS--FGEPALPVDVDPKK-------PQYME-EECYYIIPEGVRPVLRKYRIEVLYWGLRGLKRV----------------NLFEVERPQVRMECAGQMIESEEIQSYKLNPNFSDVVKHFDVELPELVYLHPPLTIFVMEQRAFGRLVLVGTHVVQNLVQFGPRDQEEWKDEEEEPEEKKPPKKSTPLTTVINMDLGGLP---LKHTKIPINPLN---------LVTSPIKKVIKKEEELEEEPPEKEELDWWSKYYASLAELEKQHI 1342          

HSP 2 Score: 358.992 bits (920), Expect = 1.998e-99
Identity = 214/560 (38.21%), Postives = 316/560 (56.43%), Query Frame = 2
Query: 4688 PVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYD----KLTDRVDIDDRSFFAETMIE-----DDDGSQIKSLEPLALEVLHHWHEIVP----GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCD-PFQLSEACAKFNLFRNKKVRGWWPLI----------------------------------YNPKXXXXXXXXXXXXXXCVELEME--LVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            P+  +VRVY++KA NL P+D NGK+DPY++VK+G +++  +E YIPK LNPVFG+  EL V+FP E+ L + ++D D +  DDLIG+T +DLENR+ S H+  CG+   Y   GY KW+D + PT IL  LC ++ +P P Y     K+ +++       F E +++     ++D +++   E  AL VLH W E+         LVPE++E R L   EKPG+ QG + MW+DM+P     P P++I PR    YELR  +  T+ V L +VN FT E + DI+VK W+K  + + Q+TDVH+ SL+G+G FNWRFV++FDYL  E  ++Y +K S++ ++E E++ P  L +QV D   I S+  +G  + RLS   +  K    C       +A  +F++FR+K+++GWWPLI                                    P+D    +  G       ++E E  LVT EEAE NPVG  R EP PL+ P RP  SF  F+NP  T  +FI  + K  +I + ++ +  L + L +Y  P  IS  IV
Sbjct: 1432 PIKVLVRVYVVKATNLAPTDPNGKADPYVVVKVGQQQMDSKERYIPKQLNPVFGEVFELTVSFPLETELTLYVFDHDLVGSDDLIGKTRVDLENRFFSRHRAGCGLALHYDKDGYNKWRDAKKPTAILLELCRKNGIPSPEYRESEIKVLNKIFRVPNEAFPEELLKKNKKTEEDYAELD--EHKALSVLHRWKEMREFCEGACPLVPEHVEVRSLLNAEKPGLPQGYVHMWIDMFPVDVPPPPPVNIKPRLPESYELRVIIWNTDDVVLDDVNPFTGEPSSDIYVKGWIKGLEDEKQETDVHFNSLTGEGNFNWRFVFHFDYLPTEKEVIYKKKESLFALEETEFRQPAVLVLQVWDYDRIGSNDFLGSIELRLSDMVRAVKTSEQCSVKMAKDKAGPRFSIFRSKRMKGWWPLIKLKSQEDIEREEREAEQEKKNKKKKKKKSSKRSQMKPEDLQFVDNSGNTFLLMGKVEAEFHLVTPEEAEKNPVGKARKEPEPLDKPNRPKTSFNWFVNPMKTFVFFIWKKYKKYIIALIILVILGLFLGLILYTMPSHISQLIV 1989          

HSP 3 Score: 65.0846 bits (157), Expect = 1.249e-9
Identity = 37/134 (27.61%), Postives = 75/134 (55.97%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNF 538
            MS++V LK +       D+ ++L FR    K+  L+      F + F WP   K++++++L +  +N +++  ++LLG L I+  ++++   + +RE L D +  +TD+ +  E++Y SP  G+   G D+ +F
Sbjct:    1 MSITVLLKKIFNLPGKYDRKVELSFRGFTHKTKILQCENIAIFNEHFRWPHYGKVERDEVLSISVFNCSKMFSNRLLGKLVISLQHVVSVGQLILREPLTDAQHSLTDMYIELEVKY-SPLQGAAG-GWDSQDF 132          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: ube2v2 (ubiquitin conjugating enzyme E2 V2 [Source:Xenbase;Acc:XB-GENE-1015103])

HSP 1 Score: 580.482 bits (1495), Expect = 1.183e-172
Identity = 339/1031 (32.88%), Postives = 557/1031 (54.03%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKT----SYQPD-SSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVA--------------------SEKEPTPENQYVHSMTQSRF--AYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G +K+ T +K  TN P+YNE       +S       + + R +  S       + +G ++G F +D  +VYT   H F+ KWA L DP   T+G KGY+K DI+V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT+I++N+K A+ GE K L D YV+V+FAG  G+T V   +Y P WN+QIIFTE FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT+GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL++++      +  P+ +S   V +    PV+ T  GK E + LFG   E+T+I+  +G   KP+ FE++IG  GN +D  +K +                    S  +   E+  + S++ S        D  YFH+P+ +KKPC ++ +  +D R R++  NI++K+  +L E +     +I  EK    RR L+  +  L  S  + V+     +    +T LD +  +    +LE M  + + +  ++K++ V +K++     ++ L     +PQ+ +PDIFI+M+  N R+AYARI +++I++S +  E G  CG +  V+LK L          + +QA++++Y+WLGL +  R +  GLP G+   +   G      PP  + Y  + +FQLR +++ AR++  +D SGLSDPFAR+  +     + +  +T  P WD+ L+ DNI        ++  PP +V+EI+D D+    +F+GR F +P V +  ++Y   +    L+++ IYRG   AG++L AF+L+++    K      LP ++          D   G +    L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:  221 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDEKKYTSMKESTNCPYYNE-------VSATVPTSPVPRDRAVKVSVIHSKNLLRSGTLVGSFKLDVGTVYTQPEHQFYHKWALLSDPDDITAGLKGYLKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPDGVP-AERQWARFYVKIYRAEGLPRMNTSIMANVKKALIGENKDLVDPYVQVAFAGQKGKTSVQKSSYEPMWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANEGDK---GFLPTFGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLLSLAVEILDTTNPELTSSTEVQIEGAQPVAETCTGKMEEFFLFGAFLESTMIDRKIGD--KPINFEVTIGNYGNQIDGISKPSMRKRKEGGDGVEEETELLQNSSDDEADEDGEMLSISSSPAMKPLITDRNYFHLPFFDKKPCTYIKSWWQDQRRRLYNANIMDKIADKLEEGLNDVHEMIKTEKPYPERR-LRGVLEELSSSCFRFVTLANKDQNQNGQTKLDRERLKSCMRELENMGTQAKTMRSQVKKNTVKDKLKLVQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRIAYARIPSKDILYSIVDEETGKDCGKVKCVFLK-LPGKRGFGPAGWTVQAKMEVYMWLGLSKQRRDFLCGLPCGFEEIKAVKGPGLQSFPPISLSYTKKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFNTQSQCTEVLNETLCPTWDQLLVFDNIELYGEAHEMRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMSDERYCPPRFPPQLEYYQIYRGNSTAGDLLGAFELLQIGPAGK----SDLPQIEG-------PTDIERGPI----LPVPLGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 1202          

HSP 2 Score: 479.174 bits (1232), Expect = 5.938e-138
Identity = 261/631 (41.36%), Postives = 386/631 (61.17%), Query Frame = 2
Query: 4340 MYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKF---NLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            +Y  ELE   ++  F D   +F+L RGK  +DDD     +R  G FKG++C+Y +   +    +   +                                       +++ + + +P++ +VRVY+++A +LHP+D+NGK+DPY+++KLG  +++D+ENYI K LNPVFGK  ++E TFP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   PT IL  LC+E  +  P Y     RV + +R F   T I+D++G + ++ E LAL VL HW +I   G KLVPE++ETRPL  P+KPGI+QG +EMWVDM+P     P P IDI+PRK   YELR  +  T++V L + ++FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRF++ FDYL AE+ IV ++K S++  DE EYK P  L +QV D+    +D  +G  +  L++FP+ AK  + C   +++E        ++F+ K+V+GWWP +   ++++ +          VE E+ L++AEEAE  P GLGR EP PLE P RPD SF+ FLNP  +I+YFI +  +W+++KI ++ + LL++ LF+Y+ PG +   I+
Sbjct: 1333 VYNKELET--EYDNFEDWLHTFNLLRGKIGDDDDTVSEEERIVGRFKGSMCVYKVPLPEDVTKEAGYDP-----------------------------------NFGMFQGIPNNDPMNVLVRVYVVRATDLHPADINGKADPYVVIKLGKTDIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGISKTYAIHGYNLWRDPVKPTQILSKLCKEGKIDGPHYGP-GGRVKVTNRVFTGPTEIDDENGQKKQTDEHLALSVLQHWEDIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDMPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFLFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCS-IEMAEPDVDLPMVSIFKQKRVKGWWPFVARNENDEMELTGK------VEAELHLLSAEEAEKTPAGLGRNEPDPLEKPNRPDTSFIWFLNPLKSIRYFIWHTYRWLILKILILILLLLMVGLFLYSLPGYLVKKIL 1918          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: ube2v2 (ubiquitin conjugating enzyme E2 V2 [Source:Xenbase;Acc:XB-GENE-1015103])

HSP 1 Score: 541.576 bits (1394), Expect = 2.429e-161
Identity = 332/1031 (32.20%), Postives = 539/1031 (52.28%), Query Frame = 2
Query:  758 QISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKT----SYQPD-SSKIGVDVRPCNPVSN-----------TVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVA--------------------SEKEPTPENQYVHSMTQSRF--AYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            Q+S+T++EAR L G N++P+  V  G +K+ T +K  TN P+YNE       +S       +I  + L +S          G ++G F +D  +VYT   H F+ KWA L DP   T+G KGY+K DI+V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT+I++N+K A+ GE K L D YV+V+FAG  G+T V   +Y P WN+QIIFTE FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT+GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL++++      +  P+ +S   V +    PV+            T  GK E + LFG   E+T+I+  +G   KP+ FE++IG  GN +D  +K +                    S  +   E+  + S++ S        D  YFH+P+ +KKPC ++ +  +D R R++  NI++K+  +L     Q    +           L     N+      V+ G+    G    T  D   Q+      E M  + + +  ++K++ V +K++     ++ L     +PQ+ +PDIFI+M+  N R+AYARI +++I++S +  E G  CG +  V+LK L          + +QA++++Y+WLGL +  R +  GLP G+   +   G      PP  + Y  + +FQLR +++ AR++  +D SGLSDPFAR+  +     + +  +T  P WD+ L+ DNI        ++  PP +V+EI+D D+    +F+GR F +P V +  ++Y   +    L+++ IYRG   AG++L AF+L+++     K  +  +    DI++          G +    L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:   39 QVSITVIEARQLVGLNMDPVVCVEVGDEKKYTSMKESTNCPYYNE-------VSATVPTSPVIHSKNLLRS----------GTLVGSFKLDVGTVYTQPEHQFYHKWALLSDPDDITAGLKGYLKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPDGVP-AERQWARFYVKIYRAEGLPRMNTSIMANVKKALIGENKDLVDPYVQVAFAGQKGKTSVQKSSYEPMWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANEGDK---GFLPTFGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLLSLAVEILDTTNPELTSSTEVQIEGAQPVAEVRTTLSYHLHLTCTGKMEEFFLFGAFLESTMIDRKIGD--KPINFEVTIGNYGNQIDGISKPSMRKRKEGGDGVEEETELLQNSSDDEADEDGEMLSISSSPAMKPLITDRNYFHLPFFDKKPCTYIKSWWQDQRRRLYNANIMDKIADKLVNETGQGEAEV-----------LHEGAGNVF-----VLEGLGRLTGDG-LTNHDCFAQQ------ENMGTQAKTMRSQVKKNTVKDKLKLVQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRIAYARIPSKDILYSIVDEETGKDCGKVKCVFLK-LPGKRGFGPAGWTVQAKMEVYMWLGLSKQRRDFLCGLPCGFEEIKAVKGPGLQSFPPISLSYTKKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFNTQSQCTEVLNETLCPTWDQLLVFDNIELYGEAHEMRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMSDERYCPPRFPPQLEYYQIYRGNSTAGDLLGAFELLQVIGPAGKSDLPQIEGPTDIER----------GPI----LPVPLGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 989          

HSP 2 Score: 452.981 bits (1164), Expect = 9.983e-131
Identity = 250/639 (39.12%), Postives = 370/639 (57.90%), Query Frame = 2
Query: 4316 NSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKF---NLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
              W    ++Y  ELE   ++  F D   +F+L RGK  +DDD     +R  G FKG++C+Y +   +    +   +                                       +++ + + +P++ +VRVY+++A +LHP+D+NGK+DPY+++KLG  +++D+ENYI K LNPVFGK  ++E TFP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   PT IL  LC+E  +  P Y     RV + +R F          G + ++ E LAL VL HW +I   G KLVPE++ETRPL  P+KPGI+QG +EMWVDM+P     P P IDI+PRK   YELR  +  T++V L + ++FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRF++ FDYL AE+ IV ++K S++  DE EYK P  L +QV D+    +D  +G  +  L++FP+ AK  + C   +++E        ++F+ K+V+GWWP +   ++++ +          VE E+ L++AEEAE  P GLGR EP PLE P RP+ S    L+P   +   +  + +W ++ I      L+ +AL +Y  PG+IS  ++
Sbjct: 1002 QQWTTAGIVYNKELET--EYDNFEDWLHTFNLLRGKIGDDDDTVSEEERIVGRFKGSMCVYKVPLPEDVTKEAGYDP-----------------------------------NFGMFQGIPNNDPMNVLVRVYVVRATDLHPADINGKADPYVVIKLGKTDIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGISKTYAIHGYNLWRDPVKPTQILSKLCKEGKIDGPHYGP-GGRVKVTNRVF---------TGQKKQTDEHLALSVLQHWEDIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDMPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFLFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCS-IEMAEPDVDLPMVSIFKQKRVKGWWPFVARNENDEMELTGK------VEAELHLLSAEEAEKTPAGLGRNEPDPLEKPNRPNPSLAWMLSPLRVVCVLLWRQYRWHVLGIIGSCAVLMFVALVLYTLPGAISERLI 1586          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: ube2v2 (ubiquitin conjugating enzyme E2 V2 [Source:Xenbase;Acc:XB-GENE-1015103])

HSP 1 Score: 538.495 bits (1386), Expect = 3.586e-160
Identity = 330/1016 (32.48%), Postives = 537/1016 (52.85%), Query Frame = 2
Query:  779 EARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKT----SYQPD-SSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVA--------------------SEKEPTPENQYVHSMTQSRF--AYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELS--EIIRQTSHLISLEKNVQAR-RYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            +AR L G N++P+  V  G +K+ T +K  TN P+YNE       +S       +I  + L +S          G ++G F +D  +VYT   H F+ KWA L DP   T+G KGY+K DI+V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT+I++N+K A+ GE K L D YV+V+FAG  G+T V   +Y P WN+QIIFTE FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT+GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL++++      +  P+ +S   V +    PV+ T  GK E + LFG   E+T+I+  +G   KP+ FE++IG  GN +D  +K +                    S  +   E+  + S++ S        D  YFH+P+ +KKPC ++ +  +D R R++  NI++K+  +LS   + +Q       ++  Q     L     N+      V+ G+    G    T  D   Q+      E M  + + +  ++K++ V +K++     ++ L     +PQ+ +PDIFI+M+  N R+AYARI +++I++S +  E G  CG +  V+LK L          + +QA++++Y+WLGL +  R +  GLP G+   +   G      PP  + Y  + +FQLR +++ AR++  +D SGLSDPFAR+  +     + +  +T  P WD+ L+ DNI        ++  PP +V+EI+D D+    +F+GR F +P V +  ++Y   +    L+++ IYRG   AG++L AF+L+++     K  +  +    DI++          G +    L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:    4 KARQLVGLNMDPVVCVEVGDEKKYTSMKESTNCPYYNE-------VSATVPTSPVIHSKNLLRS----------GTLVGSFKLDVGTVYTQPEHQFYHKWALLSDPDDITAGLKGYLKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPDGVP-AERQWARFYVKIYRAEGLPRMNTSIMANVKKALIGENKDLVDPYVQVAFAGQKGKTSVQKSSYEPMWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANEGDK---GFLPTFGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLLSLAVEILDTTNPELTSSTEVQIEGAQPVAETCTGKMEEFFLFGAFLESTMIDRKIGD--KPINFEVTIGNYGNQIDGISKPSMRKRKEGGDGVEEETELLQNSSDDEADEDGEMLSISSSPAMKPLITDRNYFHLPFFDKKPCTYIKSWWQDQRRRLYNANIMDKIADKLSICYLGQQGPEPEWADETGQGEAEVLHEGAGNVF-----VLEGLGRLTGDG-LTNHDCFAQQ------ENMGTQAKTMRSQVKKNTVKDKLKLVQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRIAYARIPSKDILYSIVDEETGKDCGKVKCVFLK-LPGKRGFGPAGWTVQAKMEVYMWLGLSKQRRDFLCGLPCGFEEIKAVKGPGLQSFPPISLSYTKKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFNTQSQCTEVLNETLCPTWDQLLVFDNIELYGEAHEMRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMSDERYCPPRFPPQLEYYQIYRGNSTAGDLLGAFELLQVIGPAGKSDLPQIEGPTDIER----------GPI----LPVPLGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 950          

HSP 2 Score: 442.195 bits (1136), Expect = 3.956e-127
Identity = 245/631 (38.83%), Postives = 362/631 (57.37%), Query Frame = 2
Query: 4340 MYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKF---NLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            +Y  ELE   ++  F D   +F+L RGK  +DDD     +R  G FKG++C+Y +   +    +   +                                       +++ + + +P++ +VRVY+++A +LHP+D+NGK+DPY+++KLG  +++D+ENYI K LNPVFGK  ++E TFP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   PT IL  LC+E  +  P Y                        G + ++ E LAL VL HW +I   G KLVPE++ETRPL  P+KPGI+QG +EMWVDM+P     P P IDI+PRK   YELR  +  T++V L + ++FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRF++ FDYL AE+ IV ++K S++  DE EYK P  L +QV D+    +D  +G  +  L++FP+ AK  + C   +++E        ++F+ K+V+GWWP +   ++++ +          VE E+ L++AEEAE  P GLGR EP PLE P RP+ S    L+P   +   +  + +W ++ I      L+ +AL +Y  PG+IS  ++
Sbjct: 1028 VYNKELET--EYDNFEDWLHTFNLLRGKIGDDDDTVSEEERIVGRFKGSMCVYKVPLPEDVTKEAGYDP-----------------------------------NFGMFQGIPNNDPMNVLVRVYVVRATDLHPADINGKADPYVVIKLGKTDIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGISKTYAIHGYNLWRDPVKPTQILSKLCKEGKIDGPHYGP----------------------GQKKQTDEHLALSVLQHWEDIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDMPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFLFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCS-IEMAEPDVDLPMVSIFKQKRVKGWWPFVARNENDEMELTGK------VEAELHLLSAEEAEKTPAGLGRNEPDPLEKPNRPNPSLAWMLSPLRVVCVLLWRQYRWHVLGIIGSCAVLMFVALVLYTLPGAISERLI 1592          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: FER1L6 (fer-1-like family member 6 [Source:NCBI gene;Acc:100497075])

HSP 1 Score: 541.191 bits (1393), Expect = 5.136e-160
Identity = 353/1189 (29.69%), Postives = 578/1189 (48.61%), Query Frame = 2
Query:  755 FQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAI-------------------------------KTSYQPDSSKIGVDVRPCNPVSNTVA----------------GKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQ----------------------YVHSMTQSRFAYTYDNKYFH-IPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFS------GKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVK--DIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTA-----PVP------------GTVEKVKPVLPQTEEMESA----DWWTRYYATIGDL 4024
             QI++TI EAR L G NI+P+  +  G  K+ T +K  TN+PFYNE+F FD    + ++ + II++       +V+  ++    ++G F +D  +VY   GH F  KWA L DP    +G KGY+K DISV   GD  +      + E   IE NLLIP    +  R      V IY+AE LP MN++I++N+  A  G+ K L D YV V FAG  GRT        P W++QI+F E FPP   R++I V D   + D  ++T FIDL+KI       ++GFLPT+GP+WINLYG+PR    T L++  Q  N+   EGV++RGR++I I                               K S +    K   D +P + V  T +                 K E +LLFG I+E TLI+  +G  G  ++FE S+G  GN+LD  +   ++K+ +PE++                      ++   T  +   T  N+ +H +P+  +KPC+++ +   D   R++  N+++K+   L + + Q   L+ +  ++     ++  +   I      +S  +        T LD K   L R +LE M    + +  + K+ ++ +  RE  +L+  ++  + +PQ+ +PD+FI+++  N RVAYARI AR+I++S++A E+G  CG + T++ K       K    +N+QA++ +YLWLG  +        LP GY  E  S      G  PP  + Y  + MFQLR +++ AR +I +D SGLSDPFA++    H   + I +QT SP W++ L+ +N++       +   PPN+V+E++D D+ +  E++G     P V +    Y+ AKL +  ++ G L+ GE+LAAF+L+++     +  V+ LP ++  D  ++                  +P  IRP LS +R E+L WGVR+L++++++                 V++P++ I+ AG  ++S  I  +   PNF     + ++ LP +    PP++I   +   FG   +VG   I  L  +      +    I           S +         G  +  + + D S   ++   +   P P  TA     P P            G++ +      +T   ESA    DWW++YYA++  L
Sbjct:   19 LQIAITITEARQLIGENIDPVVIIEIGDDKKQTTVKEGTNAPFYNEYFVFDFIGPQEQLFDKIIRL-------SVMHNKLLGSILIGSFRVDLGTVYNEPGHQFCDKWALLTDPSDIRTGVKGYLKCDISVAGKGDTVQSSQKISDAEE-QIEKNLLIPKGFPSE-RPWARFYVRIYRAEGLPKMNSSIMANVTKAFIGDSKDLVDPYVVVMFAGQMGRTTAQKNCADPLWHEQIVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKIS-DEQDGDKGFLPTFGPAWINLYGSPRN---TTLMEDHQELNEGHGEGVSFRGRILIEIAVEILSGGAHESKFSKAIKDMKLPLKDSKSSKGSGKEKGEKGSEDAKPTSAVDKTNSIQVEVEPFDVPPEFQEEKSEDFLLFGSIFEATLIDRKIGDKG--ISFECSVGNYGNVLDGVSHSGTKKK-SPEHEDGEGAPLLQPEEGEAAPEVSLSFISVTTPEKPLITDGNRNYHYLPFYERKPCIYVKSTWGDQTFRLYSSNMLQKMADHLEDGLEQVKELVKI-SDLAPEEKMRDVLTEFINQSRAFISTAEKRSKMTNTTALDKKRVTLCRQELEAMSANAKAIVQQKKKMSLSDMTREMQSLIDNIKFLVDEPQHTVPDVFIWLLSNNKRVAYARIPARDILYSTLAEERGHHCGKIKTLFFKLPG----KRPPGWNVQAKVDVYLWLGSSKYSHFIFENLPGGYEVETHSASSGHHGSPPPGNLVYKSQHMFQLRAHMYQARGLIAADTSGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNNLVIYGELKDIAEDPPNIVIEVYDDDALSKSEYIGSTVASPTVILANQTYSPAKLTYHPLFCGNLSGGELLAAFELLQV----PESGVQSLPPIETPDAAQIYP----------------VPSNIRPVLSKYRVEVLFWGVRELKKVQLLS----------------VDRPQVLIECAGKGVKSCVIQSYKSNPNFNVIGDWFEVELPENEVLHPPLSICVVDWRAFGRSTLVGTHTINCLKQFLYKPHREQTSAIVGLVAQSPPYDSPD--------PGEQDHIYVDIDPSLRKDMPQSRPHSPAPSPTATLAPSPTPAAGPASDPAASKGSLRRSTKKKKRTIADESAENVIDWWSKYYASVEKL 1142          

HSP 2 Score: 426.017 bits (1094), Expect = 4.177e-121
Identity = 234/547 (42.78%), Postives = 330/547 (60.33%), Query Frame = 2
Query: 4652 TLRLYKNLRDINPVD-----------------FVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACA-----KFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVT 6217
            +  +YKN+ D NP D                  ++RVYI+   NL P+D +GKSDPYI+++LG  E++DR+NYIPK LNPVFG+  E++ TFP++S L + IYD D +  DDLIGET IDLENR+ S H+ +CG+   Y   GY  W+D   PT IL  LC+++ +  P       ++ I  + F  +T+   DD  Q++S E LAL+ LH W +I   G  LVPE+IETRPLY  +KPGI+QG ++MWVDM+P    +P  P+DI+PRK  GYELR  +  TE V L + N FT +K+ DI+VK W+K  + D Q+TDVHY SL+G+G FNWRFV+ F YL AE  +V +++ +++ +++ E K P  L +QV D   + SD  +G  +  L+ F + AK  + CD   LS A       K ++F+ K++RGWWP + + +               VE E  LVT EEAE NPVG  R EP PLE P RP+ SF  F+NP+  + + I    K  +I   V+ +  L + LF Y  PG+ISN I++
Sbjct: 1224 SFSIYKNVDDTNPKDGGQLRILQGIPPNHTVKVLIRVYIVAGFNLSPADPDGKSDPYIVLRLGKTEIKDRDNYIPKQLNPVFGRSFEMQATFPKDSILSIVIYDHDMIGTDDLIGETKIDLENRFFSRHRATCGLQSQYEIEGYNAWRDSTKPTEILAKLCKDNKLDGPYLR--PGQIQIGGKIFTGQTIFNQDD-EQVESYEHLALKALHSWSDIPDIGCNLVPEHIETRPLYHKDKPGIEQGRIQMWVDMFPTDLPLPGPPVDISPRKPKGYELRIIIWNTEDVILEDENIFTGQKSSDIYVKGWLKGIEDDSQETDVHYNSLTGEGNFNWRFVFPFSYLPAEKLMVVSKRENIFSLEKTERKIPTVLLLQVWDFDRLSSDDFLGSMELNLNAFHRGAKTAKGCD---LSMAATPKDENKISIFQQKRIRGWWPFVKSGELTGK-----------VEAEFHLVTTEEAEKNPVGRARKEPEPLEKPNRPNTSFNWFVNPFKCLYHLIWRNYKKYIIIGLVLLIITLFLVLFFYTLPGAISNRILS 1753          
BLAST of Otoferlin vs. Ensembl Xenopus
Match: FER1L6 (fer-1-like family member 6 [Source:NCBI gene;Acc:100497075])

HSP 1 Score: 516.924 bits (1330), Expect = 7.430e-152
Identity = 352/1181 (29.81%), Postives = 559/1181 (47.33%), Query Frame = 2
Query:  755 FQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAI-------------------------------KTSYQPDSSKIGVDVRPCNPVSNT------------------VAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEM-SIGITGNLLDDYAKVASEKEPTPENQ----------------------YVHSMTQSRFAYTYDNKYFH-IPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFS------GKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVK--DIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAP------VPGTVEKVKPVLPQTEEMESA----DWWTRYYATIGDL 4024
             QI++TI EAR L G NI+P+  +  G  K+ T +K  TN+PFYNE+F FD    + ++ + II++       +V+  ++    ++G F +D  +VY   GH F  KWA L DP    +G KGY+K DISV   GD  +      + E   IE NLLIP    +  R      V IY+AE LP MN++I++N+  A  G+ K L D YV V FAG  GRT        P W++QI+F E FPP   R++I V D   + D  ++T FIDL+KI       ++GFLPT+GP+WINLYG+PR    T L++  Q  N+   EGV++RGR++I I                               K S +    K   D +P + V  T                     K E +LLFG I+E TLI+  +G  G  ++FE+ S G  GN+LD  +   ++K+ +PE++                      ++   T  +   T  N+ +H +P+  +KPC+++ +   D   R++  N+++K+   L + + Q   L+ +  ++     ++  +   I      +S  +        T LD K   L R          Q L +  KR N              L   +A PQ+ +PD+FI+++  N RVAYARI AR+I++S++A E+G  CG + T++ K       K    +N+QA++ +YLWLG  +        LP GY  E  S      G  PP  + Y  + MFQLR +++ AR +I +D SGLSDPFA++    H   + I +QT SP W++ L+ +N++       +   PPN+V+E++D D+ +  E++G     P V +    Y+ AKL +  ++ G L+ GE+LAAF+L++         V+ LP ++  D  ++                  +P  IRP LS +R E+L WGVR+L++++++                 V++P++ I+ AG  ++S  I  +   PNF     + ++ LP +    PP++I   +   FG   +VG   I  L  +         RE                      T  I+        G       DM + +P+    +P      V G++ +      +T   ESA    DWW++YYA++  L
Sbjct:   39 LQIAITITEARQLIGENIDPVVIIEIGDDKKQTTVKEGTNAPFYNEYFVFDFIGPQEQLFDKIIRL-------SVMHNKLLGSILIGSFRVDLGTVYNEPGHQFCDKWALLTDPSDIRTGVKGYLKCDISVAGKGDTVQSSQKISDAEE-QIEKNLLIPKGFPSE-RPWARFYVRIYRAEGLPKMNSSIMANVTKAFIGDSKDLVDPYVVVMFAGQMGRTTAQKNCADPLWHEQIVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKIS-DEQDGDKGFLPTFGPAWINLYGSPRN---TTLMEDHQELNEGHGEGVSFRGRILIEIAVEILSGGAHESKFSKAIKDMKLPLKDSKSSKGSGKEKGEKGSEDAKPTSAVDKTNSIQVEVEPFDVPPEVSFSVEKSEDFLLFGSIFEATLIDRKIGDKG--ISFEIISTGNYGNVLDGVSHSGTKKK-SPEHEDGEGAPLLQPEEGEAAPEVSLSFISVTTPEKPLITDGNRNYHYLPFYERKPCIYVKSTWGDQTFRLYSSNMLQKMADHLEDGLEQVKELVKIS-DLAPEEKMRDVLTEFINQSRAFISTAEKRSKMTNTTALDKKRVTLCR----------QELVVGPKRYN--------------LSHFLAQPQHTVPDVFIWLLSNNKRVAYARIPARDILYSTLAEERGHHCGKIKTLFFKLPG----KRPPGWNVQAKVDVYLWLGSSKYSHFIFENLPGGYEVETHSASSGHHGSPPPGNLVYKSQHMFQLRAHMYQARGLIAADTSGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNNLVIYGELKDIAEDPPNIVIEVYDDDALSKSEYIGSTVASPTVILANQTYSPAKLTYHPLFCGNLSGGELLAAFELLQSG-------VQSLPPIETPDAAQIYP----------------VPSNIRPVLSKYRVEVLFWGVRELKKVQLLS----------------VDRPQVLIECAGKGVKSCVIQSYKSNPNFNVIGDWFEVELPENEVLHPPLSICVVDWRAFGRSTLVGTHTINCLKQFL----YKPHRE---------------------QTSAIV--------GLVAQSPKDMPQSRPHSPAPSPTATLALVRGSLRRSTKKKKRTIADESAENVIDWWSKYYASVEKL 1102          

HSP 2 Score: 425.631 bits (1093), Expect = 4.168e-121
Identity = 234/547 (42.78%), Postives = 330/547 (60.33%), Query Frame = 2
Query: 4652 TLRLYKNLRDINPVD-----------------FVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACA-----KFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVT 6217
            +  +YKN+ D NP D                  ++RVYI+   NL P+D +GKSDPYI+++LG  E++DR+NYIPK LNPVFG+  E++ TFP++S L + IYD D +  DDLIGET IDLENR+ S H+ +CG+   Y   GY  W+D   PT IL  LC+++ +  P       ++ I  + F  +T+   DD  Q++S E LAL+ LH W +I   G  LVPE+IETRPLY  +KPGI+QG ++MWVDM+P    +P  P+DI+PRK  GYELR  +  TE V L + N FT +K+ DI+VK W+K  + D Q+TDVHY SL+G+G FNWRFV+ F YL AE  +V +++ +++ +++ E K P  L +QV D   + SD  +G  +  L+ F + AK  + CD   LS A       K ++F+ K++RGWWP + + +               VE E  LVT EEAE NPVG  R EP PLE P RP+ SF  F+NP+  + + I    K  +I   V+ +  L + LF Y  PG+ISN I++
Sbjct: 1183 SFSIYKNVDDTNPKDGGQLRILQGIPPNHTVKVLIRVYIVAGFNLSPADPDGKSDPYIVLRLGKTEIKDRDNYIPKQLNPVFGRSFEMQATFPKDSILSIVIYDHDMIGTDDLIGETKIDLENRFFSRHRATCGLQSQYEIEGYNAWRDSTKPTEILAKLCKDNKLDGPYLR--PGQIQIGGKIFTGQTIFNQDD-EQVESYEHLALKALHSWSDIPDIGCNLVPEHIETRPLYHKDKPGIEQGRIQMWVDMFPTDLPLPGPPVDISPRKPKGYELRIIIWNTEDVILEDENIFTGQKSSDIYVKGWLKGIEDDSQETDVHYNSLTGEGNFNWRFVFPFSYLPAEKLMVVSKRENIFSLEKTERKIPTVLLLQVWDFDRLSSDDFLGSMELNLNAFHRGAKTAKGCD---LSMAATPKDENKISIFQQKRIRGWWPFVKSGELTGK-----------VEAEFHLVTTEEAEKNPVGRARKEPEPLEKPNRPNTSFNWFVNPFKCLYHLIWRNYKKYIIIGLVLLIITLFLVLFFYTLPGAISNRILS 1712          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Otof (otoferlin [Source:MGI Symbol;Acc:MGI:1891247])

HSP 1 Score: 600.127 bits (1546), Expect = 3.777e-179
Identity = 347/1032 (33.62%), Postives = 557/1032 (53.97%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNG-KPLTFEMSIGITGNLLDDYAKVAS---EKEPTPENQY-------------------VHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +S   M + IIKI  +   N      + +G ++G F +D  +VY+   H F  KWA L DP   ++G KGYVK D++V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT++++N+K A  GE K L D YV+V FAG  G+T V   +Y P WN+Q++FT+ FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RLM+ +      TS    +S   V V    PVS +  G+ E + LFG   E ++I+    KNG KP+TFE++IG  GN +D  ++       KEP  E +                    V S    R   T D  YFH+PY  +KPC+++ +   D R R++  NI++ +  +L E +     +I  EK+   RR L+  +  L     + +S     +G + +T LD +  +    +LE M  + ++L  ++KR  V +K+R C   ++ L     +PQ+ +PD+FI+M+  N R+AYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA+L++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ IYRG+  AG++LAAF+L+++    K           D+  +   ++ +R   M      +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:  243 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN-----LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVP-PERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDR---KNGDKPITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQIT-DRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERR-LRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGK----------ADLPPINGPVDMDRGPIMP-----VPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 1225          

HSP 2 Score: 479.945 bits (1234), Expect = 5.492e-138
Identity = 262/638 (41.07%), Postives = 389/638 (60.97%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            I+ + +YP ELE+  +F  F D   +F+L RGK  +D+D     +R  G FKG++C+Y +   +    +   +                                    T  +++ +   +P++ +VR+Y+++A +LHP+D+NGK+DPYI +KLG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC+E  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  V  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD SF+ FLNP  + +YF+ +  +W+L+K  ++F+ LL+ ALF+Y+ PG ++  I+
Sbjct: 1405 IDELKVYPKELES--EFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDP-----------------------------------TYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGP-HGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKFLLLFLLLLLFALFLYSLPGYLAKKIL 1995          

HSP 3 Score: 60.077 bits (144), Expect = 4.849e-8
Identity = 32/118 (27.12%), Postives = 62/118 (52.54%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIY-FGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L V+LK +      GD+  K+ FR     S  L+    +  F + F WP+A  +D+N++L ++ +N ++V  +KL+G   +    ++ E  + V + L+D+   I    ++ E+ Y
Sbjct:    1 MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDSNAIIKTSLSMEVRY 118          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Otof (otoferlin [Source:MGI Symbol;Acc:MGI:1891247])

HSP 1 Score: 598.971 bits (1543), Expect = 8.625e-179
Identity = 347/1032 (33.62%), Postives = 557/1032 (53.97%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNG-KPLTFEMSIGITGNLLDDYAKVAS---EKEPTPENQY-------------------VHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +S   M + IIKI  +   N      + +G ++G F +D  +VY+   H F  KWA L DP   ++G KGYVK D++V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT++++N+K A  GE K L D YV+V FAG  G+T V   +Y P WN+Q++FT+ FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RLM+ +      TS    +S   V V    PVS +  G+ E + LFG   E ++I+    KNG KP+TFE++IG  GN +D  ++       KEP  E +                    V S    R   T D  YFH+PY  +KPC+++ +   D R R++  NI++ +  +L E +     +I  EK+   RR L+  +  L     + +S     +G + +T LD +  +    +LE M  + ++L  ++KR  V +K+R C   ++ L     +PQ+ +PD+FI+M+  N R+AYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA+L++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ IYRG+  AG++LAAF+L+++    K           D+  +   ++ +R   M      +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:  258 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN-----LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVP-PERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDR---KNGDKPITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQIT-DRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERR-LRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRSCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGK----------ADLPPINGPVDMDRGPIMP-----VPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 1240          

HSP 2 Score: 486.108 bits (1250), Expect = 3.962e-140
Identity = 267/643 (41.52%), Postives = 390/643 (60.65%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            I+ + +YP ELE+  +F  F D   +F+L RGK  +D+D     +R  G FKG++C+Y +   +    +   +                                    T  +++ +   +P++ +VR+Y+++A +LHP+D+NGK+DPYI +KLG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC+E  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  V  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD +F+ FLNP  +IKY I  R KW++IKI +  + LL++ALF+Y+ PG     +V K+ G
Sbjct: 1400 IDELKVYPKELES--EFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDP-----------------------------------TYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGP-HGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKIVLALLGLLMLALFLYSLPG----YMVKKLLG 1991          

HSP 3 Score: 59.6918 bits (143), Expect = 5.362e-8
Identity = 32/118 (27.12%), Postives = 62/118 (52.54%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIY-FGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L V+LK +      GD+  K+ FR     S  L+    +  F + F WP+A  +D+N++L ++ +N ++V  +KL+G   +    ++ E  + V + L+D+   I    ++ E+ Y
Sbjct:    1 MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDSNAIIKTSLSMEVRY 118          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Fer1l6 (fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:MGI:3645398])

HSP 1 Score: 531.176 bits (1367), Expect = 5.627e-156
Identity = 364/1218 (29.89%), Postives = 587/1218 (48.19%), Query Frame = 2
Query:  710 KLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPK-RPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAI--------------------------------------------------KTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTP-------------ENQYVHSMTQSRFAYTYDNK---------YFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRS-NVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNREC---FSG-KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVK--DIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDE---------RSVKSLNLFNAGNDTEG------------ILNEGFENEDGSAIN--ELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEM---------ESA----DWWTRYYATI 4015
            KL   I    +K +++QI+VTI EAR L G NI+P+  +  G  K+ + +K  TNSPFYNE+F FD    ++ + + IIKI       +V+  ++    ++G F +D  +VY   GH F  KWA L DP    +G KGY+K DISV   GD  K  P   D EE   IE NLLIP    +  R      V +Y+AE LP MN++I++N+  A  G+ K L D +VEVSFAG TGRT V      P W++Q++F E FPP   R++I V D   + D  ++T FIDL+KI       ++GFLPT+GP+WINLYG+PR  +   L+   Q  N+   EGV++RGR+++ I                                                  +T+ + +S+++ V+     P    +  K E +LLFG  +E T+I+  +G   KP++FE+S+G  GNL+D  +   S+K+ T              E         S  + T+  K         Y ++P+  KKPC+  I+   D   R+   N++EK+   L E I +   L+ + +     + +KT++ + I      +S  +    T  +T LD K   L   +L+ M  + + +  + K+  ++ E +RE    V+ +   + +PQ+ +PD+FI+M+  N RVAYARI A+++++S +  + G  CG + T +LK       K    + +QA++ IYLWLG  R        LP GY  E     SG   PP  + Y  + +FQLR +++ AR +I +D +GLSDPFA++        + I +QT SP W++ L+ + ++ +     L  SPP+VVVE++D D+    E+LG     P V +    Y   KL +  I+ G L+ G++LA F+L+++        ++GLP     DI ++                  +P  IRP LS +R E+L WGVR++++++++                 V++P++ I+  G  ++S  I  +   PNF       ++ LP +    PP++I   +   FG   +VG   I N +  + C   + F    +T  D           + +S NL ++  D               +L +  + +  + ++  + + M E +  P    P P       P  P              ESA    DWW++YYA++
Sbjct:   67 KLLTKIHDGEIKSQNYQITVTITEARQLVGENIDPVVTIEIGDDKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKI-------SVLHHKLIGSILIGSFRVDVGTVYNQPGHQFCDKWALLTDPGDIRTGTKGYLKCDISVTGKGDILKTNPKTSDAEEQ--IEKNLLIPQGFPSE-RPWARFYVRLYRAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQTGRTSVQKNCADPVWHEQVVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKIS-NEQDGDKGFLPTFGPAWINLYGSPRNHS---LMDDYQELNEGFGEGVSFRGRILVEIAVEILSGGAQESKFSKALKELKLSSKDKDSKSSKGSSKDKADKADDSKAQQTTDKTNSTEVEVESFAVPP--EIIPEKYEDFLLFGAFFEATMIDRKIGD--KPISFEVSVGNFGNLIDGGSHHGSKKKSTELTEEDVLPLLHEGEKDVAQDSAISMASTTHPEKPLVTDGNRNYNYLPFGAKKPCVSFISSWGDQTFRLHWSNMLEKMADLLEEGIEEVRELVKVSQEAPEEK-MKTALRDFITQSRVFISEAEKKPKTLNQTALDKKRLTLCWQELKAMADEAEGVIRQQKKKLSLDEMIREAQNFVEKIHFLVDEPQHTIPDVFIWMLSNNKRVAYARIAAKDLLYSPIEEQMGKHCGKIKTHFLKLPG----KRPPGWTVQAKVDIYLWLGSTRYSNTILDNLPVGYEAEMPPKSSGTHHPPSALLYQAQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSQCQTTKIISQTLSPTWNQMLLFNELVLHGEEKELLESPPHVVVELYDSDAVGKPEYLGATVAAPVVTLADQDYEPPKLSYHPIFCGNLSGGDLLAVFELLQVPPS----GLQGLPPTGPPDITQIYP----------------VPSNIRPVLSKYRVEVLFWGVREMKKVQLLS----------------VDRPQVLIECGGGGVKSCVIQSYKNNPNFSVQAEAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTI-NCLKQFLCKPRETFALTSQTDGDGARPAISDSLAATESSNLLSSSQDLPADHVYVDVEPPPTMLPDSAQAQTATLVDIPDSSPMLETEHKPVAQGP-PKDGHGKDPRKPSRRSTKRRRRTIADESAENVIDWWSKYYASV 1223          

HSP 2 Score: 449.129 bits (1154), Expect = 2.075e-128
Identity = 257/636 (40.41%), Postives = 371/636 (58.33%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQ-IKSLEPLALEVLHHWHEIV-PGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGT-AIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACA--KFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            +  + +Y  +LE+  +F  F D  K+F L+RGK  E+D   +  DR  G FKG+ CIY                                          ++   E    LR+ + +   +PV  ++RVYI+ A NL P+D +GKSDPYI+++LG  E++DR+ YIPK LNPVFG+  E++ TFP+ES L V IYD D +  DDLIGET IDLENR+ S H+  CG+   Y   GY  W+D   PT IL  LC+++ +  P +     ++ I  + F  +T+  ++D  + ++S E LAL+VLH W +I   G +LVPE+IETRPLY  +KPG++QG L+MWVDM+P  T  +  P+DI+PRK  GYELR T+  TE V L + N FT +K+ DI+VK W+K  + D Q+TDVHY SL+G+G FNWRF++ F YL AE  +V +++ +++ +++ E KTP  L +QV D   + SD  +G  +  L+ FP+ AK  ++CD  +   A    K ++F+ K+VRGWWP   + +               VE E  LVTAEEAE NPVG  R EP PL  P RPD SF  F++P+  + + I    K  +I  F++ + ++ + LFIY  PG+IS  IV
Sbjct: 1278 LAALKIYDGDLES--EFNNFEDWVKTFELFRGKSTEEDHGLDG-DRVIGKFKGSFCIYK---------------------------------------SPEDSTSEDSGQLRIQQGIPPNHPVQVLIRVYIVAAFNLSPADPDGKSDPYIVLRLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSVLIYDHDMIGSDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYF--RPGKIQIGKKVFSGKTVFNEEDSEEMVESYEHLALKVLHSWEDIPEAGWRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDTPQLGPPVDISPRKPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWIKGLEDDRQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVISKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGSLEMNLNSFPRAAKSAKACDLSKFENAVQENKISIFQQKRVRGWWPFAKSKELTGK-----------VEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFVSPFKCLYHLIWKNYKKYIIIAFILIILIVFLVLFIYTLPGAISRRIV 1858          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Fer1l6 (fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:MGI:3645398])

HSP 1 Score: 531.176 bits (1367), Expect = 5.627e-156
Identity = 364/1218 (29.89%), Postives = 587/1218 (48.19%), Query Frame = 2
Query:  710 KLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPK-RPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAI--------------------------------------------------KTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTP-------------ENQYVHSMTQSRFAYTYDNK---------YFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRS-NVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNREC---FSG-KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVK--DIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDE---------RSVKSLNLFNAGNDTEG------------ILNEGFENEDGSAIN--ELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEM---------ESA----DWWTRYYATI 4015
            KL   I    +K +++QI+VTI EAR L G NI+P+  +  G  K+ + +K  TNSPFYNE+F FD    ++ + + IIKI       +V+  ++    ++G F +D  +VY   GH F  KWA L DP    +G KGY+K DISV   GD  K  P   D EE   IE NLLIP    +  R      V +Y+AE LP MN++I++N+  A  G+ K L D +VEVSFAG TGRT V      P W++Q++F E FPP   R++I V D   + D  ++T FIDL+KI       ++GFLPT+GP+WINLYG+PR  +   L+   Q  N+   EGV++RGR+++ I                                                  +T+ + +S+++ V+     P    +  K E +LLFG  +E T+I+  +G   KP++FE+S+G  GNL+D  +   S+K+ T              E         S  + T+  K         Y ++P+  KKPC+  I+   D   R+   N++EK+   L E I +   L+ + +     + +KT++ + I      +S  +    T  +T LD K   L   +L+ M  + + +  + K+  ++ E +RE    V+ +   + +PQ+ +PD+FI+M+  N RVAYARI A+++++S +  + G  CG + T +LK       K    + +QA++ IYLWLG  R        LP GY  E     SG   PP  + Y  + +FQLR +++ AR +I +D +GLSDPFA++        + I +QT SP W++ L+ + ++ +     L  SPP+VVVE++D D+    E+LG     P V +    Y   KL +  I+ G L+ G++LA F+L+++        ++GLP     DI ++                  +P  IRP LS +R E+L WGVR++++++++                 V++P++ I+  G  ++S  I  +   PNF       ++ LP +    PP++I   +   FG   +VG   I N +  + C   + F    +T  D           + +S NL ++  D               +L +  + +  + ++  + + M E +  P    P P       P  P              ESA    DWW++YYA++
Sbjct:   67 KLLTKIHDGEIKSQNYQITVTITEARQLVGENIDPVVTIEIGDDKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKI-------SVLHHKLIGSILIGSFRVDVGTVYNQPGHQFCDKWALLTDPGDIRTGTKGYLKCDISVTGKGDILKTNPKTSDAEEQ--IEKNLLIPQGFPSE-RPWARFYVRLYRAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQTGRTSVQKNCADPVWHEQVVFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKIS-NEQDGDKGFLPTFGPAWINLYGSPRNHS---LMDDYQELNEGFGEGVSFRGRILVEIAVEILSGGAQESKFSKALKELKLSSKDKDSKSSKGSSKDKADKADDSKAQQTTDKTNSTEVEVESFAVPP--EIIPEKYEDFLLFGAFFEATMIDRKIGD--KPISFEVSVGNFGNLIDGGSHHGSKKKSTELTEEDVLPLLHEGEKDVAQDSAISMASTTHPEKPLVTDGNRNYNYLPFGAKKPCVSFISSWGDQTFRLHWSNMLEKMADLLEEGIEEVRELVKVSQEAPEEK-MKTALRDFITQSRVFISEAEKKPKTLNQTALDKKRLTLCWQELKAMADEAEGVIRQQKKKLSLDEMIREAQNFVEKIHFLVDEPQHTIPDVFIWMLSNNKRVAYARIAAKDLLYSPIEEQMGKHCGKIKTHFLKLPG----KRPPGWTVQAKVDIYLWLGSTRYSNTILDNLPVGYEAEMPPKSSGTHHPPSALLYQAQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSQCQTTKIISQTLSPTWNQMLLFNELVLHGEEKELLESPPHVVVELYDSDAVGKPEYLGATVAAPVVTLADQDYEPPKLSYHPIFCGNLSGGDLLAVFELLQVPPS----GLQGLPPTGPPDITQIYP----------------VPSNIRPVLSKYRVEVLFWGVREMKKVQLLS----------------VDRPQVLIECGGGGVKSCVIQSYKNNPNFSVQAEAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTI-NCLKQFLCKPRETFALTSQTDGDGARPAISDSLAATESSNLLSSSQDLPADHVYVDVEPPPTMLPDSAQAQTATLVDIPDSSPMLETEHKPVAQGP-PKDGHGKDPRKPSRRSTKRRRRTIADESAENVIDWWSKYYASV 1223          

HSP 2 Score: 449.129 bits (1154), Expect = 2.075e-128
Identity = 257/636 (40.41%), Postives = 371/636 (58.33%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQ-IKSLEPLALEVLHHWHEIV-PGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGT-AIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACA--KFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            +  + +Y  +LE+  +F  F D  K+F L+RGK  E+D   +  DR  G FKG+ CIY                                          ++   E    LR+ + +   +PV  ++RVYI+ A NL P+D +GKSDPYI+++LG  E++DR+ YIPK LNPVFG+  E++ TFP+ES L V IYD D +  DDLIGET IDLENR+ S H+  CG+   Y   GY  W+D   PT IL  LC+++ +  P +     ++ I  + F  +T+  ++D  + ++S E LAL+VLH W +I   G +LVPE+IETRPLY  +KPG++QG L+MWVDM+P  T  +  P+DI+PRK  GYELR T+  TE V L + N FT +K+ DI+VK W+K  + D Q+TDVHY SL+G+G FNWRF++ F YL AE  +V +++ +++ +++ E KTP  L +QV D   + SD  +G  +  L+ FP+ AK  ++CD  +   A    K ++F+ K+VRGWWP   + +               VE E  LVTAEEAE NPVG  R EP PL  P RPD SF  F++P+  + + I    K  +I  F++ + ++ + LFIY  PG+IS  IV
Sbjct: 1278 LAALKIYDGDLES--EFNNFEDWVKTFELFRGKSTEEDHGLDG-DRVIGKFKGSFCIYK---------------------------------------SPEDSTSEDSGQLRIQQGIPPNHPVQVLIRVYIVAAFNLSPADPDGKSDPYIVLRLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSVLIYDHDMIGSDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYF--RPGKIQIGKKVFSGKTVFNEEDSEEMVESYEHLALKVLHSWEDIPEAGWRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDTPQLGPPVDISPRKPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWIKGLEDDRQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVISKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGSLEMNLNSFPRAAKSAKACDLSKFENAVQENKISIFQQKRVRGWWPFAKSKELTGK-----------VEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFVSPFKCLYHLIWKNYKKYIIIAFILIILIVFLVLFIYTLPGAISRRIV 1858          
BLAST of Otoferlin vs. Ensembl Mouse
Match: Fer1l4 (fer-1-like 4 (C. elegans) [Source:MGI Symbol;Acc:MGI:1921812])

HSP 1 Score: 480.715 bits (1236), Expect = 2.326e-138
Identity = 340/1204 (28.24%), Postives = 563/1204 (46.76%), Query Frame = 2
Query:  743 KIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGL-SKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTS------------------------------------------YQPDS-----------SKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLD--------DYAKVASEKEPTP------------ENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKS-CRGTAKKTM-----LDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTK-KITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVD-----NFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTG 4096
            K +DFQ+ VT++EA+ L G NINP   V  G Q++ T     TN PFYNE+F F+   +RL + +L+++I    S++   +A RI      G F +D           F +KWAPL DP+   +G KG+VK+ +SV   GD P  P       + +IE NLL+P  V    R    + V +Y+AE LP + T ++ ++  A++ +   L D YV VSF G  G T V     +P WN+Q+ F E FPP    LR+ +RDN  + D  ++T  +DL++I  +G     GF PT+GP+W+ LYG+       +L    Q  N+ L EG+ +RGRL++A+                                              QP S           S + V+V    P+        E +LLFG ++E T+I+  L K  KP++ E+SIG  G   +        D    +S  E  P            E + + +  Q       +  Y  +P +++KPCL + +  ED+  R+   N + K+   L   +++   +         RR    +   L  ++E++V+G +  C G  ++TM     LD    +L+   L  M  +   L   L+ +N+   +     L+  L     +PQ  LPD+ ++M     RVAYARI A++I++S +  E+G  CG + ++ L       +       + A+L+++LWLGL +  +     LP     E  SG     Y D  D   FQLR +L+ AR V+ +DDSGLSDPFAR++IS     + +  QT SP+WDE L+ D +I +   + L+  PP VV+ +FD +      FLGR F  P+V +  D Y   +LQ++ + +G  AAGE++A F+L+E+D     + +V      +D+  +   I+ +         L +P  +RP L  FR E+L WG+R L R   VHL             F + +P++ +++AG R+ES+ + ++   PNF + +  + + LP      PP++I       FG   +VG+  + +++ +      D        E  +  +        +L  AG   + +L    +      + +  +++E+ P+P                    EEM   DWW++YYA++ +        + +++  +++    ++G
Sbjct:  223 KAQDFQVGVTVLEAQKLVGVNINPYVAVRVGDQRKVTATLRGTNCPFYNEYFLFEFHETRLHLQDLLLEITAFHSQTLPFMATRI------GTFRMDLGMALDQPDGHFHQKWAPLHDPRDTRAGTKGFVKITLSVRARGDLPLPPPPPCPGTSSDIEKNLLLPHGV-QAERPWARLRVRVYRAEGLPTVRTGLLGSLARALHDQ-NVLLDPYVRVSFLGQQGETSVRGEETAPKWNEQLSFVELFPPLTRSLRLQLRDNAPLVDVALATHVLDLRQISNSGRAA--GFNPTFGPAWVPLYGS---LPSGRLRDDLQSLNEGLGEGIWFRGRLLVAVSMEVYEGRVEPKPSQTTQRSGLSRLTGKKKKKKEKTRQGQTPAGILQPASASTSEDAPEIPSAMEVEVEDLLPLPENALASFEDFLLFGVLFEATMIDPSLAK--KPISLEISIGHAGRQEEQSGQGSRADEGSESSTLEVQPLLESEDRGAGQEEQELLGTPAQWPEPVDGNGPYLCLPLRHRKPCLHVWSCWEDYTWRLQSSNSVCKVAERLDHGLQEVEKM--------QRRSGPGACTRLKQTLEELVAGSRQFCHGAERRTMTRPNALDRCRAKLLTHSLNLMARQGLRLLRSLRLNNMQRTVVLAKKLLARLRFLAQEPQPPLPDVLVWMFSGQRRVAYARIPAQDILYSVVEEERGRDCGKIQSLLLT------VPGAAPGEVCAKLELFLWLGLGKQAKACTSELPMDLLPEPSSGLPQSLYRD--DFRYFQLRAHLYQARGVLAADDSGLSDPFARVLISTQCQTTRVLEQTLSPLWDELLVFDQLIVDGRREHLREEPPLVVINVFDHNKFGPAVFLGRAFAAPRVKLIEDPYQRPELQFFPLRKGPQAAGEVIATFELIELDYSGHLEPSVPSDVEPRDLASLVEPISGH---------LSLPPSVRPVLRAFRVEVLFWGLRGLGR---VHL-------------FEIEKPQVVLEVAGRRVESEVLPNYRENPNFTELVRHVTVDLPEQPYLQPPLSILVIERRAFGRTVLVGSHIVPHMLRFILQGHEDPQEEEETEEETRDLVPHGPQGEKSLPEAGTSRQ-LLKAPLKKLTLGLLGQGPELEEDIPDP--------------------EEM---DWWSKYYASLQEFQGQPSSDDEMDEAGDADGTHLISG 1346          

HSP 2 Score: 379.793 bits (974), Expect = 6.912e-106
Identity = 219/550 (39.82%), Postives = 308/550 (56.00%), Query Frame = 2
Query: 4685 NPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFF--AETMIEDDDGSQI---KSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAE-DCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCD-PFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXC-----------------------------VELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKM 6223
             P+  +VRVYI+KA NL P+D NGK+DPY++V  G ++   +E YIPK LNP+FG+ +EL V+ P +  L V ++D D +  DDLIGET IDLENR+ S H+ +CG+   Y  +GY  W+D   P+ IL  LC+   +P+P Y      V +  R F   +E    DD   ++    S E  AL VL  W E+   G +LVPE++ETRPLY P  PG+ QG L MW+D++P+    P P+DI PR+ I YELR  +  T+ V L +VN  T E++ DI+VKSW+K  + D Q+TDVH+ SL+G+G FNWRFV+ FDYL  E +  V  +   + ++E E++ P  L +QV D   I ++  +G  + +L    + A+    C     L  A  + NLFR  ++RGWWP++     ED + E  E   G                              VE E EL+T EEAE  PVG GR EP PLE P RP  SF  F+NP  T  +FI  R   IL+ + ++ +  + + L  Y  PG IS  I + +
Sbjct: 1444 RPIKLLVRVYIVKATNLAPADPNGKADPYVVVSAGKEQRDTKERYIPKQLNPIFGEVLELSVSLPAQPELTVAVFDHDLVGSDDLIGETHIDLENRFYSHHRANCGLASQYDVNGYNAWRDAFRPSQILAGLCQRCGLPVPEYR--AGAVKVGSRVFLTPSEAPPPDDRKPKVTSEASEEAQALHVLRRWQEMPGLGIQLVPEHVETRPLYHPRSPGLLQGSLHMWIDIFPSDVPAPPPVDIKPRQPISYELRVVIWNTDDVALDDVNPLTGERSSDIYVKSWVKGLEQDRQETDVHFNSLTGEGNFNWRFVFRFDYLPTEREVSVRRKPGPFALEEAEFRQPAVLVLQVWDYDRISANDFLGSLELQLPDMVRGARDPEHCSVRLALDGAGPRCNLFRCHRLRGWWPVVKMKDMEDVEREAREAQAGKKRKRKRRAGRPEDLEFTDTGGNVYILTGKVEAEFELLTVEEAEKRPVGKGRKEPEPLEKPNRPKTSFNWFVNPLKTFIFFIWRRYWRILVLLLLLALITIFLLLVFYTIPGQISEVIFSPV 1991          

HSP 3 Score: 71.633 bits (174), Expect = 1.354e-11
Identity = 36/138 (26.09%), Postives = 70/138 (50.72%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYN 550
            M+L+V +++L G     D+ ++L FR   +K+ ++        G+ F WP        + L ++  N +RV   + LG L I+   L +   + +RE LVDER++++ I V  +++Y  P   +  +  + F  P+ +
Sbjct:    1 MALTVCVRHLTGLPGTHDRQVRLCFRGFTQKTRKIHCGREADVGELFRWPHYGSPLAGESLSVQVVNCSRVFSPRPLGTLVISLQQLQSAGHLVLREALVDERLRVSPIQVELDLKYQPPEGAAGTWAEEDFGTPIRD 138          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q5SPC5|OTOF_DANRE (Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1)

HSP 1 Score: 604.749 bits (1558), Expect = 5.207e-180
Identity = 354/1036 (34.17%), Postives = 562/1036 (54.25%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVA----------------------SEKEPTPENQYVHSM--TQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK---LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P S +  D+QISVT++EAR L G N++P+  V  G++K+ T +K  TN P+YNE+F FD  +    M + IIKI  +   N      + +G ++G F +D  +VYT   H F  KWA L DP   T+G KGYVK DI+V+  GD  K P      +  +IE NLL+P  V  + R+     V IY+AE LP MNT+I++N+K A  GE + L D YV V FAG  G+T V   +Y P WN+Q+IFTE FPP   RL++ +RD+D V D  I T FIDL+K+   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL+I+I      T+     S   V + P + +S +  GK E + LFG   E T+I+  +G   KP++FE++IG  GN +D  +K A                      S +E   ++  + S+  T        D  YFH+PY  KKPC+++ +  +D R R++  NI++K+  +L E +     +I  EK    RR L+  +  L  S  + V+     +  + +T LD +  +    ++E M  + + +  ++KR+ V +K++     ++ L     +PQ+ +PD+FI+MI  N R+AYARI +++I++S +  E G  CG +  V+L RL          + +QA+L++YLWLGL +  + + +GLP G+   +   G     +PP  + Y  + +FQLR +++ AR++  +D SGLSDPFAR+  S H   + + ++T  P WD+ L+ DN+        L+  PP +V+E++D D+    EF+GR F +P   +  + Y   +    L+++ IYRG  AAG++LAAF+L+++    +      LP +               G  D ++   L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+T L
Sbjct:  249 MEPSSGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEEKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKIIKISVIHSKN-----LLRSGTLVGTFKLDVGTVYTQPEHQFHHKWAMLSDPDDITTGCKGYVKCDIAVVGKGDNIKTPHKASEADEDDIEGNLLLPEGVP-SERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVLVQFAGQKGKTSVQKSSYEPIWNEQVIFTEMFPPLCRRLKVQIRDSDKVNDVAIGTHFIDLRKVSNDGDK---GFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISIAVEILDTTSAEIMSSTEVHMEPVSNISESATGKMEEFFLFGSFLEATMIDRKIGD--KPISFEVTIGNYGNQIDGVSKPALAKKKKEGGGESEEEESELIHNSSEEEAEDDGDLTSVPSTPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAYPERR-LRGVLEELSTSCSRFVTLANKDQNLSGRTKLDRERLKSCMREMESMGQQAKTIRTQVKRNTVRDKLKLVLNFLQRLRFLADEPQHSIPDVFIWMISNNKRIAYARIPSKDILYSIVDEEMGKDCGKVKAVFL-RLPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLIGLPSGFEENKAVKGIGIQAVPPISLVYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEAGELRDDPPIIVIELYDQDTVGKAEFIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCAAGDLLAAFELLQIGPAGR----AALPPID--------------GPTDSDRGPILPVPLGIRPVLSRYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGSHAVTTL 1234          

HSP 2 Score: 498.049 bits (1281), Expect = 2.981e-143
Identity = 272/641 (42.43%), Postives = 393/641 (61.31%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDD-NFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            ++ +M+Y  ELE+  +FG F D   +F+LYRGK  +DDD N  + DR  G FKG++C+Y +   +    +   +                                     + +++++   +P++ +VR+YII+A +LHP+D+NGK+DPYI++KLG  ++RD+ENYI K LNPVFGK  ++E TFP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D + P  IL  LC+E  +  P Y     RV + +R F   T IED+ G + ++ E LAL VL HW EI   G KL+PE++ETRPL  P+KPGI+QG +EMWVDM+P     P P IDI+PRK   YELR  +  T++V L + ++FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRFV+ FDYL AE+ IV ++K S++  DE EYK P  L +QV D+    +D  +G  +  L+KFP+ AK  + C  D           ++F+ K+V+GWWP +   ++++ +          VE E+ L+TAEEAE +PVGLGR +P PLE P RPD S + F+NP  +I+YFI +  +W+++K   + + LL++ LF+Y+ PG     +V K+ G
Sbjct: 1399 VDELMVYNKELES--EFGSFEDWLHTFNLYRGKAGDDDDHNVVDEDRIVGRFKGSLCMYKLPLSEEITREAGFDP-----------------------------------NMGMFQSIPHNDPINVLVRIYIIRATDLHPADINGKADPYIVIKLGKSDIRDKENYISKQLNPVFGKSFDIEATFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSVHGYNVWRDPQKPAQILAKLCKEGKLDGPHYGP-GGRVKVANRIFLGPTEIEDESGLKKQTEEHLALTVLRHWEEIPRVGCKLIPEHVETRPLLNPDKPGIEQGRIEMWVDMFPMDVPAPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESMFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNKFPRGAKTAKQCSLDMVLKEHELPTISIFKQKRVKGWWPFVAQNENDEFELTGK------VEAELHLLTAEEAEKSPVGLGRNDPEPLEKPNRPDTSLMWFMNPLRSIRYFIWHNYRWLILKALALLLLLLLVGLFLYSIPG----YLVKKLLG 1991          

HSP 3 Score: 58.5362 bits (140), Expect = 7.928e-7
Identity = 31/118 (26.27%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSAN-IYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L V+LK +      GD+  K+ FR +   S  L+   +   F Q F WPI  ++D +++L ++ +N ++V  ++L+G  ++    ++ E  + V + L+D+        ++ EI+Y
Sbjct:    1 MALVVHLKTVTELRGKGDRIAKVTFRGLSFFSRVLENCEDEARFEQAFRWPIGSQVDGDEMLEIQVFNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTTISIEIKY 118          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q9ESF1|OTOF_MOUSE (Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1)

HSP 1 Score: 598.971 bits (1543), Expect = 6.489e-178
Identity = 347/1032 (33.62%), Postives = 557/1032 (53.97%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNG-KPLTFEMSIGITGNLLDDYAKVAS---EKEPTPENQY-------------------VHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +S   M + IIKI  +   N      + +G ++G F +D  +VY+   H F  KWA L DP   ++G KGYVK D++V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT++++N+K A  GE K L D YV+V FAG  G+T V   +Y P WN+Q++FT+ FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RLM+ +      TS    +S   V V    PVS +  G+ E + LFG   E ++I+    KNG KP+TFE++IG  GN +D  ++       KEP  E +                    V S    R   T D  YFH+PY  +KPC+++ +   D R R++  NI++ +  +L E +     +I  EK+   RR L+  +  L     + +S     +G + +T LD +  +    +LE M  + ++L  ++KR  V +K+R C   ++ L     +PQ+ +PD+FI+M+  N R+AYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA+L++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ IYRG+  AG++LAAF+L+++    K           D+  +   ++ +R   M      +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:  243 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN-----LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVP-PERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDR---KNGDKPITFEVTIGNYGNEVDGMSRPLRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQIT-DRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERR-LRGVLEELSCGCHRFLSLSDKDQGRSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGSATAGDLLAAFELLQIGPSGK----------ADLPPINGPVDMDRGPIMP-----VPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 1225          

HSP 2 Score: 479.945 bits (1234), Expect = 3.842e-137
Identity = 262/638 (41.07%), Postives = 389/638 (60.97%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            I+ + +YP ELE+  +F  F D   +F+L RGK  +D+D     +R  G FKG++C+Y +   +    +   +                                    T  +++ +   +P++ +VR+Y+++A +LHP+D+NGK+DPYI +KLG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC+E  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  V  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD SF+ FLNP  + +YF+ +  +W+L+K  ++F+ LL+ ALF+Y+ PG ++  I+
Sbjct: 1405 IDELKVYPKELES--EFDSFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDP-----------------------------------TYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGP-HGRVRVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKFLLLFLLLLLFALFLYSLPGYLAKKIL 1995          

HSP 3 Score: 60.077 bits (144), Expect = 3.335e-7
Identity = 32/118 (27.12%), Postives = 62/118 (52.54%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIY-FGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L V+LK +      GD+  K+ FR     S  L+    +  F + F WP+A  +D+N++L ++ +N ++V  +KL+G   +    ++ E  + V + L+D+   I    ++ E+ Y
Sbjct:    1 MALIVHLKTVSELRGKGDRIAKVTFRGQSFYSRVLENCEGVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFCMVLQKVVEENRVEVTDTLMDDSNAIIKTSLSMEVRY 118          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q9HC10|OTOF_HUMAN (Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=3)

HSP 1 Score: 597.43 bits (1539), Expect = 2.242e-177
Identity = 348/1032 (33.72%), Postives = 556/1032 (53.88%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIA-----IKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNG-KPLTFEMSIGITGNLLDDYAKVAS---EKEPTPENQY-------------------VHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +S   M + IIKI  +   N      + +G ++G F +D  +VY+   H F  KWA L DP   +SG KGYVK D++V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT++++N+K A  GE K L D YV+V FAG  G+T V   +Y P WN+Q++FT+ FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL++      + TS    +S   V V    P+S + AGK E + LFG   E ++I+    +NG KP+TFE++IG  GN +D  ++       KEP  E +                    V S    R   T D  YFH+PY  +KPC+++ +   D R R++  NI++ +  +L E +     +I  EK+   RR L+  +  L     + +S     +G + +T LD +  +    +LE M  + + L  ++KR  V +K+R C   ++ L     +PQ+ +PDIFI+M+  N RVAYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA++++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ IYRG   AG++LAAF+L+++          G     D+  +   ++ +R   M      +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:  244 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN-----LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISSGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVP-PERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPISESCAGKMEEFFLFGAFLEASMIDR---RNGDKPITFEVTIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNASDDEAGDAGDLASVSSTPPMRPQVT-DRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDIQEMIKTEKSYPERR-LRGVLEELSCGCCRFLSLADKDQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQI----------GPAGKADLPPINGPVDVDRGPIMP-----VPMGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 1226          

HSP 2 Score: 476.863 bits (1226), Expect = 4.085e-136
Identity = 259/638 (40.60%), Postives = 389/638 (60.97%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEI-VPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            I+ + +YP ELE+  +F  F D   +F+L RGK  +D+D     +R  G FKG++C+Y +   +    +   +                                    T  +++ +   +P++ +VRVY+++A +LHP+D+NGK+DPYI ++LG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC++  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  +  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD SF+ FLNP  + +YF+ +  +W+L+K+ ++ + LL++ALF+Y+ PG +   I+
Sbjct: 1405 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDS-----------------------------------TYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLCKDGKVDGPHFGP-PGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKLLLLLLLLLLLALFLYSVPGYLVKKIL 1995          

HSP 3 Score: 61.2326 bits (147), Expect = 1.226e-7
Identity = 31/118 (26.27%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIY-FGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L ++LK +      GD+  K+ FR     S  L+   ++  F + F WP+A  +D+N++L ++ +N ++V  +KL+G  ++    ++ E  + V + L+D+   I    +  E+ Y
Sbjct:    1 MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEMLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRY 118          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q9ERC5|OTOF_RAT (Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2)

HSP 1 Score: 596.66 bits (1537), Expect = 3.380e-177
Identity = 346/1032 (33.53%), Postives = 556/1032 (53.88%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNG-KPLTFEMSIGITGNLLDDYAKVAS---EKEPTPENQY-------------------VHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +S   M + IIKI  +   N      + +G ++G F +D  +VY+   H F  KWA L DP   ++G KGYVK D++V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT++++N+K A  GE K L D YV+V FAG  G+T V   +Y P WN+Q++FT+ FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RLM+ +      TS    +S   V V    PVS +  G+ E + LFG   E ++I+    KNG KP+TFE++IG  GN +D  ++       KEP  E +                    V S    R   T D  YFH+PY  +KPC+++ +   D R R++  NI++ +  +L E +     +I  EK+   RR L+  +  L     + +S     +G + +T LD +  +    +LE M  + ++L  ++KR  V +K+R C   ++ L     +PQ+ +PD+FI+M+  N R+AYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA+L++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D +GLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P V +  + Y   +    L+++ IYRG   AG++LAAF+L+++    K           D+  +   ++ +R   M      +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:  259 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN-----LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVP-PERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPVSESCTGRMEEFFLFGAFLEASMIDR---KNGDKPVTFEVTIGNYGNEVDGTSRPQRPRPRKEPGDEEEVDLIQNSSDDEGDEAGDLASVSSTPPMRPQIT-DRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERR-LRGVLEELSCGCHRFLSLSDKDQGHSSRTRLDRERLKSCMRELESMGQQAKSLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQTFQLRAHMYQARSLFAADSTGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPSGK----------ADLPPINGPVDMDRGPIMP-----VPVGIRPVLSKYRVEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVSSL 1241          

HSP 2 Score: 487.263 bits (1253), Expect = 1.387e-139
Identity = 267/643 (41.52%), Postives = 390/643 (60.65%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            I+ + +YP ELE+  +F  F D   +F+L RGK  +D+D     +R  G FKG++C+Y +   +    +   +                                    T  +++ +   +P++ +VR+Y+++A +LHP+D+NGK+DPYI +KLG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ IL  LC+E  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  V  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD +F+ FLNP  +IKY I  R KW++IKI +  + LL++ALF+Y+ PG     +V K+ G
Sbjct: 1401 IDELKVYPKELES--EFDNFEDWLHTFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDP-----------------------------------TYGMFQGIPSNDPINVLVRIYVVRATDLHPADINGKADPYIAIKLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTRLCKEGKVDGPHFGP-HGRVKVANRVFTGPSEIEDENGQRKPTDEHVALSALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVMSKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKIVLALLGLLMLALFLYSLPG----YMVKKLLG 1992          

HSP 3 Score: 60.077 bits (144), Expect = 2.842e-7
Identity = 31/118 (26.27%), Postives = 63/118 (53.39%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIY-FGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L V+LK +       D+  K+ FR     S  L+   ++  F + F WP+A  +D+N++L ++ +N ++V  +KL+G  ++    ++ E  + V + L+D+   I    ++ E+ Y
Sbjct:    1 MALIVHLKTVSELRGRADRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNEVLEIQIFNYSKVFSNKLIGTFRMVLQKVVEENRVEVSDTLIDDNNAIIKTSLSMEVRY 118          
BLAST of Otoferlin vs. UniProt/SwissProt
Match: sp|Q2WGJ9|FR1L6_HUMAN (Fer-1-like protein 6 OS=Homo sapiens OX=9606 GN=FER1L6 PE=2 SV=2)

HSP 1 Score: 531.946 bits (1369), Expect = 1.800e-155
Identity = 337/1081 (31.17%), Postives = 543/1081 (50.23%), Query Frame = 2
Query:  710 KLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPK-RPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTS---------------------------------YQPDSSKIGVDVRPCNPVSNT-------------VAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTP------------ENQYVHSMTQSRFAYTYDNK---------YFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRS-NVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVK--DIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQC 3727
            KL   I    ++ +++QI++TI EAR L G NI+P+  +  G +K+ + +K  TNSPFYNE+F FD    ++ + + IIKI       +V   ++    ++G F +D  +VY   GH F  KWA L DP    +G KGY+K DISV+  GD  K  P   D EE   IE NLLIP       R      V +Y+AE LP MN++I++N+  A  G+ K L D +VEVSFAG  GRT V      P W++Q+IF E FPP   R++I V D   + D  ++T FIDL+KI       ++GFLPT+GP+WINLYG+PR  +   L+   Q  N+   EGV++RGR+++ I                                     + D ++ G   +  N  ++T             V  K E +LLFG  +E T+I+  +G   KP++FE+SIG  GNL+D  +   S+K                +    H +     + T+  K         Y ++P++ KKPC++ I+   D   R+   N++EK+   L E I +   LI + +     + +KT + + I      +S  +       +T LD K   L   +LE M  + + +  + K+  +V E + E    V+ +   + +PQ+ +PD+FI+M+  N RVAYARI ++++++S +A + G  CG + T +LK       K    +++QA++ +YLWLG ++        LP GY  E  S       PP  + Y ++ +FQLR +++ AR +I +D +GLSDPFA++    H   + I +QT SP W++ L+ ++++ +     L  SPP VVVE++D D+    E+LG     P V +    Y   +L +  I+ G L+ G++LA F+L+++        ++GLP V+  DI ++                  +P  IRP LS +R E+L WGVR++++++++                 V++P+  I+  G  ++S  I  +   PNF       ++ LP +    PP++I   +   FG   +VG   I N +  + C
Sbjct:   68 KLLTKIHDGEVRSQNYQIAITITEARQLVGENIDPVVTIEIGDEKKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKI-------SVFHHKLIGSVLIGSFKVDLGTVYNQPGHQFCNKWALLTDPGDIRTGTKGYLKCDISVMGKGDVLKTSPKTSDTEEP--IEKNLLIPNGFP-LERPWARFYVRLYKAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQMGRTTVQKNCADPVWHEQVIFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKKIS-NEQDGDKGFLPTFGPAWINLYGSPRNHS---LMDDYQEMNEGFGEGVSFRGRILVEIAVEILSGRAQESKFSKALKELKLPSKDKDSKSSKGKDKADKTEDGKSQQASNKTNSTEVEVESFDVPPEIVPEKNEEFLLFGAFFEATMIDRKIGD--KPISFEVSIGNFGNLIDGGSHHGSKKSAESAEEDLLPLLHEGQGDVAHDVPIPMASTTHPEKPLVTEGNRNYNYLPFEAKKPCVYFISSWGDQTFRLHWSNMLEKMADFLEESIEEVRELIKISQEAPEEK-MKTVLSDFISRSSAFISEAEKKPKMLNQTTLDKKRLTLCWQELEAMCKEAKGIIQQQKKKLSVDEMIHEAQNFVEKIRFLVDEPQHTIPDVFIWMLSNNRRVAYARIASKDLLYSPVAGQMGKHCGKIKTHFLKPPG----KRPAGWSVQAKVDVYLWLGSIKHASAILDNLPVGYEAEMSSKGAGTNHPPSNLLYQEQHVFQLRAHMYQARGLIAADSNGLSDPFAKVTFLSHCQTTKIISQTLSPTWNQMLLFNDLVLHGDVKELAESPPLVVVELYDSDAVGKPEYLGATVAAPVVKLADQDYEPPRLCYHPIFCGNLSGGDLLAVFELLQVPPS----GLQGLPPVEPPDITQIYP----------------VPANIRPVLSKYRVEVLFWGVREMKKVQLLS----------------VDRPQALIECGGQGVKSCVIQSYKNNPNFSIQADAFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTI-NYLKQFLC 1090          

HSP 2 Score: 455.292 bits (1170), Expect = 1.490e-129
Identity = 261/633 (41.23%), Postives = 370/633 (58.45%), Query Frame = 2
Query: 4334 IMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMI-EDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCD--PFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            + +Y  +LE+  +F  F D  K+F L+RGK  EDD   +  DR  G FKG+ CIY                                          Q+   E    LR+ + +   +PV  ++RVYI+ A NL P+D +GKSDPYI++KLG  E++DR+ YIPK LNPVFG+  E++ TFP+ES L + IYD D +  DDLIGET IDLENR+ S H+  CG+   Y   GY  W+D   PT IL  LC+++ +  P +     ++ I ++ F  +T+  E+D    ++S E LAL+VLH W +I   G +LVPE+IETRPLY  +KPG++QG L+MWVDM+P     P  P+DI+PR+  GYELR T+  TE V L + N FT +K+ DI+VK W+K  + D Q+TDVHY SL+G+G FNWRF++ F YL AE  +V T++ +++ +++ E KTP  L +QV D   + SD  +G  +  L+ FP+ AK  ++CD   F+ +    K ++F+ K+VRGWWP   + +               VE E  LVTAEEAE NPVG  R EP PL  P RPD SF  F++P+  + Y I    K  +I  F++ + ++ + LFIY  PG+IS  IV
Sbjct: 1277 LQIYDGDLES--EFNNFEDWVKTFELFRGKSTEDDHGLDG-DRVIGKFKGSFCIYK---------------------------------------SPQDSSSEDSGQLRIQQGIPPNHPVTVLIRVYIVAAFNLSPADPDGKSDPYIVIKLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDDLIGETKIDLENRFYSKHRAICGLQSQYEIEGYNAWRDTSKPTEILTKLCKDNKLDGPYFH--PGKIQIGNQVFSGKTIFTEEDTDETVESYEHLALKVLHSWEDIPEVGCRLVPEHIETRPLYHKDKPGMEQGRLQMWVDMFPKDMPQPGPPVDISPRRPKGYELRVTIWNTEDVILEDENIFTGQKSSDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFSLEKMECKTPAVLVLQVWDFERLSSDDFLGTLEMNLNSFPRAAKSAKACDLAKFENASEETKISIFQQKRVRGWWPFSKSKELTGK-----------VEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMSPFKCLYYLIWKNYKKYIIIAFILIILIIFLVLFIYTLPGAISRRIV 1854          
BLAST of Otoferlin vs. TrEMBL
Match: G3PC42 (Otoferlin b OS=Gasterosteus aculeatus OX=69293 PE=4 SV=1)

HSP 1 Score: 1052.35 bits (2720), Expect = 0.000e+0
Identity = 661/1895 (34.88%), Postives = 1018/1895 (53.72%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSY----QPD-SSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKV---------------------ASEKEPTPENQYVHSMTQSRFAYTYDNK----YFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGK-----MPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNI-IFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK---LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESA-----------DWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGK-QEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSE--ACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            ++P S +  D+QISVT+VEAR L G N++PM  V  G+ K+ T +K  TN P+YNE+F FD  +    M + I+K+  +   N      + +G ++G F +D  ++Y+   H F+ KWA L DP+  ++G KGYVK D++V+  GD  K P   +  E  +IE NLLIP  V    R+     + IY+AE LP MNT+I++N+K A  GE K L D YV+V FAG  G+T V    Y P WN+QI+FTE FPP   R++I +RD+D V D  I T F+DL+ I   G K   GFLPT GP+W+N+YG+ RT+T   L+   Q  N+ L EGV++R RL+I +         PD S+   V +     +S T  GK E + LFG   E T+I+  +G   KP+ FE++IG  GN +D  A+                      +SE+E   +       T         ++    YFH+PY  +KPC+++ +  +D R R+F  NII+ +  +L + +     +I  EK    RR L+  +  L     + +S     +  + +T LD +  +L   ++E +  + + +  ++K+S V +K++     +  L     +PQ+ +PD+FI+MI    R+AYAR+ +++I++S++  E G  CG + T++L R+          + +Q++++IYLWLGL R  + Y  GLP G+     S        PP  + Y+ + +FQLRV+++ AR++  +D +GLSDPFAR+  S     + I  +T  P WD+ L+ +N+ +F  A + L+  PP +V+EI+D D+    EF+GR F +P V +  + Y   +    L+++ IYRG   AGE+LAAF+L+++    K      LP +               G  D ++   L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+ +L  +        +R  DK              N  + T  I+  G E E G    + T +K +  +  V      ++ ++K      ++               DWW++Y+A+I  L ++   +E     SE   D ++                 +      PDD P K  K+ K +K KK+   +PF+    +L      D L++                Y  ELE+  ++  F D   SF+L+RGK  +EDD N  + DR  G FKG++C+Y +                                      ++ +R+   + T+ +++N+   +P++ +VR+Y+I+A +LHP+D+NGK+DPYI +KLG  E++D+ENYI K LNP+FGK  ++E TFP +S L V IYDWD +  DDLIGET +DLENR+ S H+ +CGI  +Y  HGY  W+D   PT IL  LC+E  +  P Y     RV +++R F A T IEDD+G + ++ E LAL VL HW EI   G KLVPE++ETRPL  P+KPGI+QG +EMWVDM+P     P  P+DI+PRK   +ELR  +  T++V L + + FT EK+ DIFV+ W+K    D Q TDVHY S++G+G FNWRFVY FDYL AE+ IV ++K S++  DE EYK P  LN+QV D+    +D  +G  +  L++FP+ AK  + C    ++        ++F+ K+++GWWP +   +D++ +          VE E+ L+T EEAE +PVG GR EP PLE P RPD + L FL P+  +K+ I  +  W+ IKI    + L I+ALF+YN PG     +V KM G
Sbjct:   45 MEPSSGRPVDYQISVTVVEARQLIGLNMDPMVCVEIGEDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKLSVIHSKN-----LLRSGTLVGTFKLDVGTIYSQPEHQFYHKWALLSDPEDISAGCKGYVKCDVAVVAKGDTIKTPHKANESEEDDIEGNLLIPEGVP-AERQWARYYLKIYRAEGLPRMNTSIMANVKKAFIGENKDLVDPYVQVQFAGQRGKTSVQKSCYEPIWNEQIVFTEMFPPLCKRMKIQLRDSDKVNDVAIGTHFLDLRTISNDGDK---GFLPTLGPAWVNMYGSTRTYT---LMDEYQELNEGLGEGVSFRARLLICLGVEILDPSSPDISNSTDVQLEGIPNISETATGKVEEFFLFGSFLEATMIDRKIGD--KPINFEVTIGYYGNEMDGAARPKTKGKKGGGDGGEEETELIHNSSEEETDEDGDLTSVATTPPMKPVITDRMVRNYFHLPYFERKPCVYIKSWWQDQRRRLFNANIIDNVADKLEDGLNDVQEIIKTEKTYPERR-LRGVLEELSHGCSQFLSLANQDQNLSGRTKLDRERLKLCMSEVESIGQQAKAMRTQVKKSTVRDKIKLAQNFLTRLRFLADEPQHSVPDVFIWMISNGKRIAYARVPSKDILYSAIREETGKDCGKVKTIFL-RIPGKKGFGPAGWTVQSKIEIYLWLGLTRQRKDYLRGLPNGFEENKLSKGPGMPCSPPISLTYMMKQIFQLRVHMYQARSLFAADSTGLSDPFARVFFSTQSQVTEILAETLCPTWDQLLVFENVELFGEATE-LRDDPPIIVIEIYDQDTVGKAEFMGRTFAKPVVKMADEHYGPPRFPPQLEYYQIYRGNCTAGEMLAAFELLQIGPNGK----ADLPPID--------------GPTDVDRGPILPVPLGIRPVLSKYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSALIPNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSIAVPSLRKFI-------YRATDKQA------------NNFSTTGEIIVVGLEPEPGFKKMD-TVVKLDSGSDAVVKVEVSSLHRIKKFKKDDDKDGDEIEEEELDESMLDWWSKYFASIETLTEALKAQEAALSDSEDRDDMDIA----------------DGGAEIKPDDSPVKGPKRGKGKKDKKKHTIDPFEKKKPKL------DELKV----------------YSKELES--EYDNFEDWLHSFNLFRGKGGDEDDQNVTDEDRIVGKFKGSLCMYKV-------------------------------------SDEMQRDVSFESTMGMFQNIPHNDPINVLVRIYVIRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPLFGKSFDVEATFPMDSTLTVSIYDWDLVGTDDLIGETKLDLENRYYSKHRATCGITCNYAIHGYNVWRDPMKPTQILAKLCKEGKLDGPHYGP-GGRVKVENRVFMAATEIEDDNGLKRQTDEHLALTVLKHWEEIPRVGCKLVPEHVETRPLLHPDKPGIEQGRIEMWVDMFPKDMTAPGPPLDISPRKPKKFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSITGEGNFNWRFVYPFDYLMAEEKIVISKKESMFAWDETEYKIPARLNLQVWDADHFSADDFLGAIELDLNRFPRGAKSAKQCSIEMVTNEGEMPTVSIFKQKRIKGWWPFVARNEDDEFELTGK------VEAELHLLTGEEAERSPVGEGRNEPEPLEKPNRPDIALLWFLIPFKAVKHLICDQYMWLTIKIVTALLLLAILALFLYNMPG----YMVKKMLG 1780          
BLAST of Otoferlin vs. TrEMBL
Match: A0A5N4D7Q0 (Otoferlin OS=Camelus dromedarius OX=9838 GN=Otoferlin PE=4 SV=1)

HSP 1 Score: 1036.17 bits (2678), Expect = 0.000e+0
Identity = 640/1897 (33.74%), Postives = 998/1897 (52.61%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNG-KPLTFEMSIGITGNLLDDYAKVAS---EKEPTPENQY-------------------VHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLR-IPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLN-----LFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPV----------PGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIE-KLSESESDEEVTGFVLXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +S   M + IIKI  +   N      + +G ++G F +D  +VY+   H F  KWA L DP   ++G KGYVK D++V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT++++N+K A  GE K L D YV+V FAG  G+T V   +Y P WN+Q++FT+ FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RLM+ +      TS    +S   V V    P+S +  GK E + LFG   E ++I+    KNG KP+TFE++IG  GN +D  ++       KEP  E +                    V S    R   T D  YFH+PY  +KPC+++ +   D R R++  NI++ +  +L E +     +I  EK+   RR L+  +  L     + +S     +  + +T LD +  +    +LE M  + + L  ++KR  V +K+R C   ++ L     +PQ+ +PD+FI+M+  N R+AYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA+L++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D D+    +F+GR F +P V +  + Y   +    L+++ IYRG   AG++LAAF+L+++    K      LP +            N   +MD+  +  +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+  +++L  +        +R  D++     +   L      L+N G  +          E    + +L  M +     D    V                 + +  +  +    DWW++Y+A+I  + +    +E     L E E  +   G               EE         P     +  +  +KK+   +  +PS  +++ KE      +ESE+     W+                        +F+L RGK  +D+D     +R  G FKG++C+Y +                                      E   RE     T  +++ +   +P++ +VRVY+++A +LHP+D+NGK+DPYI ++LG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ I+  LC+E  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  V  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD +F+ FLNP  +IKY I  R KW++IK  +  + LL++ALF+Y+ PG     +V K+ G
Sbjct:  265 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN-----LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVP-PERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDMAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPISESCTGKVEEFFLFGAFLEASMIDR---KNGDKPITFEITIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNSSDDETDEAGDLASVSSTPPMRPQIT-DRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERR-LRGVLEELSCGCCRFLSLADKDQSHSSRTRLDRERLKSCMRELESMGQQAKTLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDTMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGK----ADLPPI------------NGPVDMDQGPIMPVPMGIRPVLSKYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHTVSSLRRFV-------YRPPDRSAPSWNTAGRLPRGCHVLYNGGPSSHPAGEVVVNMELEVPVRKLETMVKLDATSDAVIKVDVADEEKEKKKKKKGSSEEMEEEEPDESMLDWWSKYFASIDTMKEQLRQQEASGIDLEEKEEMDNTEGLKGLMKGKEKARAAKEEKKKRAQSLGP----GQVSEAPEKKKPKIDELKPSLAQVYPKE------LESEFDNFEDWLH-----------------------TFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKV-----------------------------------PLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGISQTYSTHGYNIWRDPMKPSQIVTRLCKEGKVDGPHFGP-PGRVKVSNRVFTGPSEIEDENGQRKPTEEHVALLALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKTVLALLGLLMLALFLYSLPG----YMVKKLLG 2022          
BLAST of Otoferlin vs. TrEMBL
Match: A0A5N4D7X0 (Otoferlin OS=Camelus dromedarius OX=9838 GN=Otoferlin PE=4 SV=1)

HSP 1 Score: 1022.69 bits (2643), Expect = 0.000e+0
Identity = 635/1893 (33.54%), Postives = 998/1893 (52.72%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEA-NLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNG-KPLTFEMSIGITGNLLDDYAKVAS---EKEPTPENQY-------------------VHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLR-IPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLN-----LFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPV----------PGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIE-KLSESESDEEVTGFVLXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFN-----LFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            ++P + +  D+Q+S+T++EAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +S   M + IIKI  +   N      + +G ++G F +D  +VY+   H F  KWA L DP   ++G KGYVK D++V+  GD  K P   +  +  +IE  NLL+P  V    R+     V IY+AE LP MNT++++N+K A  GE K L D YV+V FAG  G+T V   +Y P WN+Q++FT+ FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RLM+ +      TS    +S   V V    P+S +  GK E + LFG   E ++I+    KNG KP+TFE++IG  GN +D  ++       KEP  E +                    V S    R   T D  YFH+PY  +KPC+++ +   D R R++  NI++ +  +L E +     +I  EK+   RR L+  +  L     + +S     +  + +T LD +  +    +LE M  + + L  ++KR  V +K+R C   ++ L     +PQ+ +PD+FI+M+  N R+AYAR+ +++++ S +  E G  C  + T++LK L       +  + +QA+L++YLWLGL +  + +  GLP G+   +   G      PP  + Y  +  FQLR +++ AR++  +D SGLSDPFAR+        + +  +T  P WD+ L+ DN+        L+  PP +V+EI+D D+    +F+GR F +P V +  + Y   +    L+++ IYRG   AG++LAAF+L+++    K      LP +            N   +MD+  +  +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+  +++L  +        +R  D++     +   L      L+N G  +          E    + +L  M +     D    V                 + +  +  +    DWW++Y+A+I  + +    +E     L E E  +   G               EE         P     +  +  +KK+   +  +PS  +++ KE      +ESE+     W+                        +F+L RGK  +D+D     +R  G FKG++C+Y +                                      E   RE     T  +++ +   +P++ +VRVY+++A +LHP+D+NGK+DPYI ++LG  ++RD+ENYI K LNPVFGK  ++E +FP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D   P+ I+  LC+E  V  P +     RV + +R F   + IED++G +  + E +AL  L HW +I   G +LVPE++ETRPL  P+KPGI+QG LE+WVDM+P     P  P+DI+PRK   YELR  V  T++V L + +FFT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWR+++ FDYL AE+ IV ++K S++  DE EYK P  L +Q+ D+    +D  +G  +  L++FP+ AK  + C    +  A  + +     +F+ K+V+GWWPL+   ++++ +          VE E+ L+TAEEAE NPVGL R EP PLE P RPD SF+ FLNP  + +YF+ +  +W+L+K+ ++ + LL++ALF+Y+ PG +   I+
Sbjct:  265 MEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVSPDVMFDKIIKISVIHSKN-----LLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILSDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGRNLLLPEGVP-PERQWARFYVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNEQVVFTDLFPPLCKRMKVQIRDSDKVNDMAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRNYT---LLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPISESCTGKVEEFFLFGAFLEASMIDR---KNGDKPITFEITIGNYGNEVDGLSRPQRPRPRKEPGDEEEVDLIQNSSDDETDEAGDLASVSSTPPMRPQIT-DRNYFHLPYLERKPCIYIKSWWPDQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERR-LRGVLEELSCGCCRFLSLADKDQSHSSRTRLDRERLKSCMRELESMGQQAKTLRAQVKRHTVRDKLRLCQNFLQKLRFLADEPQHSIPDVFIWMMSNNKRIAYARVPSKDLLFSIVEEELGKDCAKVKTLFLK-LPGKRGFGSAGWTVQAKLELYLWLGLSKQRKDFLCGLPCGFEEVKAAQGLGLHSFPPISLVYTKKQAFQLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYGEAHELRDDPPIIVIEIYDQDTMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYRGNATAGDLLAAFELLQIGPAGK----ADLPPI------------NGPVDMDQGPIMPVPMGIRPVLSKYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHTVSSLRRFV-------YRPPDRSAPSWNTAGRLPRGCHVLYNGGPSSHPAGEVVVNMELEVPVRKLETMVKLDATSDAVIKVDVADEEKEKKKKKKGSSEEMEEEEPDESMLDWWSKYFASIDTMKEQLRQQEASGIDLEEKEEMDNTEGLKGLMKGKEKARAAKEEKKKRAQSLGP----GQVSEAPEKKKPKIDELKPSLAQVYPKE------LESEFDNFEDWLH-----------------------TFNLLRGKTGDDEDGSTEEERIVGRFKGSLCVYKV-----------------------------------PLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRVYVVRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGISQTYSTHGYNIWRDPMKPSQIVTRLCKEGKVDGPHFGP-PGRVKVSNRVFTGPSEIEDENGQRKPTEEHVALLALRHWEDIPRVGCRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIVWNTDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKTAKQC---TMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGK------VEAELHLLTAEEAEKNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKVLLLALLLLLLALFLYSVPGYLVKKIL 2022          
BLAST of Otoferlin vs. TrEMBL
Match: A0A2D0RKB5 (otoferlin-like isoform X2 OS=Ictalurus punctatus OX=7998 GN=LOC108269528 PE=4 SV=1)

HSP 1 Score: 1010.36 bits (2611), Expect = 0.000e+0
Identity = 633/1871 (33.83%), Postives = 994/1871 (53.13%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEK----EPTPENQYVHSMTQSRFA----------------YTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGY--NRECFSGKM---PPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK-LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDD-NFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            I+P + ++ DFQ+SVT++EAR L G N++P+  V  G +K+ T +K  TN P+YNE+F F+  +    M + I+++  +   N      + +G ++G F +D  +VY+   H F+ KWA L DP   T+G KGYVK DI+V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT+I++N+K A  GE K L D YV+V FAG  G+T +    Y P WN+QIIFTE+FPP   R+++ +RD D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R++T   L+   Q  N+ L EGV++R RL+I++      TS    +S   V V     +S    GK E + LFG   E T+I+  +G   KP+ FE++IG  G+ +D   K  ++K    +   E++ + + +    A                   D  YFH+PY  +KPC+++ +  +D R R++  NII+ +  +L E +     +I  EK    RR L+  +  L       ++     +     T LD +  +L   +LE M  + + +  ++K+  V +K++     ++ L     +PQ+ +PD++I+M     R+AYAR+ +++++ S++  E G  C  + T++ K L          + +QA+ ++YLWLGL +  + +  GLP G+  N+      M   PP  + Y  + +FQLRV+++ AR++  +D +GLSDPFAR+  S H   + I  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P   +  + Y   +    L+++ +YRG   AGE+LAAF+L+++    K      LP +            +   +MD    L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  I+S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+T L  +        +R  DK+     +++ + +          +    + +  S      DM    P+ D         +K + V  +  +    DWW++Y+A+I  L ++   +E  +  +E   D +  G  +        + + +    D     P +    +K             +P  +EL +     N  +ESE+     W+    +Y                       RGK  +DDD N  + DR  G FKG++C+Y +                                      ++  RE      +  ++N+   +P++ +VRVY+I+A +LHP+D+NGK+DPYI +KLG  EV+D+ENYI K LNP+FGK  +++ TFP +S L V IYDWD +  DDLIGET IDLENR+ S H+ +CGI  SY  HGY  W+D   PT IL  LC++  +  P Y     RV + +R +   T I D++G + ++ E LAL VL+HW +I   G KL+ E++ETRPL  P+KPGI+QG +EMWVDM+P     P  P+DI+PRKA  +ELR  +  T++V L + + FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRF+Y FDYL AE+ IV ++K S++  DE EYK P  LN+QV D+    +D  +G  +  L++FP+ AK  + C  D     +     N+F+ K+++GWWP I   ++++ +          VE E+ L+T+EEAE +PVG GR EP PLE P RPD +FL F+ P   I+YFI  + KW++IKI +  + L I+ALF+Y+ PG ++  ++
Sbjct:   61 IEPSAGRLMDFQVSVTVIEARQLVGLNMDPVVCVEIGDEKKYTSMKESTNCPYYNEYFVFEFHVPPDVMFDKILRVSVIHSKN-----LLRSGTMVGAFKMDVGTVYSQPDHQFYHKWAVLCDPDDITAGCKGYVKCDIAVVTKGDNIKTPHKANETDEDDIEGNLLLPEGVP-ADRQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENKDLVDPYVQVLFAGQKGKTSIQKSCYEPIWNEQIIFTEQFPPLCKRIKVQIRDADKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRSYT---LMDEYQDLNEGLGEGVSFRARLLISLAVEILDTSSPEITSSPEVQVEGVPNISENATGKIEEFFLFGAFLEATMIDRKIGD--KPINFEVTIGNYGSDVDIPTKPRTKKSKKGDGDEESELIQASSDEEVADDGELSSVSTTPPMKPVITDRNYFHLPYFERKPCIYIKSWWQDQRRRLYNANIIDHIADKLEEGLNDVQEIIKTEKAFPERR-LRGVLEELSNGCSNFLTLANKDQSQTGLTKLDREKLKLCMWELETMGQQAKAMRSQVKKKTVKDKVKLAQNFLQKLRFLSDEPQHSVPDVYIWMFSNGKRIAYARVPSKDLLFSNVEEEIGKDCAKVKTIFFK-LPGKKSFGPAGWTVQAKTEMYLWLGLNKQRKDFLSGLPNGFEENKAVKGPGMHSSPPISLIYTMKQVFQLRVHMYQARSLFAADSTGLSDPFARVFFSTHSQVTEIVNETLCPTWDQLLVFDNVELYGEASELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPTTKMSDEHYGPPRFPPQLEYYQVYRGNCTAGEMLAAFELLQIGPGGK----ADLPPI------------DGPTDMDRGPILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLSQ----------------VDRPRVDIECAGKGIQSALIPNYNKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTTLRKFI-------YRAPDKSVNSWSAMEEIVIHTEPEPAVKKMETMVKLDSASDAVVKVDM----PDDDKEGKGKKKKKKGEEVEEEQLDESMLDWWSKYFASIETLMENIKAQEAEKAEAEEREDMDADGADIKPDSNVKGNKKRKGKGKDKNKTAPGEGLADRK-------------RPKIEELKVF----NRELESEFDHFEDWLHTFNLY-----------------------RGKSGDDDDENVMDEDRLVGKFKGSLCMYKV-------------------------------------SDELYREMGIDPNMGTFQNIPHNDPINVLVRVYVIRATDLHPADINGKADPYISIKLGKSEVKDKENYISKQLNPIFGKSFDIDATFPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASSYAIHGYNVWRDPMKPTQILAKLCKDGKLDPPQYGP-GGRVKVANRVYTGPTEIMDENGLKKQTDEHLALAVLNHWEDIPRMGCKLIHEHVETRPLLNPDKPGIEQGRIEMWVDMFPKDMPAPGPPLDISPRKAKKFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLMAEEKIVISKKESMFSWDETEYKIPARLNLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTLDMILNEQDMPMVNIFKQKRIKGWWPFIARDENDEMEITGK------VEAELHLLTSEEAEKSPVGEGRNEPEPLEKPNRPDTTFLWFITPLKAIRYFICNQYKWLVIKIVLALLLLAIVALFLYSMPGYMAKKLL 1788          
BLAST of Otoferlin vs. TrEMBL
Match: A0A2D0RLD5 (otoferlin-like isoform X1 OS=Ictalurus punctatus OX=7998 GN=LOC108269528 PE=4 SV=1)

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 633/1876 (33.74%), Postives = 993/1876 (52.93%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEK----EPTPENQYVHSMTQSRFA----------------YTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGY--NRECFSGKM---PPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK-LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDD-NFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            I+P + ++ DFQ+SVT++EAR L G N++P+  V  G +K+ T +K  TN P+YNE+F F+  +    M + I+++  +   N      + +G ++G F +D  +VY+   H F+ KWA L DP   T+G KGYVK DI+V+  GD  K P   +  +  +IE NLL+P  V    R+     V IY+AE LP MNT+I++N+K A  GE K L D YV+V FAG  G+T +    Y P WN+QIIFTE+FPP   R+++ +RD D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R++T   L+   Q  N+ L EGV++R RL+I++      TS    +S   V V     +S    GK E + LFG   E T+I+  +G   KP+ FE++IG  G+ +D   K  ++K    +   E++ + + +    A                   D  YFH+PY  +KPC+++ +  +D R R++  NII+ +  +L E +     +I  EK    RR L+  +  L       ++     +     T LD +  +L   +LE M  + + +  ++K+  V +K++     ++ L     +PQ+ +PD++I+M     R+AYAR+ +++++ S++  E G  C  + T++ K L          + +QA+ ++YLWLGL +  + +  GLP G+  N+      M   PP  + Y  + +FQLRV+++ AR++  +D +GLSDPFAR+  S H   + I  +T  P WD+ L+ DN+        L+  PP +V+EI+D DS    +F+GR F +P   +  + Y   +    L+++ +YRG   AGE+LAAF+L+++    K      LP +            +   +MD    L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  I+S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+T L  +        +R  DK+     +++ + +          +    + +  S      DM    P+ D         +K + V  +  +    DWW++Y+A+I  L ++   +E  +  +E   D +  G  +        + + +    D     P +    +K             +P  +EL +     N  +ESE+     W+    +Y                       RGK  +DDD N  + DR  G FKG++C+Y +                                      ++  RE      +  ++N+   +P++ +VRVY+I+A +LHP+D+NGK+DPYI +KLG  EV+D+ENYI K LNP+FGK  +++ TFP +S L V IYDWD +  DDLIGET IDLENR+ S H+ +CGI  SY  HGY  W+D   PT IL  LC++  +  P Y     RV + +R +   T I D++G + ++ E LAL VL+HW +I   G KL+ E++ETRPL  P+KPGI+QG +EMWVDM+P     P  P+DI+PRKA  +ELR  +  T++V L + + FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRF+Y FDYL AE+ IV ++K S++  DE EYK P  LN+QV D+    +D  +G  +  L++FP+ AK  + C  D     +     N+F+ K+++GWWP I   ++++ +          VE E+ L+T+EEAE +PVG GR EP PLE P RPD +FL F++P   I+Y +    KW++IKI V  + L ++ LF+Y+ PG     +V K+ G
Sbjct:   61 IEPSAGRLMDFQVSVTVIEARQLVGLNMDPVVCVEIGDEKKYTSMKESTNCPYYNEYFVFEFHVPPDVMFDKILRVSVIHSKN-----LLRSGTMVGAFKMDVGTVYSQPDHQFYHKWAVLCDPDDITAGCKGYVKCDIAVVTKGDNIKTPHKANETDEDDIEGNLLLPEGVP-ADRQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENKDLVDPYVQVLFAGQKGKTSIQKSCYEPIWNEQIIFTEQFPPLCKRIKVQIRDADKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRSYT---LMDEYQDLNEGLGEGVSFRARLLISLAVEILDTSSPEITSSPEVQVEGVPNISENATGKIEEFFLFGAFLEATMIDRKIGD--KPINFEVTIGNYGSDVDIPTKPRTKKSKKGDGDEESELIQASSDEEVADDGELSSVSTTPPMKPVITDRNYFHLPYFERKPCIYIKSWWQDQRRRLYNANIIDHIADKLEEGLNDVQEIIKTEKAFPERR-LRGVLEELSNGCSNFLTLANKDQSQTGLTKLDREKLKLCMWELETMGQQAKAMRSQVKKKTVKDKVKLAQNFLQKLRFLSDEPQHSVPDVYIWMFSNGKRIAYARVPSKDLLFSNVEEEIGKDCAKVKTIFFK-LPGKKSFGPAGWTVQAKTEMYLWLGLNKQRKDFLSGLPNGFEENKAVKGPGMHSSPPISLIYTMKQVFQLRVHMYQARSLFAADSTGLSDPFARVFFSTHSQVTEIVNETLCPTWDQLLVFDNVELYGEASELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPTTKMSDEHYGPPRFPPQLEYYQVYRGNCTAGEMLAAFELLQIGPGGK----ADLPPI------------DGPTDMDRGPILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLSQ----------------VDRPRVDIECAGKGIQSALIPNYNKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTTLRKFI-------YRAPDKSVNSWSAMEEIVIHTEPEPAVKKMETMVKLDSASDAVVKVDM----PDDDKEGKGKKKKKKGEEVEEEQLDESMLDWWSKYFASIETLMENIKAQEAEKAEAEEREDMDADGADIKPDSNVKGNKKRKGKGKDKNKTAPGEGLADRK-------------RPKIEELKVF----NRELESEFDHFEDWLHTFNLY-----------------------RGKSGDDDDENVMDEDRLVGKFKGSLCMYKV-------------------------------------SDELYREMGIDPNMGTFQNIPHNDPINVLVRVYVIRATDLHPADINGKADPYISIKLGKSEVKDKENYISKQLNPIFGKSFDIDATFPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASSYAIHGYNVWRDPMKPTQILAKLCKDGKLDPPQYGP-GGRVKVANRVYTGPTEIMDENGLKKQTDEHLALAVLNHWEDIPRMGCKLIHEHVETRPLLNPDKPGIEQGRIEMWVDMFPKDMPAPGPPLDISPRKAKKFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLMAEEKIVISKKESMFSWDETEYKIPARLNLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTLDMILNEQDMPMVNIFKQKRIKGWWPFIARDENDEMEITGK------VEAELHLLTSEEAEKSPVGEGRNEPEPLEKPNRPDTTFLWFISPLKAIRYLVCNNYKWLIIKIVVALLLLAMLGLFLYSMPG----YMVKKLLG 1789          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: otofa (otoferlin a [Source:NCBI gene;Acc:557476])

HSP 1 Score: 593.964 bits (1530), Expect = 5.816e-178
Identity = 349/1037 (33.65%), Postives = 557/1037 (53.71%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKV------------------------ASEKEPTPENQYVH-SMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK---LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P + +  D+QISVT++EAR L G N++P+  V  G+ K+ T +K  TN P+YNE+F FD  +    M + I+K+  +   N      + +G ++G F +D  +VY+   H F+ KWA L DP   T+G KGY+K DI+V+  GD  K P   +  +  +IE NLL+P  V  + R+     V IY+AE LP MNT+I++N+K A  GE + L D YV+V FAG  G+T V   +Y P WN+QIIFTE FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ L EGV++R RL+I++      T+     S   V + P + +S +  GK E + LFG   E T+++  +G   KP+ FE++IG  GN LD  +K                         +S++E   +   V  S T        D  YFH+PY  KKPC+++ +  +D R R++  NI++K+  +L E +     +I  EK    RR L+  +  L     + V+     +  A +T LD +  +    ++E M  + + +  ++KR+ V +K++     ++ L     +PQ+ +PD+FI+M+  N R+AYARI  ++I+ S +  E G  CG +  V+L RL          + +QA+L++YLWLGL +  + +  GLP G+   +   G     +PP  + Y  + +FQLR +++ AR++  +D SGLSDPFAR+  S H   + + ++T  P WD+ L+ DN+        L+  PP +V+EI+D D+    E++GR F +P   +  + Y   +    L+++ IYRG   AGE+LAAF+L+++    +      LP +               G  D ++   L +P  IRP LS +R E+L WG+R L+RI +                  V++P++ I+ AG  I+S    ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+T+L
Sbjct:  223 MEPSAGRPVDYQISVTVIEARQLVGLNMDPVVCVEIGEDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKLSVIHSKN-----LLRSGTLVGTFKLDVGTVYSQPEHQFYHKWAMLSDPDDITAGCKGYIKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVP-SERQWARFYVKIYRAEGLPKMNTSIMANVKKAFIGENRDLVDPYVQVQFAGQKGKTSVQKSSYEPIWNEQIIFTEMFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKIANDGDK---GFLPTMGPAWVNMYGSTRNYT---LMDEHQDLNEGLGEGVSFRARLLISVAVEILDTTSPEIMSSTEVQMEPVSNISESATGKLEEFFLFGSFLEATMVDRKIGD--KPINFEVTIGNYGNQLDGVSKPVSGKKKKREGGGESDEEESELIQNSSDEETEDDGDLVSVSSTPPMKPVITDRNYFHLPYFEKKPCIYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAYPERR-LRGVLEELSTGCSRFVTLANKDQNQAGRTKLDRERLKSCMREMESMGQQAKTIRSQVKRNTVRDKLKLALNFLQRLRFLADEPQHSIPDVFIWMMSNNKRIAYARIPTKDILFSIVDEEMGKDCGKVKAVFL-RLPGKKGFGPAGWTVQAKLEMYLWLGLNKQRKDFLSGLPNGFEENKAVKGTGLQAVPPISLTYNMKQVFQLRAHMYQARSLFAADTSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDNVELYGEATELRDDPPIIVIEIYDQDTVGKAEYIGRTFAKPLTKMVDEHYGPPRFPPQLEYYQIYRGNCTAGELLAAFELLQIGPAGR----TELPPID--------------GPTDVDRGPILPVPLGIRPVLSRYRIEVLFWGLRDLKRINLAQ----------------VDRPRVDIECAGKGIQSALNQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTSL 1209          

HSP 2 Score: 475.322 bits (1222), Expect = 4.515e-137
Identity = 271/637 (42.54%), Postives = 390/637 (61.22%), Query Frame = 2
Query: 4337 MMYPCELENVKDFGGFHDPFKSFSLYRGKQ-EEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            ++Y  ELE   +F  F D   +F+LYRGK  ++DD N  + DR  G FKG++C+Y +   D    D   +                                     + +++++   +P++ +VRVY+I+A +LHP+D+NGK+DPY+++KLG  E++D+ENYI K LNPVFGK  ++E TFP ES L V +YDWD +  DDLIGET IDLENR+ S H+ +CGI  +Y  HGY  W+D + PT IL  LC+E  +  P Y     +V + +R F   T IED++G + ++ E LAL  L HW EI   G KL+PE++ETRPL  P+KPGI+QG LEMWVDM+P     P P IDI+PRK   YELR  +  T++V L + ++FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRFV+ FDYL AE+ IV ++K S++  DE EYK P  L MQV D+    +D  +G  +  L++FP+ AK  + C  D     +     ++F+ K+V+GWWP +   +++D +          VE E+ L+TAEEAE +PVGLGR EP PLE P RPD S + F+NP  +++YFI +  +W+++K   + + LL++ LF+Y+ PG     +V K+ G
Sbjct: 1284 LVYNKELET--EFDHFEDWLHTFNLYRGKAIDDDDQNIVDDDRIVGRFKGSLCMYKLPLSDEITRDVGFDP-----------------------------------NMGMFQSIPHNDPINVLVRVYVIRATDLHPADINGKADPYVVIKLGKSEIKDKENYISKQLNPVFGKSFDIEATFPMESMLTVSVYDWDLVGTDDLIGETKIDLENRYYSKHRATCGIASNYSLHGYNVWRDPQKPTQILAKLCKEGKLDGPHYGP-GGKVKVANRIFLGPTDIEDENGLKKQTEEHLALTALKHWEEIPRVGCKLIPEHVETRPLLNPDKPGIEQGRLEMWVDMFPMDVPSPGPAIDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFDYLMAEEKIVISKKESLFSWDETEYKIPARLTMQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSIDMVLNEQELPTISIFKQKRVKGWWPFVARDENDDLELTGK------VEAELHLMTAEEAEKSPVGLGRNEPDPLEKPNRPDTSLMWFMNPLKSLRYFIWHNYRWLILKTLGLMLLLLLLGLFLYSIPG----YLVKKLLG 1872          

HSP 3 Score: 62.3882 bits (150), Expect = 6.614e-9
Identity = 38/132 (28.79%), Postives = 66/132 (50.00%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSAN-IYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDA 529
            M+L V LK +      GD+  K+ FR +   S  L+   +   F + F WP+A K+D N++L +  YN ++V  ++L+G  ++    ++ E  + V + L+D+        ++ EI Y  P  GS    SD 
Sbjct:    1 MALVVYLKTVTELRGKGDRIAKVSFRGLSFYSRVLENCEDEARFEEAFRWPVASKVDGNEMLEIHIYNYSKVFTNRLIGTFRMVLQKVVEEGHLEVSDTLIDDNNTAIQTSISIEIRY-QPMDGSVRVWSDG 131          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: otofb (otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5])

HSP 1 Score: 583.948 bits (1504), Expect = 9.892e-175
Identity = 347/1034 (33.56%), Postives = 554/1034 (53.58%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSS-----KIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYA---------------------KVASEKEPTPENQYVH-SMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGY--NRECFSGKM---PPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK---LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            I+P + +  DFQISVT++E R L G N++P+  V  G +K+ T +K  TN P+YNE+F FD  +    + + I+K+  +   N      + +G V+G F +D  +VY+   H F+ KWA L DP   T+G KGYVK DI+V+  GD  K P   +  +  +IE NLL+P  V    R+     + IY+AE LP MNT+I++N+K A  GE K L D YV+V FAG  G+T V    Y P WN+QI+FTE+FPP   R+++ +RD+D V D  + T FIDL+KI   G K   GFLPT GP+W+N+YG+ R++T   L+   Q  N+ L EGV++R RL++++       SS        V V     +S+  AGK E + LFG   E T+I+  +G   KP+ FE++IG  G+ +DD                       + +S++E T + + V  S T        D  YFH+PY  +KPC+++ +  +D R R++  NII+ +  +L E +     +   EK    RR L+  + +L       +      +  + KT LD +  +    +LE M  + + +  ++K+  V +K ++    ++ L     +PQ+ +PDI+I+MI    R+AYAR+ +++I++S++  E G  CG + T++ K L          + +QA+ ++YLWLGL R  + +  GLP G+  N+      M   PP  + Y  + +FQLRV+L+ AR++  +D +GLSDPFAR+  S H   + I  +T  P WD+ L+ DN+        L+  PP +V+EI+D D+    +F+GR F +P   +  + Y   +    L+++ +YRG   AGE+LAAF+L+++    K      LP +               G  D ++   L +P  IRP LS +R E+L WG+R L+R+ +                  V++P++ I+ AG  I+S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+T+L
Sbjct:  162 IEPGAGRPMDFQISVTVIECRQLVGLNMDPVVCVEIGDEKKYTSMKESTNCPYYNEYFVFDFHLPPDVIFDKILKLSVIHSKN-----LLRSGTVVGTFKMDVGTVYSQADHQFYHKWAILCDPDDITAGCKGYVKCDIAVVAKGDNIKTPHKANETDEDDIEGNLLLPEGVP-AERQWARFYLKIYRAEGLPKMNTSIMANVKKAFIGENKDLIDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIVFTEQFPPLCKRMKVQIRDSDKVNDVALGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRSYT---LMDEYQDLNEGLGEGVSFRARLLVSLAVEILDTSSPEVMCSTEVQVEGVPNISDNAAGKIEEFFLFGAFLEATMIDRKIGD--KPINFEVTIGNYGSEVDDTPTKPKSKKSKKGDGDDEESELIQGSSDEEVTDDGELVSVSTTPPMKPVITDRNYFHLPYFERKPCIYIKSWWQDQRRRLYNANIIDNIADKLEEGLNDVQEIFKTEKAFPERR-LRGVLEDLSHGCSNFLELANKDQNQSGKTKLDRERLKSCMRELENMSQQAKTMRTQVKKKTVKDKFKQAQIFLQKLRFLADEPQHSVPDIYIWMISNGKRIAYARVPSKDILYSNVEEETGKDCGKVKTIFFK-LPGKKGFGPAGWTVQAKTEMYLWLGLNRQRKDFLSGLPNGFEENKAVKGPGMQSAPPISLIYTMKQIFQLRVHLYQARSLFAADSTGLSDPFARVFFSTHSQVTEILNETLCPTWDQLLVFDNVELYGEACELRDDPPIIVIEIYDQDTVGKADFMGRTFAKPITKMSDEHYGPPRFPPQLEYYQVYRGNCTAGEMLAAFELLQIGPGGK----ADLPPID--------------GPTDMDRGPILPVPIGIRPVLSKYRIEVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGIQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSHAVTSL 1145          

HSP 2 Score: 472.241 bits (1214), Expect = 3.136e-136
Identity = 266/632 (42.09%), Postives = 383/632 (60.60%), Query Frame = 2
Query: 4352 ELENVKDFGGFHDPFKSFSLYRGKQEEDDD-NFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            ELEN  +F  F D   +F+LYRGK  +DD+ N  + DR  G FKG++C+Y +   D    +   +                                     + +++N+   +P++ +VRVY+I+A +LHP+D+NGK+DPYI +KLG  E++D+ENYI K LNPVFGK  ++E TFP +S L V +YDWD +  DDLIGET IDLENR+ + H+ +CGI  SY  HGY  W+D   PT IL  LC++  +  P Y     RV + +R +   T IED++G + ++ E LAL VL+HW ++   G KLVPE++ETRPL  P+KPGI+QG +EMWVDM+P     P P +DI+PRK   +ELR  +  T++V L + + FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRF+Y FDYL AE+ IV ++K S++  DE EYK P  LN+QV D+    +D  +G  +  L++FP+ AK  + C  D     +     N+F+ K+++GWWP +   ++++ +          VE E+ L+T EEAE +PVG GR EP PLE P RPD + L FL P   IK+ +    KW++IKI V+ + L ++ LF+Y+ PG     +V K+ G
Sbjct: 1236 ELEN--EFEHFEDWLHTFNLYRGKSGDDDEQNASDEDRLIGKFKGSLCMYKVPMTDDMGREMGIDS-----------------------------------NMGMFQNIPHNDPINILVRVYVIRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPVFGKSFDIEATFPMDSSLTVSVYDWDLVGTDDLIGETKIDLENRYYTKHRATCGITASYAIHGYNVWRDPMKPTHILAKLCKDGKLDPPQYGP-GGRVKVANRVYTGPTEIEDENGLKKQTDEHLALAVLNHWEDMPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPKDMPAPGPALDISPRKPKKFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLMAEEKIVISKKESMFSWDETEYKIPARLNIQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCTIDMVLNEQEMPMVNIFKQKRIKGWWPFVARDENDELEITGK------VEAELHLMTGEEAEKSPVGEGRNEPEPLEKPNRPDTTLLWFLMPLKAIKHLVCNSYKWLIIKIVVVLLLLAMLGLFLYSMPG----YMVKKLLG 1819          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: fer1l6 (fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GENE-070912-312])

HSP 1 Score: 499.59 bits (1285), Expect = 4.552e-146
Identity = 322/1042 (30.90%), Postives = 509/1042 (48.85%), Query Frame = 2
Query:  761 ISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGD-KPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIA----IKTSYQPDSSKIGVDVRPCNPVSNTVAGK---------------------------REMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEK-------EPTPENQYVHSMTQSRFAYT-------------YDNK-YFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRS--NVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGK---MPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLV 3712
            IS+ I EAR L G NI+P   +  G +K+ + +K  TN+PFYNE+F FD    +    + +IK+       +V+  +I     +G F ID  +VY   GH F  KWA LIDP   ++G KG++K DI V   GD  P+     D EE   IE N L+P    +  R      V +Y+AE LP MN++I++N+  A   +  AL D YV VSF    GRT        P WN+Q++F E FPP   RL+I V D   + D  I T +IDL +I       ++GFLPT+GP+WIN+YG+ R  T   L+  +Q  N+ + EGV+YRGRL I     I T      S   + +   +      AGK                            E ++LFG ++E T+I+  +G   KP++FE +IG  GN +D  A  A++K        P  E      + + + A +             + N+ Y+++P   +KPC+ +    ED   R+   N+++++    + +   T++    E                I S+EK V    +C      TMLD K   L + +LE M +++     E KR    + E ++E   L + +   + +PQ+ LPDIF++M+  N R+AYARI AR +++S    EKG  CG ++T++LK       K   ++ +QA++ +YLWLG   +       LPEG+     S +     P+ + Y D   FQLR +++ AR +I +D++GLSDPFAR+    H   + I  QT +P W++ L++D +  +     L   PP + +E++D D+    E+LG     P V +  + YT   L +  ++ G+L+ G+IL AF+L+E+    K      LP                Y + + +   +P +IRP L  +R E+L WG+R+L++++                +  V++P++ I+ AG  + S  I  +   PNF   +   ++ LP      PP+ I   +   FG   +VGN  I NL+
Sbjct:   38 ISINITEARQLVGENIDPSVVIEIGDEKKQSSVKEGTNAPFYNEYFVFDFFAHQEIFFDKVIKL-------SVMHSKIMKSYCIGTFKIDVGTVYNQPGHQFTNKWAALIDPNDISTGVKGHLKCDICVTGKGDVSPRSQKFSDAEEQ--IEKNPLVPEGFPSM-RPWARYYVKVYRAEGLPRMNSSIMANVTKAFVSDNTALIDPYVVVSFFSQVGRTSTQKSTADPVWNEQVVFKEMFPPLCRRLKIQVLDEGSMNDVAIGTHYIDLCRIS-NDQDGDKGFLPTFGPAWINIYGSARNST---LVDDNQEMNEGIGEGVSYRGRLYIQLAVEILTGGAESKSMFSLKLPSKDAKGGKTAGKDPKAGTGGADTSFIVGNLVFVKVSEENMENFILFGAMFEATMIDRRIGD--KPISFEFTIGNCGNFIDGAAPPAAKKRGERGFDHPGQEGAMTTPLLEGQAALSCKSTTRPEKPHTGHGNRVYYYLPISTQKPCIHVQCSWEDRTYRLHHSNMLDRI----AFLFVSTAYYCGQE---------------FIASVEKKVK--DNCL-----TMLDKKRLTLCKQELESM-IEVAGTITEPKRKVLTIKEMLQESRKLTQKIRFLVEEPQHTLPDIFVWMLSNNKRLAYARIPARNLLYSENVVEKGKDCGKISTLFLKPPG----KRGATWAVQAKVDVYLWLGKCTESSNMLKNLPEGFEIHGVSSEESGGAPEIVLYKDHHEFQLRAHMYQARGLIAADNTGLSDPFARVSFQSHTHVTAIINQTLTPTWNQMLMMDKLSLHGMLTELAQEPPLITIEVYDDDALGKPEYLGSTVAVPVVKLAEEPYTAPSLHYSPLFCGSLSGGDILGAFELIEVPKSGK----HSLPP---------------YDDPEGSIYPVPSYIRPVLRKYRIEVLFWGLRELKKVQ----------------LLTVDRPQVFIECAGKGVSSSVIQSYKSNPNFSMIVDAFEVELPEDEYLHPPLTITVVDWRAFGRSTLVGNHVINNLI 997          

HSP 2 Score: 423.705 bits (1088), Expect = 1.009e-120
Identity = 226/512 (44.14%), Postives = 322/512 (62.89%), Query Frame = 2
Query: 4691 VDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVT 6217
            V+ ++RVYI+ A NLHP+D +GK+DPYI++KLG   ++DR+NYIPK LNPVFG+  E++ +FP+ES L + IYD+D +  DDLIGET IDLENR+ S H+  CGI   Y   GY  W+D   PT +L  LC+++ +  P +     R+ I ++ +  +T+  D+D   ++S E LAL+VLH W E+   G KLVPE+IETR LY+ +KPG+ QG ++MWVD++P     P  P+DI+PRK  GYELR  +  TE V L + NF T +++ DI+VK W+K  + D Q+TDVHY SL+G+G FNWRFV+ F YL AE  +V +++ +++ +D+ E K P  L MQV D   + SD  +G  +  L  FP+ AK  + C    L E+    ++F+ K+ +GWWP I + +               VE E  LVTAEEAE NPVG  R EP PLE P RPD +F  F+NP+    + I    K  +I   ++ +  L +AL  Y  PG++SN IV+
Sbjct: 1225 VNVLIRVYIVSASNLHPADPDGKADPYIVLKLGKTVIKDRDNYIPKQLNPVFGRSFEIQASFPKESLLKILIYDYDVIGGDDLIGETQIDLENRFYSRHRAMCGIPSEYAIDGYNAWRDCIKPTDLLIKLCKDNRLDSPRF--TPGRITIGEKVYTGKTVFADED-QMVESYEHLALKVLHRWEEMPGVGCKLVPEHIETRALYIKDKPGLDQGQVQMWVDIFPMDMPHPGPPVDISPRKPKGYELRIIIWNTEDVILEDTNFITGQQSSDIYVKGWLKGLEDDGQETDVHYNSLTGEGNFNWRFVFPFHYLPAEKLVVVSKRENIFSLDKTEQKLPAVLVMQVWDFERLSSDDFLGSVELDLHGFPRGAKTAKDCKMEMLKESNDNISIFQQKRSKGWWPFIKSEELTGK-----------VEAEFHLVTAEEAEKNPVGRARKEPEPLEKPNRPDTTFSWFVNPFKCFFHLIWKNYKKYIIIALLLLILALFLALLFYTLPGALSNKIVS 1722          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: fer1l4 (fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GENE-130530-815])

HSP 1 Score: 377.481 bits (968), Expect = 1.822e-105
Identity = 251/705 (35.60%), Postives = 374/705 (53.05%), Query Frame = 2
Query: 4253 KELFLKEEPDNLRMESEY-VTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYD----KLTDRVDIDDRSFFAETMIEDDDGSQ---IKSLEPLALEVLHHWHEI----VPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCD-PFQLSEACAKFNLFRNKKVRGWWPLI----------------------------------YNPKXXXXXXXXXXXXXXCVELEME--LVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVT 6217
            KE+  KEE D + +E E        I  + +Y  ELEN  +F  F D   +F +Y+GK   +D++ ++ DR  G +KG+  IY I  E+ E+ +D                                         ++ + +   +P+  + RVY++KA NL P+D NGK+DPY++VK+G +++  +E YIPK L+PVFG+  EL V+FP E+ L + I+D D +  DD+IGET IDLENR+ S H+  CG+   Y   GY KW+D R P+ IL  LC ++ +P P Y     K+ +++       F E +++ +  ++    +  E  AL VL  W E+    V    LVPE++E R L  PEKPG+ QG L MW+DM+P     P P++I PR  + YELR  +  T+ V L +VN FT E + DI+VK W+K  D + Q+TDVH+ SL+G+G FNWRFV++FDYL  E  IVY +K S++ ++E E++    L +QV D   I S+  +G  + RL+   + AK    C       +A  +F++FR+K+++GWWPLI                                    P+D    +  G       ++E E  LVTAEEAE NPVG  R EP PL+ P RP  SF  F+NP  T  +FI  + K  +I + ++ +  L + L +Y  P  IS  IV+
Sbjct: 1228 KEVKYKEEDDAVVVEIEPPAPKRKKISTLKLYKSELEN--EFSQFMDWLHTFPIYKGKANLEDEDDDDSDRIMGKYKGSFLIYPISSEEQEEEEDI--------------------------------------DFQITRGIPKNSPIKVLTRVYVVKATNLAPADPNGKADPYVVVKIGQQQLDSKERYIPKQLHPVFGEVFELTVSFPLETELNIIIFDHDLVGSDDMIGETRIDLENRFYSRHRAGCGLALYYDKDGYNKWRDSRKPSAILADLCRKNGIPSPEYRDTEVKVLNKIFKIPNEAFPEELLKKNKKTEEDYAEMDEHRALSVLQRWAEMREFTVGACPLVPEHVEVRSLLNPEKPGLPQGYLHMWIDMFPVDVPPPPPVNIKPRLPVSYELRVIIWNTDDVVLDDVNPFTGEPSSDIYVKGWIKGLDDEKQETDVHFNSLTGEGNFNWRFVFHFDYLPTEKEIVYKKKESIFSLEESEFRQHAVLVLQVWDYDRIGSNDFLGSIELRLNDMVRAAKSSELCSVKMAKDKASPRFSIFRSKRMKGWWPLIKLKSQEDIEREEREREMEKKNKKKKKKKQSKRGKMKPEDLQFVDSTGNTFLLMGKVEAEFQLVTAEEAEKNPVGKARKEPEPLDKPNRPKTSFNWFVNPMKTFVFFIWKKYKKYIIVLVILAILALFLFLILYTLPTHISQLIVS 1892          

HSP 2 Score: 363.229 bits (931), Expect = 6.544e-101
Identity = 244/839 (29.08%), Postives = 402/839 (47.91%), Query Frame = 2
Query:  713 LPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDK---PKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAI--------------------------KTSYQPDSSK-----------------------------IGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVAS---------------------EKEPTPENQYVHSMTQSRFAY--TYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGK---------MPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTR 2959
            L KH    + K++ FQ++V ++EA+ L G NINP   +  G +K+ T  +  TN PFYNE F F+   ++  + + +I+I  + K         F    +G F ID  +VY    H F++KWAP+ DPK   SG KGYVK  +SV+  GD       P A    +N +IE NLL+P  ++   R   +  + IY+AEDLP MN   + +    + G+ K   D YV+V+FAG  G T VV+   +P+WN+QI F E+FPP   R+++ + D+  + D  ++T F+DLQ+I    +    GF PT+GPSW+NLYG+P+  T   +    Q  N+ L++G+ YRGR+ +++                          K +++  S K                             + V+V   +P+     G++E +LLF   +E T+I+  +G   K +TFE+SIG  G   D   K                        E+E         S+T  R A    YD  +  I    +KPC+++    EDH  R    N + K+   L   I +   L+   ++  A+  L   ++  + + ++  S +   R  A+   LD      I+ ++  +  +   +   + R  V +K+ +   ++K +     +PQ  LPD+F++M+    RVAYARI A  ++ S +  E+G  CG ++T+Y+K     L +      I A+L++Y+WLG+ +  +     LP  + R  + G          MPP  +   D   FQLR +++ AR +I +DD+GLSDPF +++ S     + + T+ +
Sbjct:  214 LSKHELAAAPKVKSFQVNVNVIEAQNLVGVNINPAVYITVGHEKKRTATQKSTNCPFYNENFMFEFQETQDVLFDKVIEISVVHKKTLA-----FLMTRIGTFKIDISTVYQQPDHRFYQKWAPITDPKDTRSGVKGYVKCTLSVMMKGDSMNMASLPPA--TSQNEDIERNLLLPKRMA-AERPWAKFLLKIYRAEDLPSMNAGFLGSFSKMM-GDKKVFIDPYVQVTFAGQQGETSVVSNTNAPEWNEQISFIEQFPPLARRIKVQILDDSNMGDVAVATHFLDLQQI---SNPNRNGFNPTFGPSWVNLYGSPQNSTLRDI---HQDLNEGLSDGIFYRGRVQLSLSVEIYSSPTTAVIENKSSLSIKSPLSKLTFKRKSRKSREKSKESAGAQAASGPAEESEASEVPEAVTVEVEEIHPLPENFVGEKEEFLLFASFFEVTMIDPSIG--SKFVTFELSIGNYGKTADVVVKSKKSGSREDLSEDRQGLLESDDELEREEPAAGPLDKSVTAPRRAQPTEYDGSFSCISLLREKPCIYVWNYFEDHTFRYHNCNWLSKMADRLEYGIDEVEMLLKRPRS-NAKERLMEVLLEFVSTCKQYSSSLDRKR-QARPNPLDKHRSTFIKRNIIILAKQALRVRRRVTRRTVRDKLADVRRILKRIHFLTKEPQSTLPDVFLWMMSGGKRVAYARIPAHTVLFSLVEEERGKDCGKVSTIYMKTPGGPLGE------IFAKLEVYMWLGVTKYSKNCVTSLPAEF-RPVYEGATFGTPLPPNMPPTKLAVEDSRYFQLRAHIYQARGIIAADDNGLSDPFTKVVFSTQCQVTQVTTKKQ 1026          

HSP 3 Score: 69.707 bits (169), Expect = 4.014e-11
Identity = 36/132 (27.27%), Postives = 68/132 (51.52%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAF 532
            MS++V LK +       D+ ++L FRD   K+  L+      F + F WP   K+ K+++L +  YN++R+  ++LLG L ++  +++    + +RE L D    +TDI V  ++ Y      +  +  + F
Sbjct:    1 MSITVYLKTIYNLPGKYDRKVELSFRDFTHKTKILQCENVAIFKENFRWPHYGKIQKDEVLTISVYNSSRMFSNRLLGKLVVSLQHVVTAGRLVLREPLTDSNYSLTDIYVELDVRYHPLQGAAGEWSGEDF 132          

HSP 4 Score: 60.077 bits (144), Expect = 3.533e-8
Identity = 57/235 (24.26%), Postives = 103/235 (43.83%), Query Frame = 2
Query: 3347 IPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGS-AINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKE 4048
            IPE +RP L  FR E+L WG+R L+R+                 +F V +P++ ++ +G  IES +I  +   PNF++ +   D+    + +F                   + NC+I ++V  ++ +     + + +T +  ++V S++L             G   +D    IN L           VTAP+    +K + +  +  E E  DWW++YYA++ +L      KE
Sbjct: 1060 IPEGVRPVLKKFRIEVLYWGLRDLKRV----------------NLFEVEKPQVRMECSGQLIESGEIESYKQDPNFKEVVKHFDVVRNDAVKF-------------------MTNCSIMHVV--HKTNWPRAKKPVKRTPL--QTVVSMDL------------RGLPLKDTKIPINPLN---------LVTAPLKAVTKKEEELEEEEPEKEELDWWSKYYASLAELEKEVKYKE 1234          
BLAST of Otoferlin vs. Ensembl Cavefish
Match: dysf (dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive) [Source:ZFIN;Acc:ZDB-GENE-070501-1])

HSP 1 Score: 341.273 bits (874), Expect = 4.240e-94
Identity = 203/478 (42.47%), Postives = 276/478 (57.74%), Query Frame = 2
Query: 4700 VVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGS-QIKSLEP-LALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAED-CIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKF-NLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPM---PLEAPMRPDGSFLSFLNPWNTIKYFIKY 6109
            +VRVYII+A NL P D NGK DPY+ + LG K V D +NYIP TL PVFGK  EL  + P E  L + +YD+D L+KD+ IGET IDLENR+LS +    G+  SY   G  +W+D   PT +L+ LC+  N  LPIY +  DRV      + A  + E    S  +  LE  LAL VL         + LVPE++ETRPLY P +P I+QG L+MWVD++P     P  P +ITPRKA  + LRC +  T  V L +V+  T E+  DI+VK WM   + + QKTDVHY+SL G+G FNWRF++ F YL AE  C +  ++  + +D+ E K P  + +Q+ D+     D  +G  +  L+   +PAK    C    LS    K  +LF  K V+GWWP + + + E             VE+ +E+V+ +E +  P GLGR EP     LE P RP+ SFL F +P+ T+K FI Y
Sbjct: 1489 LVRVYIIQAFNLQPKDANGKCDPYVKITLGKKSVNDHDNYIPCTLEPVFGKMFELTCSLPLEKDLKIMLYDYDMLSKDEKIGETVIDLENRFLSRYGARSGLPQSYCVSGVNQWRDQLKPTQLLQRLCQRRNYKLPIYKQ--DRVYFRGHEYTAADLDEAKQPSPHLGPLEERLALLVLRR-------QGLVPEHVETRPLYSPLQPEIEQGRLQMWVDIFPKSLGPPGPPFNITPRKAKKFFLRCIIWNTSDVILDDVS-VTGERMSDIYVKGWMHGHEGNKQKTDVHYRSLGGEGNFNWRFLFPFHYLPAEQLCTIDKKEHFWSLDKAESKIPPKITIQIWDNDKFSFDDYLGCLEMDLNHMLRPAKSPEKCGLELLSRTQDKLVSLFEQKTVKGWWPCVCDKEGEKILAGK-------VEMSLEIVSEQEQDERPAGLGRDEPNMNPHLEDPQRPETSFLWFSSPYKTLK-FINY 1948          

HSP 2 Score: 224.172 bits (570), Expect = 4.027e-58
Identity = 191/685 (27.88%), Postives = 316/685 (46.13%), Query Frame = 2
Query:  734 QSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTN--EGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEG--KALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVK-DETISTIFIDLQKIMYTGSKEEE----GFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQA---RRYLKTSIINLIPS-IEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKR---SNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGY 2740
            + LK+   Q+ V I+E R L G NI P+ +V  G Q + T IK + N+PF++E F  +   +  ++ +  I I          ++ + T  V+GEF +      +     H+  RKW  L DP   ++G +GY+K  + VL AGD+P     +  +E  +IEANLL P  ++    +     + +Y+AEDLP M+   +  +K  +  +   K L D  VE++FA       V              F++ FP    ++RI + D D    ++ I T  + + KI   G + E     GFLPT+GP ++NLYG+ R F  T      +  N    EGVAYRGR+++ + T       +   D++P + +      ++  Y LF   Y  T + +        + FE+SIG  GN  D      +            S TQ   A      Y+++P+KN KP + + ++ ED  PR      IE L   LS +    S+L  ++  +Q+   +  L+ +++ L+   I      +         T LD   +RL +++L+    +++  AL LK    + +   + +     + L     +PQ  LPDI I+M+Q + RVAY RI A E++ S      G  CG + TV++K              I AQL++ +W GL  D++ +
Sbjct:  168 KHLKLYFIQVRVRIIEGRQLPGVNIKPVVKVTVGGQTKRTRIK-KGNNPFFDETFFLNFFETPADLFDEPIFITVFD------SKSLRTDSVIGEFKVMCACFLSVLFGRHAILRKWLLLADPDDLSAGARGYLKASMFVLAAGDEPPTDKKEGVQEKEDIEANLLRPAGLT---LRGANFTLKVYRAEDLPQMDDAFMDGMKQFLGFDSNRKNLVDPLVEINFAVLLTHVHVP-------------FSQ-FPSMCEKMRIRILDWDRASHNDVIGTTHLCMSKICAPGGEIEVDDSLGFLPTFGPCFVNLYGSLREF--TAFSDPHEALNLGKGEGVAYRGRVLLELNTKLCERVEQRVEDIQPDDLLVVEKFMRKRKYSLFAAFYSATHLQD----VDDAIQFEVSIGNYGNKFDCTCLPLA------------STTQYSRAVFDGCHYYYLPWKNVKPVVVLSSEWEDISPR------IEALNMLLSIVDHLESNLKLVQLELQSGGDQDDLEQTVVKLLDDVIADCSEELPEFDNWPCVTPLDKSLRRLRKVNLK----QIEQAALTLKHGPETELSSVLEQAEDWAQRLRSLAEEPQNSLPDIVIWMLQGDRRVAYHRIPAHEVLFSQGY--CGKHCGQLQTVFMKYPQGG----GGCTKIPAQLRVKVWFGLAADVKHF 794          

HSP 3 Score: 155.606 bits (392), Expect = 3.251e-37
Identity = 115/431 (26.68%), Postives = 197/431 (45.71%), Query Frame = 2
Query: 2822 SMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNI-IFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLP--TVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGD-STIVKEVIEKLSESESD-EEVTGF 4099
            +++ LR YL+ AR+++  D    SDPFA +       K+       +P WD+TLI   + IF  A +V + SPPN+VVE++D D+   +EF+GR  CQP +       ++ +L W+ I +    AGE+LAAF L+  D    K ++  +P   V ++  +            + N   +P  I+P L     EIL WG+R L                K F +  V  P + ++  G  ++S  I +    PNF+ N +F+D+RLP    + PP+ I   ++  FG K +VG C I +L + ++C                                       E+++    NE  D   + P  DV       ++  +P++   ++ E  DWW+++YA+ G+     + +++ ++ L   E + E+V GF
Sbjct: 1065 TLYHLRCYLYQARDLLAMDKDSFSDPFAIVSFLHQSQKTVTVRNNLNPTWDQTLIFYELEIFGDA-EVTEKSPPNIVVELYDQDTYGTDEFMGRSVCQPSL------VSSPRLAWYPILKNGKEAGELLAAFQLIRRD----KPSIHRIPGQEVGNVSVLYDTDLPCPPPLREPNIFMVPLNIKPVLQRTAIEILAWGLRNL----------------KSFQLASVTSPSLQVECGGRMVQSCVIRNTKKNPNFDINTLFIDVRLPREELYMPPLVIKVIDNRQFGRKPVVGQCTIRSL-EEFRCQP-------------------------------------ESQEAEPPNEEFDEVPQTPRDDVLI----DIDDKEPLISGQDD-EFMDWWSKFYASTGETKKCGSYLEKGLDTLQVYERELEKVEGF 1425          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008905.1 (pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 gene:ENSPMAG00000008043.1 transcript:ENSPMAT00000008905.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 409/1317 (31.06%), Postives = 660/1317 (50.11%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSY----QPD---SSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKV--------------------------ASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKM--KVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYM-IQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFS-GKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIK-KMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDY-YQCDQVD----NFREIDKTTIDE-RSVKSLNLFNAGNDTEGILNEGFENEDGSAIN---------ELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESA--DWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIY 4498
            +DP + K + +Q+SV I+EAR L G N++P+  V  G++K+ T  K  TN P+YNE+F FD       M + IIK+  +   N      I +G ++G F +D  +VY+   H F+ KWA L DP   T+G KGYV  DI+V+  GD  K P    + +  +IE NLL+P  +    R+     V IY+AE LP MNT I++N+K A+ G+ + L D YV+VSFAG  G+T V   +Y P WN+Q++FTE FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT+GP+W+N+YG+ R +T   L+   Q  N  L EGV++R RL++ I         P+   +++I V+  P +    + +GK E + LFG   E T+I+  +  + K ++FE+SIG  GN LD   K                            ++     ++    S T S    T D +YFH+PY  +KPC+++ +   D R R++  NII+K+  +L E I      + +E+    RR L+ ++  +     + ++          +T LD    ++   +LE+M  + KL      +  +    +    +TL +     MA PQ  +PDIFI+M + +  RVAYARI A++I++S +  E G  CG + T++L RL    +  +  + +QA+L+ YLWLGL +  + +  GLP G+  +      +PP  ++Y   S F+LR +++ AR++  +D +GLSDPFAR+I S H   + +F +T  P WD+ L   ++     P  L+  PP VV+E+FD D+    EF+GR   +P V I  + Y   +    L ++ IYRG + AGE+LA+F+L++            +P   + K    S +ND   G +    + +P+ IRP L+ +R E+L WG+R L+R+++                  V++P++ I+ AG  I+S  I D+   PNF   + F ++ LP +  F PP+ I   +   FG   +VG+  +T+L  + +     D      RE + TT +  R V+ L      +  E ++    E   G  +N          L  +   +  P  T    G   K K   P+  E + +  DWW++Y+A+I  L + + ++   E   E  + E V G       ++  +     +                              + + K+  LK++P +L++E            + +Y  ELE   +F  F D   +F+LYRGK  ++DD  +  +R  G FKG+ C+Y
Sbjct:    8 VDPTAGKPQSYQVSVMIIEARQLVGLNMDPVVIVEVGEEKKQTSQKESTNCPYYNEYFVFDFHTPPNMMFDKIIKLSVIHSKN-----LIRSGTLVGTFKLDVGTVYSQPDHRFYHKWAVLTDPDDITAGIKGYVNCDIAVVGKGDNIKTPHKSVDNDADSIEGNLLLPEGIP-ADRQWARFFVRIYKAEGLPKMNTAIVANVKKALMGQERDLVDPYVQVSFAGQKGKTSVQRSSYEPVWNEQVVFTELFPPLCRRMKLQIRDSDKVNDTAIGTHFIDLKKICNDGDK---GFLPTFGPAWVNMYGSTRNYT---LMDEHQELNDGLGEGVSFRARLLLGISMEILDITSPELSTNTEISVESIP-HVADESCSGKMEEFFLFGAFLEATMIDRKI--SDKLISFEISIGNYGNSLDGLNKSNILDRSDDEDEYDEGDEDDETELLNDETDDAEMDDDTSGSSTTPSYKPETNDRQYFHMPYYEQKPCVYVRSAWHDQRRRLYNSNIIDKIADKLEEGISDVLETMKMERPHPERR-LRGALEEMSVGCSRFLTLANKDPSAFGRTRLDRDRLKICMRELEQMGPQAKLGRARTRIHTAPHSTRHTTSSTL-RSTAALMAAPQDSIPDIFIWMLVNKTKRVAYARIPAKDILYSIVEEETGKDCGKVKTLFL-RLPGKRVFGSGGWTMQAKLEAYLWLGLNKQRKDFLTGLPSGFEEKKIGVTGVPPSVLNYHKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLQFQDVYMYGEPRELRDDPPMVVIEVFDQDTVGKAEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPVTAGELLASFELLQ------------VPPADNCKFPPVSGLNDTDRGPI----IPVPKGIRPVLAKYRIEVLFWGLRDLKRVQLQS----------------VDRPRVDIECAGKGIQSVVIADFNKNPNFSHLVKFFEVDLPENELFHPPLNIRVVDCRAFGRYILVGSQTVTSLRKFIFHTTGPDMGRQGSREYNNTTCEPIRMVRPLCTSRRYSAIEAVIA---EMPSGPIVNLTVLLSLDSWLNGLLSFEGEPGATQ---GKKSKKKKTEPEDAERDESVLDWWSKYFASIEMLQEQSRLQTPGEDAVEGATAEPVQGLSAICSILSKYNKNSSAESPRKALQF---------------------HKAADKDKQLKKKP-HLQVEE-----------LKVYDKELE--AEFDNFEDWLHTFNLYRGKTSDEDDILDE-ERVVGRFKGSTCVY 1232          

HSP 2 Score: 476.093 bits (1224), Expect = 1.702e-138
Identity = 251/528 (47.54%), Postives = 347/528 (65.72%), Query Frame = 2
Query: 4661 LYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            +++ +   +P++ +VRVYI++A +LHP+D+NGK+DPYI++KLG  EV+D ENYI K LNP+FGK  ++E TFP ES L VQ+ DWD +  DDLIGET IDLE+R+ S H+ +CGI   Y  HGY  W+D   PT IL  LC+++ V  P Y     RV + +R F   T +EDD G + ++ E LAL+VLH W EI   G KLVPE++ETRPL  P+K GI+QG LEMWVDM+P     P  P+DI+PRK   YELR  +  T++V L +  F T EK  DI+V+ W+K    D Q TDVHY SL+G+G FNWRF+Y FDYL AE+ IV ++K S++  DE EYK P  L +QV D+    +D  +G  +  L++FP+ AK  + C  +  ++  +    ++F+ K+V+GWWP +   ++++ +          VE E+ L+TAEEAE NP GLGR EP PLE P RPD SF+ FLNP  +IKY I +R KWI+IK+ V  + L+++ LFIYN PG     +V K+ G
Sbjct: 1252 MFQGIPTNDPINVLVRVYIVRATDLHPADINGKADPYIVIKLGKTEVKDNENYISKQLNPIFGKSFDIEATFPMESMLTVQVMDWDLVGMDDLIGETKIDLESRYYSRHRATCGIAQQYAVHGYNTWRDPMKPTQILAKLCKDNKVDGPHYGP-GGRVKVANRIFNGPTEMEDDSGHKKQTEEHLALKVLHSWEEIARVGCKLVPEHVETRPLLHPDKTGIEQGRLEMWVDMFPKDMPHPGPPVDISPRKPKSYELRIIIWNTDEVILEDDAFMTGEKMSDIYVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFIYPFDYLVAEEKIVISKKESLFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKSSKQCTLNMLKMDGSVPMISIFKLKRVKGWWPFVSRDENDEQELTGK------VEAELHLLTAEEAEKNPAGLGRNEPDPLEKPNRPDTSFIWFLNPLKSIKYVICHRYKWIIIKLVVALLMLVLLGLFIYNMPG----YMVKKLLG 1768          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004363.1 (pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 gene:ENSPMAG00000003981.1 transcript:ENSPMAT00000004363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 501.13 bits (1289), Expect = 3.226e-152
Identity = 299/888 (33.67%), Postives = 483/888 (54.39%), Query Frame = 2
Query:  710 KLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAI------KTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAK-------------------------VASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSN-----------VYEKMRECNTLVKLLEDKMADPQYGLPDIFIYM-IQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGY-NRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEM 3229
            K  + +DP + K + +Q+SV I+ A+ L G NI+PM  +  G  K+ T I+  TN P YNE+F FD   +   M + +IK   L+  +N  A R  +G  +G F +D  +VY+   H F+ KWA LIDP   T+  +GYV+ DI+V+  GD  K+       ++ ++E NL++P       R+     V IY+A  LP MNT I++N+K A+ G+ K L D YV+VSFAG  G+T V N +Y P WN+Q++ T+ FPP   R+++ +RD+D V D  I + FIDL KI   G K   GF+PT+GP+W+N+YG+ R +T   L+   Q  N  L EGV++R RL++ +      KTS + +++   V V     ++++V GK E + LFG   E T+I+  + +  K ++FE+SIG  GN +D   K                          A + + T E   + S T      T D +YFH+PY  +KPC+++ +   D R R++  NII+K+  +L E I      +  +K    RR        L  ++E++ SG +     A K   D        LD +++K++L+ L   ++ S            + + MR    L+  L   + DPQ+ +PD+FI+M + +  R+A+ARI A++I++++   E G  CG + T++LK L          + +QA+L++YLWLG  +    +  G+P G+  ++     +PP+ + Y   S F+LR +++ AR++  +D +GLSDPFAR+I S H   + +F +T  P WD+ L   ++     P  L+  PP VV+E++D ++    EF+GR   +P V I  + Y   +    L ++ IYRG L AGE+LA+F+L+++
Sbjct:  252 KPEQRVDPTAGKPQSYQVSVMIIRAQKLVGLNIDPMVILEVGDAKKKTRIEKSTNCPNYNEYFVFDFNTAPNTMFDTMIK---LTVVHNKDAIR--SGTPIGTFKLDVGTVYSQPDHRFYHKWATLIDPDDITADVRGYVQCDITVVGKGDNIKKSHKSIESDDDSLEGNLILPDGCKGE-RQWARFYVNIYKAVGLPKMNTAIVANVKKALMGQEKDLVDPYVQVSFAGQKGKTSVQNNSYEPVWNEQVVLTDIFPPLCRRMKLQIRDSDKVNDVAIGSHFIDLTKICNNGDK---GFMPTFGPAWVNMYGSTRNYT---LVDEHQELNDGLGEGVSFRARLLLQLTTELLDKTSPELNNT-TEVMVEDIPRINDSVLGKMEEFFLFGAFMEATMIDRSISE--KLISFEISIGNYGNSIDGLNKSNPQERSDDEDEDDDEDDEEETVLLTAQKAKGTDELSSMFSTTPPMKPETNDRQYFHMPYYEQKPCVYVESTWHDQRRRLYNSNIIDKIADKLDEGISDVKEAMKTDKPHPERR--------LRGALEEMSSGCERFCSLANK---DSSSIDCTDLDRKRLKMRLKELIYNIQHSFKTMLCMLFIQIINDMMRVMRNLLSALIACIKDPQHSIPDVFIWMLVNKTKRIAFARIPAKDILYANADEELGKDCGKVKTLFLK-LPGKRSFGPGGWAMQAKLEVYLWLGTNKQRNNFLNGMPTGFVEKKSIDPTVPPRVLTYSKRSQFELRAHMYQARSLFAADSTGLSDPFARVIFSTHCKSTEVFQETLCPTWDQLLEYQDVYMYGEPRELRDDPPMVVIEVYDQNTMGKSEFIGRALAKPVVKISTEPYEPPRFPPMLDYYQIYRGPLTAGELLASFELLQV 1112          

HSP 2 Score: 50.0618 bits (118), Expect = 6.735e-6
Identity = 27/118 (22.88%), Postives = 59/118 (50.00%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSAN-IYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY 487
            M+L V+LK ++      D+  ++ FR +   +N  +   +   F + F WP+A  ++ ++ L ++ YN  ++   +L+G  ++    L+ +  + + E L+DE        V  E++Y
Sbjct:    1 MALVVHLKRVEKLRGKADRIARVTFRGLTFDTNVFENCEDEARFDKIFRWPLATAINGSETLEVQVYNHGKLLSKRLVGTFRMVLQQLVEQGQLELTETLLDENNASIMATVTLELQY 118          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001654.1 (pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 gene:ENSPMAG00000001492.1 transcript:ENSPMAT00000001654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 469.929 bits (1208), Expect = 1.681e-142
Identity = 245/515 (47.57%), Postives = 338/515 (65.63%), Query Frame = 2
Query: 4661 LYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPG 6193
            +++ +   +P+  +VRVY+++A +LHP+D+NGK+DPYI+VKLG  EV+D+ENYI K LNPVFGK  ++E  FP +S L V IYDWD +  DDLIGET IDLENR  S H+ +CGI   Y  HGY  W+D   P+ IL  LC+E  V  P Y     RV + +R+F A T +ED++G +  + E +AL VLHHW EI    KL+PE+IETRPL  PEKPGI+QG +EMWVDM+PA    P  PIDI PRK    E+R  +  T+ V L + +  T EK+ DIFV+SW+K    D Q TDVHY S++G+G FNWRFV+ FDYL AE+ IV ++K SV+  DE EYK P  L +QV D+    +D  +G  +  L++FP+ AK  + C  D  +   +    ++F+ K+++GWWP     ++++ +          VE E+ L+T+EEAE +P GLGR EP PLE P RPD SF+ FL P  +IKY I +R KW+++KI +  + L ++ALF+YN PG
Sbjct:  477 MFQGIPSNDPIGVLVRVYVVRANDLHPADVNGKADPYIVVKLGKHEVKDKENYISKQLNPVFGKSFDIEAVFPMDSMLTVSIYDWDLVGTDDLIGETKIDLENRLYSKHRATCGISQRYSIHGYNMWRDPLKPSQILARLCKEVKVDPPQYSP-EGRVKVANRTFTAATEVEDENGQKKPTDEHMALTVLHHWEEIPGACKLIPEHIETRPLLHPEKPGIEQGRIEMWVDMFPADVPRPGPPIDIAPRKPKSLEMRVIIWNTDDVILEDDSLLTGEKSSDIFVRSWLKGQQEDKQDTDVHYNSVTGEGNFNWRFVFPFDYLVAEEKIVMSKKESVFSWDETEYKIPARLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTSKLCSLDMLKTDGSVPMISIFKQKRIKGWWPFAARNENDELELTGK------VEAEIHLLTSEEAEKSPAGLGRNEPDPLEKPNRPDTSFMWFLTPLRSIKYLICHRYKWLIVKIVLALLLLAMLALFLYNMPG 984          

HSP 2 Score: 185.267 bits (469), Expect = 1.470e-47
Identity = 133/476 (27.94%), Postives = 218/476 (45.80%), Query Frame = 2
Query: 2750 LPEGY------NRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDM--------KTKKITVKGL--PTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLG------DSTIVKEVIEKLSESESDEEVTGF 4099
            LP GY      N    +  +PP  + Y ++ MFQLRV+++ AR++  +D +GLSDPF RII S H   + +  +T  P WD+ L+ D+I        L+  PP +V+E+FD D+    +F+GR   +P V +  ++Y   +    L ++ IYRG   AGE+LAAF+L+++          +T       L  P+ K      S   D  +G +    L +P  IRP LS +R E+L WG+R L+RI++V                 V++P++ ++ +G  ++S  I  +   PNF       ++ LP +    PP+ I   +   FG   +VG   +T+L  +         R   KT       K+ N+   G+  +  L        GS    +         P VTA         +P++ Q +E E  DWW++Y+ +I  L              ++EK+ + E + E   F
Sbjct:    1 LPNGYEQKKAKNSSPIAQALPPISLIYKEKQMFQLRVHMYQARSLFAADSTGLSDPFGRIIFSTHSQATEVIPETLCPTWDQMLVFDSIELYGEAQELRDDPPIIVIEVFDQDTVGKADFIGRALAKPVVKMSNEKYDAPRFPPQLDYYQIYRGNSTAGELLAAFELLQVATSPTHHHAPRTTAPRPATLIPPSGKGDLPPISGPTDTEHGTI----LPVPRGIRPILSKYRIEVLFWGLRDLKRIQLVT----------------VDRPRVDVECSGKSVQSVVIPSYKQNPNFSTLFKHFEVDLPDNELLHPPLNIRVVDCRAFGRYTLVGTHTVTSLRKFI-------LRAPSKT-------KAANIRTIGDPNDPRLPAS-----GSVCQSVC--------PQVTA--------HQPIIHQPDE-ELLDWWSKYFVSIETLNKRCKKKLKKKRSPILEKMFDKELEGEFDNF 420          

HSP 3 Score: 49.6766 bits (117), Expect = 7.967e-6
Identity = 26/53 (49.06%), Postives = 34/53 (64.15%), Query Frame = 2
Query: 4340 MYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIY 4498
            M+  ELE   +F  F D   +FSLYRGK E+DD + E  DR  G FKG++C+Y
Sbjct:  408 MFDKELEG--EFDNFEDWLHTFSLYRGKIEDDDSSMEE-DRLVGRFKGSLCVY 457          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001770.1 (pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 gene:ENSPMAG00000001575.1 transcript:ENSPMAT00000001770.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 283.493 bits (724), Expect = 2.537e-78
Identity = 214/708 (30.23%), Postives = 347/708 (49.01%), Query Frame = 2
Query:  737 SLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYG---EGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDND-MVKDETISTIFIDLQKIMYTGSKEEE---------------------GFLPTYGPSWINLYGTPRTFT-----YTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAG-KREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSN--------VYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEK-GIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGY 2740
            S K  DFQ+ + ++EAR L GNNI P+ +V    Q + T I+ + N+PF++E F F+  +S  E+ + +I  + L       +  +     +G F +D  +VY    H+F RKW  L DP+  +SG KGY+KV + VL AGD+P    ++  EE  +IE NLL P  VS    +   + +  Y+AED+P M+  ++  +K  I+G     K L D Y+EVSFAG T  TK++ +N +P+WNQ I    RFP    RLRI + D D +  ++ + T F+ + +I   G  E E                     GFLPT+GP +INLYG+PR FT     Y +L       N    EGVAYRGR+++ + T  + D     V+  P + +       +R  Y L    Y  T++ E      +P+ FE+SIG  GN  D      +            S TQ   A       +++P+ N KP + + +  ED   R+   NI+   +R L   I +      +   +QAR  ++   ++ + +I+ +   ++ C     +     +   +  LD E  + +   LAL L+ +         V E + E +  ++ L +   +PQ  +PD+ ++M++ + RVA+ARI A E++HSS+ P   G  CG+  T+ LK   ++       + I  Q+++ +WL L  D + +
Sbjct:  205 SRKPRDFQVRIRVIEARQLPGNNIKPVVKVTVAGQSKRTRIR-KGNNPFFDETFFFNFHLSSAELFDELIYFKVLH------SHSLRADSEIGTFKLDVGTVYDEPRHTFQRKWLLLCDPEDLSSGAKGYLKVTLLVLGAGDEPPEDRSEAVEEREDIENNLLRPAGVS---LRGAFLTLRAYRAEDVPQMDDAVLDTVKQ-IFGFDSNKKNLVDPYLEVSFAGKTLCTKIIEKNANPEWNQAISLPIRFPSMCERLRITLYDWDRLTHNDAVGTAFLSMSQISCPGGDEPEAFITMRCLRLNLLRLIEDEGTGFLPTFGPCFINLYGSPREFTGFPDPYEEL-------NFGKGEGVAYRGRILVELTTKLE-DHINNKVEPIPSDDLLRVEKYLRRRRYNLCATFYSATMLRE----VNEPIQFEVSIGNYGNKYDVTCPPLA------------STTQYSRAVFDGCSSYYLPWGNIKPVVTLTSYWEDVGHRLEALNILMHTQRRLEVNIGR------VRATLQAREPVEAVAVSWLHAIDTL---IEDCSQALPEI---TERPNVTPLDREVWRARSATLALILRSAQRLREEATRVEETLSELDDWLERLTELTREPQNSIPDVVVWMLRGDRRVAFARIPAHEVMHSSLGPHACGKNCGITQTIVLKYPQDT-----HGFKIPGQVRVRIWLSLAADSKSF 860          
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002265.1 (pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gene:ENSPMAG00000002063.1 transcript:ENSPMAT00000002265.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.083 bits (549), Expect = 1.037e-61
Identity = 137/380 (36.05%), Postives = 202/380 (53.16%), Query Frame = 2
Query: 5027 GYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGI-QQGLLEMWVDMYPAGTAIPAP-IDITPRKAIG-YELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAED-CIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAK-----FNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPM---PLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILI 6130
            G  +W+D   P++IL+ +    + P PIY+   DR+ +  R +       +        L P+   +  H   ++    L+PE++ETR L    +PG+ QQG L MWVD++P     P P  DITPRKA   Y+LRC +  T+ V +++    T EK  DI+VK W+   D   QKTDVHY+SL G+G FNWR+++ F+Y+ AE+ C+V  ++  + +D+ E + P    +Q+ D+     D  +G     LS  P PAK    C    +     K      +LF  K V+GWWP I       ++E+  + I G VE+ +E++  +EAE  P GLGR EP     L+ P RP+ SFL F +P  T KY I  R KWI I
Sbjct:    2 GQNQWRDQMTPSMILEGVARAKSWPQPIYE--GDRLTLKGRDYLMSDF--EAKAPTNPHLGPVKERLALH---LLRSMGLIPEHVETRTLEHSIQPGLEQQGKLMMWVDVFPKNMGPPGPPFDITPRKAKKRYQLRCIIWNTKDV-ILDETSITGEKMSDIYVKGWIDGRDDAKQKTDVHYRSLGGEGNFNWRYIFPFEYVPAENICVVSRKEHFWSLDKTELRLPPKFTIQIWDNDKFSPDDYLGYLDLNLSHMPVPAKSAEKCSLEMVETPTGKKKHKTTSLFEQKNVKGWWPCI-------AEEDGKKIIAGKVEMTLEILADKEAEERPAGLGREEPNMNPKLDPPNRPETSFLWFTSPLKTFKYIIWRRYKWIFI 366          
BLAST of Otoferlin vs. Ensembl Yeast
Match: TCB3 (Cortical ER protein involved in ER-plasma membrane tethering; one of 6 proteins (Ist2p, Scs2p, Scs22p, Tcb1p, Tcb2p, Tcb3p) that connect ER to the plasma membrane (PM) and regulate PM phosphatidylinositol-4-phosphate (PI4P) levels by controlling access of Sac1p phosphatase to its substrate PI4P in the PM; localized to the bud via specific mRNA transport; non-tagged protein detected in a phosphorylated state in mitochondria; C-termini of Tcb1p, Tcb2p and Tcb3p interact [Source:SGD;Acc:S000004537])

HSP 1 Score: 49.2914 bits (116), Expect = 8.346e-6
Identity = 24/89 (26.97%), Postives = 52/89 (58.43%), Query Frame = 2
Query: 4703 VRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLEN 4969
            + + +I    L  +D NG SDP++ + + DK+V  + N   KTL+PV+ +  ++ +    ++ ++  + DWDR   +D +G+ ++D+ +
Sbjct: 1136 LNIKLISGHGLKSADRNGYSDPFVHIFVNDKKVF-KSNIKKKTLDPVWNEDAKIPILSRSKNQVIFNVLDWDRAGDNDDLGQASLDVSS 1223          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO47415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLZ1])

HSP 1 Score: 587.415 bits (1513), Expect = 2.326e-175
Identity = 374/1152 (32.47%), Postives = 601/1152 (52.17%), Query Frame = 2
Query:  761 ISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPK----SPTSGEKGYVKVDISVLCAGDKPK-RPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIG---VDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLD----DYAKVASEKEPTP------------------ENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAK--KTMLDVKYQRLIRLDLEKMKVKLQNLALELK-RSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKM---PPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTT----AKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFR--EIDKTTIDERSVKSLNLFNAGN--DTEGILNEGFENEDGSAINELTDMK-EEKPNPDVTAPVPGTVEKVKPVLPQ--------------TEEMESADWWTRYYATIGDL--GDS 4033
            I + I EAR L G  I+P+  V  G QK++T IK QTN PFY+EFF FD  M  + + + I+  +      N+V+Q    G ++G F +D  +VY    H F R+WA L DP+    +  +G KGY +VDI+VL  GD  K +P   DN+++  IE NLL+P  V    R    + + IY+AE LP MN+ +++N+K A  GE + L + YVEV FAG+  RT V    Y P WN+Q++F+E FPP   R++I ++D+D V DE I T FIDL +I   G+    GF+PT+GP W NLYG+ R ++   L       N  L EGVA+RGRL+IA+   +   +S+ G   V+V P  P+S+T AGK E + LF   YE ++I+  +G   K ++FEMSIG  GN +D    D    A+  + T                   +N +++S+T      T D +Y+HIP+++ KPC  +    +DHR R++  N++ K+   L + +      + ++      R+L   +  LI    + ++ +KS    +   +T LD +  +L + ++E +    Q L    K  +++ + ++  N L++ L +   +PQ  +PD+FI+M+    RVAY+RI ++ I++S +  E+G   G M TV+L RL          + IQA+L I +WLGL +  + Y    P+GY     + K+   PP ++ Y ++  F LR +++ AR++IGSD SGLSD FAR+I +  ++ + +  +TRSP WD+TLI   ++     + +  +PP +VVEIFD D   D EF+GR   +P V +  + Y        L+W+ + RG   AGE+LAAF+L+++   T  +  +  P       +T                 +P  IRP +   R E+L WGVR+++RI +                  V++P++ ID+AG+ I+S  IT+    PNF++ + + D+ LP + ++ PP+ I   +   FG   +VG   + +L  Y Q  + +  R  +  K+ +D + +    L N  +   + G      E +D   I E+  M+ + +   D   P+      +                     ++ +S DWW+RYY T+ D   GDS
Sbjct:  262 IQIRIHEARQLAGTQIDPVCTVSVGNQKKSTTIKEQTNCPFYDEFFVFDFKMPPMVLFDKIVMFQ-FYTGRNLVSQ----GALIGSFKLDVGTVYAQPDHRFCRRWAVLTDPEETLGASGAGVKGYARVDITVLGKGDPAKEQPGIKDNDDD--IEGNLLLPDGVP-AERPKARVIIKIYRAEGLPKMNSGLMANVKKAFTGEVRDLVNPYVEVQFAGHRARTTVKKNTYEPKWNEQVVFSELFPPLCRRIKIQLKDSDSVTDEVIGTHFIDLSRISNDGAN---GFMPTFGPCWANLYGSTRDYS---LFDEHNDLNNGLGEGVAFRGRLLIAVHAEFGESASESGIRQVEVEPTAPISDTAAGKDEQFQLFACFYEASMIDRKVGD--KMVSFEMSIGNWGNSIDGQPIDEVSHATHIQHTSNTQHTQSTMGGDEDRRDGDNPFLYSLTPPVKPVTNDRQYYHIPWEDSKPCTHIKFMWQDHRRRLYNSNVLLKICERLEDGLTDCIERVKMDLP-NTFRWLSRVLSELINGCNQYLNLIKSMPTASHVGRTKLDKERLKLCQYEVESVCTSAQELKTSTKDDTHMKDNLKAANALLQRLLNIAVEPQDTIPDVFIWMLCGGKRVAYSRIPSQHIMYSLVEEERGKDSGRMQTVFL-RLPGKRGDGPKGWAIQAKLNIMIWLGLHKHKKDYLKDAPKGYQTPKNAHKLMAPPPNHLIYTEKQKFVLRAHVYQARSLIGSDASGLSDAFARVIFTHLVSDTRVIWETRSPTWDQTLIFQEVVLWGDVNEIAVNPPTIVVEIFDKDIGGDSEFIGRALARPIVKMACEPYEKPFFPPALEWFQVCRGEENAGEMLAAFELLQVTSGTCFLPSEVEPVNTPDGPITP----------------VPVGIRPVMKKHRIEVLFWGVREMKRINLT----------------TVDRPQVDIDLAGHVIQSTVITNAKKNPNFQNPVCYFDVELPENERYCPPLTIRVRDCRTFGRFTLVGTHVLNSLHRYLQTGEKEKERIEKAGKSCLDRKRL----LANGPSRPTSPGGGEVALEMDDAPPI-EMEQMELQARLITDTETPIAVVATDMHASTDHEKKKEKGDKDKKEDDDDEDSLDWWSRYYETLKDQEKGDS 1358          

HSP 2 Score: 416.772 bits (1070), Expect = 3.994e-118
Identity = 226/507 (44.58%), Postives = 308/507 (60.75%), Query Frame = 2
Query: 4721 KAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIP-APIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            KA+NLHPSD+NGK+DPY++V LG   VRDR+NY+ K LNP FG+C E E   P +S L V IYDWD +  DDLIGET +DLENR+ S H+ +CG+   Y   G+ KW+D   PT IL  LC+E  +  P Y   T RV +D++ F A   I ++ G   +S EP AL  L  +  +  G  LVPE++ETR L+ PEKPG++QG LEMWVDM+P     P AP+DITPRK   YELR  +  TE V L   N  T EK  DIF+K W++    D Q+TDVHY+SL+G+G FNWRF++ F Y KAE+ IV T+K S +  DE E K P  L++QV D+    +D  IG     L++ P+ AK  +SC  D  +   +  + + F+ K ++G+WP   N ++E+ +          VE E+EL+T EEAE  P G  R +P  LE P RPD +++  +NP   +K  I    +  LIK+ VI + L ++ LF Y+ PG      V K+FG
Sbjct: 1490 KALNLHPSDVNGKADPYLVVNLGKHRVRDRDNYVSKQLNPTFGRCFEFEAIIPMDSMLTVGIYDWDLVGSDDLIGETKVDLENRFYSRHRATCGLQDQYATFGFNKWRDPLRPTQILAKLCKEEGLDGPHYS--TGRVRVDNKVFVAAPQILEESGHWKQSDEPSALRCLKQFQTLKRGFTLVPEHVETRALFNPEKPGVEQGKLEMWVDMFPMDMPSPGAPVDITPRKPTSYELRVIIWNTEDVLLEEANMLTGEKCSDIFIKGWLEGLKDDKQQTDVHYRSLTGEGNFNWRFIFPFQYQKAEERIVITRKASFFSWDESEEKVPARLHLQVWDADAFSADDFIGDLCLDLTRMPRGAKTSKSCTLDLLKQDGSVPQVSFFKMKHMKGFWPFFVNTEEEEIELAGK------VEAELELLTQEEAEKKPAGRAREDPQALEKPNRPDVAWMMMMNPLRGLKAMIWNNYRMCLIKMLVIALLLALMGLFFYSMPG----YTVKKIFG 1984          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO43088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZG6])

HSP 1 Score: 322.398 bits (825), Expect = 1.056e-88
Identity = 209/605 (34.55%), Postives = 310/605 (51.24%), Query Frame = 2
Query: 4352 ELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIY----DKLTDRVDIDDRSFFAETM--IEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKS-VYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC----DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMP---LEAPMRPDGSFLSFLNPWNTIKYFIKYRLKW 6121
            ELE +++FGG  D   SFSLYRGK ++ DD+ E   +  G FKG   IY +   +  D D  E                                        ++ NL    P+D VVRVYI+ AI+L P D  G +DPY++V+LG K++ +++ Y P TLNP+FGK  EL+   P    L + + D+D LT+DD+IGET IDLE R L+ ++  CGI  +Y + G  +W+D++ P  +L+  CEE       Y    D   DR+ +  R +  +      + +       + LAL VL+         + +PE++ETR L  P +P I+QG +++WVD++P    +  P +DIT R+   YELR  V  T  V +++    T E+  DI+VK W++    D +KTDVHY+SL G G FNWR V+NF YL  E  +V  +K   + +D  E +    LNMQ+ D+     D  +G  +  L K P+P +  + C    DP +  E     +LF+   ++GWW            +E  EE  G +E+ +E++ + EA   P G GR EP     L+ P RP  SFL F +P+ T+KY I    KW
Sbjct: 1284 ELEKIEEFGGLEDMIASFSLYRGKAKKRDDDDEETQKVVGEFKGTFRIYPLPEAEGVDPDLPET---------------------------------------VFTNLPPNEPIDCVVRVYILSAIDLQPQDPGGLADPYVVVQLGKKKLDNKDQYKPNTLNPIFGKMFELDAVIPVHKDLKITLMDYDLLTRDDMIGETVIDLEQRLLTRYRAKCGIPKTYCDSGPNQWRDHKRPMELLREWCEETEKNFKFYKGTKDGTPDRIVVGYRVYQLDEFGAFRNPNEHLGAKHQRLALHVLNQL-------EFIPEHVETRGLRSPMQPNIEQGKVQLWVDIFPKNEGVLKPSVDITAREPTNYELRVIVWNTSGV-IMDETSITGEQMSDIYVKGWLEGMGDDKEKTDVHYRSLDGDGNFNWRMVFNFLYLPIEKKMVIREKEHFWSLDAKEVRLAPRLNMQIWDNDTFSYDDFLGSCQLDLIKLPKPCQTAKRCGTSRDPGKNGEYV---DLFQQHSIQGWWACY---------QEGIEEPTGKIEMTIEVLNSNEAAVKPAGKGRDEPNQNPHLDEPNRPATSFLWFTSPFKTLKYIIWRNYKW 1829          

HSP 2 Score: 246.514 bits (628), Expect = 1.836e-65
Identity = 195/693 (28.14%), Postives = 329/693 (47.47%), Query Frame = 2
Query:  737 SLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELI----IKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKP----KRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKH---AIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMV-KDETISTIFIDLQKIMYTGSKEEE----------GFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVD-VRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLK--TSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRS--------NVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLG 2716
            S K++DFQI V I+E R L GNNI+P+  V    QK+ T+I   TN P YNE FTF+   S  E+ + +    +      +      +++F G    + +  +   + N    F                 +GY+KV   VL  GD+P    K P  +++E++  IE+N L+P+ V+  P       + I+QAED+P M++ +  +IK     I+G  K L D YV+V+F G    T +  ++ +P++ +Q+     FP    R++I + D D V  D+ I T F+ L  I   G +  E           F PT+GP ++N YG+PR F+  +L   D   N+ + EGVAYRGR++I ++T+   +  +  V  +   + V      +RE Y LF   YE T+I +  G    P+ FE+SIG  GN +D+    A+     P     H              Y ++P+ N+KP + + +  ED   R+   N+I +L  +L   +++    +      +   ++   TSI+ ++  I   +  V     ++K    D+  ++++ L+     +   NL  ELK +        N+ + + E N  ++ L D   +PQ  +PD+ ++MI  + R+AY RI A+E++ S+     G +CG    + LK        L     I A +++ LW G
Sbjct:    5 SDKVQDFQIRVKILEGRQLSGNNIHPVVRVAMSNQKRETKIVRSTNKPVYNESFTFNFHTSEAELFDDLFSPAVSAHSYWRWGIRPKKQLFQGLPRPKCAYISSFAFLNVVFLF-----------------QGYLKVTAMVLGPGDEPPIKAKLPPKEEDEDD--IESNCLMPMGVARQP---ALFNLRIFQAEDIPQMDSGMGRSIKKFFKGIFGGAKGLVDPYVKVNFCGKKIETSIKYQDDNPEFKEQVKIPLMFPSMCERIKIQLYDWDRVGNDDCIGTAFLSLSSISGQGDEGNELLVILHPSLLCFPPTFGPCFVNFYGSPREFS--ELPDQDDALNKGIGEGVAYRGRVLIELETTLGSNEIEQEVSQIETEDIVRVQPFLRREKYKLFACFYEATMIKDVDG----PVEFEVSIGNYGNKMDESVAPANTAPSNPLFDGCH--------------YNYLPWGNEKPVVVVESFWEDIAFRLEPLNLISRLCDKLEVNVKRVRSALDAPTPPKEDAFVPMVTSILEVL--ISDCIPHVGVLSKSSKHCSYDILGRKVLPLNHRDHDL---NLTTELKSALDFPGAEINMEQTVGELNGYLQRLRDVAIEPQNCIPDVIVWMISGSERIAYYRIPAQEVLFSTTPDACGKICGKTVELRLKYPGKKGQDLKDHPEIPALVRVELWFG 650          

HSP 3 Score: 125.561 bits (314), Expect = 1.753e-28
Identity = 109/422 (25.83%), Postives = 176/422 (41.71%), Query Frame = 2
Query: 2828 FQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVK---GL----------------PTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLD-LRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDS 4033
            FQ+  Y++ AR+++  D+SG++DP+ R+  +     + +  +T  P WD+TLI    +F+   ++ + +PP VV+E+FD D    ++FLGR   +P   I G++    KL W+ I  G    GEILAA +L  +     + T K   GL                PT +D +           GE+    L + + IRP L     E+L WGVR +++ ++  +K                 P +  +I G  I+SD +TD    PNF   ++    + LP    + PP+ I   ++  FG                             K T+   S+KSL  F     T      G    +G A                    PG  +  + V+P+ E     DWW++YYA++    DS
Sbjct:  932 FQMWAYVYQARDLLAKDESGMNDPYVRVAFANQSQMTEVKQKTLCPTWDQTLIFHVDLFDSLENI-QRNPPTVVMELFDKDQVGKDDFLGRTEFKPYPRIHGNEGPACKLLWYPISHGDEDGGEILAACELFLVSFIFFQCTTKLETGLLNFHLQDDGVVNIPHPPTPRDAE-----------GEI----LPVRDRIRPVLQKTVVEVLCWGVRNMKKYQLASIK----------------SPSVQFEIGGEIIQSDILTDAKKFPNFGRPILPRKIINLPVEEMYTPPMNIRIHDNRTFG----------------------------RKPTVAVHSIKSLTRFRCAAPTPA----GQIQVEGPA-------------------APG--QPAEGVVPEAES-HKFDWWSKYYASLNQTEDS 1267          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO36863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC0])

HSP 1 Score: 277.715 bits (709), Expect = 4.907e-76
Identity = 202/675 (29.93%), Postives = 330/675 (48.89%), Query Frame = 2
Query:  737 SLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDK-PKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHA--IYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDND-MVKDETISTIFIDLQKIMYTGSKEEE------GFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFH-IPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARR---YLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGL 2719
            S K +DFQ+ V I+E R L G NI+P+  V    Q + T++K+ TN PFY+E F F+  MS +E+ + II     +      ++++    ++G F  D    Y   GH+  RKW  L DP    +G KGY+KV + VL  GD+ P +   DDN+   +IE NLL P  V   P      ++ +Y+AED+P M++  I  IK    +  E K L D Y+  SFAG   RT++   +  P++NQ++    +FP    RL++ + D D +  D+ I T  + +  I   G   E        FLP +GP +IN+YG+ R   Y+ L       N    EGVAYRGR+++ ++T           D++    +S     +R  Y LF    E ++++   G    P+ FE+SIG  GN LD    V      TP    V           YD  Y++ +P+ + KPC+ + +  ED   R+   NI+ ++   L   + + +  +SLE N Q       L + +  LI  + K +  + +   T     LD+K Q  +RL +EK+ +  + + L    ++V E + E    ++ L D   +PQ  +PD+ I+M+    R+AY RI A ++++   +   G  CG +  +++K        +     + A +++ +WLGL
Sbjct:   11 SNKPQDFQVRVRIIEGRQLSGQNISPVARVTVANQTRQTKVKISTNKPFYDETFFFNFNMSPMELFDEIISFEVFN------SRKLRANAMIGYFKCDIGFFYEEPGHAAIRKWVLLTDPDDKMAGVKGYLKVTVMVLGPGDEAPVKSAQDDND---DIETNLLQPSGVMLRP---ATFSLKVYRAEDIPQMDSGFIEGIKRVLRVGEEQKELVDPYLLFSFAGMKARTRIHYNSDHPEFNQELNVQFKFPSMCERLKLQMFDWDRLTADDCIGTAHLPMSAISGQGEDGESWVERNISFLPMFGPCFINVYGSTR--EYSDLPDEYDDLNLGNGEGVAYRGRVLVELETKLGVTPQSPTDDLQSHEIISVQPYLRRRKYKLFACFLEASMVSCSDG----PVEFEVSIGNYGNKLD--LSVPPSSSTTPPTNAV-----------YDGCYYYFLPWGDTKPCVCVESHWEDIGFRLGTKNILTRMCERLEVNMDKVN--LSLEANAQPAETATLLISLLDQLINDVRKPLPKIDN--NTPGVNDLDLKLQE-VRL-MEKLSISEEAIKLRESATDVREALGEIEGFLQRLRDLTVEPQNSMPDVIIWMLSGTKRIAYYRIPAFDVLYEPYSEACGENCGQVQNIFMKYPGKKQQNIEDYPEVPAHVRMMIWLGL 648          

HSP 2 Score: 161.384 bits (407), Expect = 1.401e-39
Identity = 95/314 (30.25%), Postives = 153/314 (48.73%), Query Frame = 2
Query: 2792 PPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDM-KTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCD 3730
            P  +I Y     +QLR YLF AR+++ SD  G+SDP+AR++     + +    +T  P WD+TLI D +    + + +  +PP V++E++D D    +EF+GR   +P V + G      +L W+ + RG    GEILAAF+L  + + K +  + +G     D+              M  N   +P  IRP +     E+L WGVR +                K+F +  V+ P I  +  G+ + S  I +    PNF+  L F D+ LP    + PP+ I   ++  FG K +VG  A+ +L   ++CD
Sbjct:  901 PRMFITYEKPHRYQLRAYLFQARDLLASDPDGVSDPYARVVFGTRSSVTETLARTLCPTWDQTLIFDEVNIYGSIEQVAENPPAVIIELYDKDPVGKDEFMGRCVVKPLVKLNGQGPPAPRLLWYDVERGDEYGGEILAAFELFLVSITKVQNASKRGNDEGTDLPFAPP---------MKGNLFLVPNGIRPVMQRTAIEVLCWGVRNM----------------KKFQLASVSSPSIEFECGGHVVNSTIIKNTQKNPNFDQPLFFFDVYLPKEELYTPPMNIKVRDNRSFGRKPMVGLHALKSL-QRFRCD 1188          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO34141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ91])

HSP 1 Score: 263.462 bits (672), Expect = 1.013e-72
Identity = 169/459 (36.82%), Postives = 249/459 (54.25%), Query Frame = 2
Query: 4688 PVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDR---VDIDDRSFFAETMIEDDDGSQIKSLEPLALE---VLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAG-TAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC----DPFQLSEACAKF-NLF--RNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEP 6022
            P+  +VRVYII  ++L   D +G  DPY++V +G KE   R++Y  KTLNPVFG+  E   + P    L + + D+DRL++DDLIGETTIDLE R LS +  +CG+  +Y   G   W+D + P  IL+ +C +  +  P +    D+   V + +  F     IED D  Q++S E  + E    LH  H +     +VPE++ETRPLY P +P I+QG L++WVD++P    +I  PI+I PRK   + LR  +  T  V L   +  T EK  DI++K W++  D  L KTDVHY+SLSG G FNWR  + F +L  E  +  ++K ++   E E K    L +Q+ ++     D  +G     L + P+P    R C    DP         F +LF      +RGWW    +       +         V++ +E++TAEEA++ PVGLGR+EP
Sbjct:  483 PLKCIVRVYIICGMDLQSQDTDGFGDPYLVVSIGKKEFSTRKDYKKKTLNPVFGEMFEFHASIPSSKDLKITVMDYDRLSRDDLIGETTIDLEQRLLSGYHATCGLPKTYFKSGPYAWRDSKTPKEILREVCLDRGLNRPDFYHKGDQAVTVVVGEDQF----NIEDLDDYQLESNELGSSEQRLSLHALHAM----GMVPEHVETRPLYSPLQPRIEQGKLQLWVDIFPCTEGSIKPPIEIEPRKPKDFVLRVIIWDTTDVELQETS-ITGEKMSDIYLKGWLEEIDEKL-KTDVHYRSLSGDGNFNWRMEFPFSFLTIEKKLHLSKKKLWGKCE-EVKVDAKLKIQIWENDKFSPDDFLGTRSLPLHRLPKPCSNSRWCGTKYDPGVRQNPDDDFVDLFTLHTHSIRGWWACWQHDSPSGKPKGK-------VDMSLEILTAEEAKARPVGLGRSEP 923          

HSP 2 Score: 115.546 bits (288), Expect = 1.150e-25
Identity = 90/293 (30.72%), Postives = 140/293 (47.78%), Query Frame = 2
Query:  737 SLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIF-TGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPN-IEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDND-MVKDETISTIFIDLQKIMYTGSKEEEGF 1606
            S K + +Q+ V I E R + G NI+P+  V  G +KQ+T +K  TNSP YN+   F+   S  E+ + ++ +        V   R F +  +LG F  D  ++Y    H+F RKW  L       S ++GY+KV   VL  GD+P          N N   +NLL+P  V    R+     + +Y AEDLP   + I+  +K A   E K   D Y+  SF G   +TK  +   +P +NQ +      P     +++ + D D   K + I+T ++ L +I  +G    EG+
Sbjct:   15 SSKPQHYQVRVKIHEGRQIPGTNIHPLVRVSVGNKKQSTSVKRSTNSPTYNQTLFFNFHASEAELFDELMTL-------EVFNSRTFLSDSLLGFFESDIGTLYELPDHAFLRKWVLLTGAGVQESEDEGYLKVTAMVLGPGDEPPLSVFVAIVNNYNFFGSNLLLPAGVR---RQQAVFQLRVYFAEDLP-QKSAILFFLKSA--EERKKSVDPYLTFSFCGKQIQTKTQHHENNPVFNQMLQLPVMLPSMCENIKLQLWDWDSFSKHDCIATAYLPLSEI--SGKSYGEGY 292          
BLAST of Otoferlin vs. Ensembl Nematostella
Match: EDO36866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHC4])

HSP 1 Score: 259.996 bits (663), Expect = 1.730e-70
Identity = 185/674 (27.45%), Postives = 321/674 (47.63%), Query Frame = 2
Query:  758 QISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEG-KALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDND-MVKDETISTIFIDLQKIMYTGSKEEE---------GFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNK-YFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSII-NLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGY 2740
            Q+ V +++ R + G NI+P+ +V  G Q + T++K  TN P+++E F F+         + +I     +      +Q++    ++G F  D    +  + H   RKW  L DP+    G KGY+KV + VL  GD+   P   D+E++  +E NLL P  V     +    A+ +Y+AED+P M+++   ++K    GE  K L D YV VSFAG   RT+   ++  P++ +++  + R P    RL+I + D D    D+ I T ++ L  I  +G  EEE         GFLPT+GP ++N YG+ R   Y+ L       N  + EGVAYRGRL++ ++T+   ++     D+   + +      +R  + LF    E T++          + FE+SIG  GN LD      +  EP+       S + +     +D   Y+ +P+ + KPC  + +  ED   R+   N++ +    L + + +    +  +        L  +++ +LI    + +  V S    A     D+ +++  + + EK+ +  +   L    +++ E M E     K LE    +PQ  +PD+ I+M+  N RVAY RI A E++ S     +G  CG + +V+LK        +     +  ++ + LWLGL +D   +
Sbjct:    1 QVRVRVIQGRQIAGANISPVVKVTVGNQARQTKVKKSTNRPYFDEMFFFNYQEIASTFFDNLISFEVFN------SQKLRANALIGSFESDVGFFFDQQDHMVNRKWVLLTDPEDKMEGAKGYLKVTVIVLGPGDEA--PINHDDEDD--LENNLLQPAGVI---MRTSIFALKVYRAEDIPQMDSSFADSVKKVFMGEANKELVDPYVLVSFAGKQSRTRCHEKSDHPEFKEELFVSFRLPSMCERLKIQMYDWDRFTADDCIGTAYLPLSAI--SGQTEEEVISSLCNCSGFLPTFGPCYVNFYGSTRE--YSDLPDEFDDLNLGIGEGVAYRGRLLVELETTLGENAMSPSEDLDDEDIIRIQPFLRRRKFKLFACFLEATMV----ACPDSSVQFEVSIGNYGNRLD------TSVEPS-------SSSTAACNPVFDGSFYYFLPWSDSKPCCSVESHWEDIAFRLEAFNMLTRTLERLQKNMDKVELALDAKMPAPELAALVIALLGDLIQDCRRPLPEVSSKTAGAN----DLDFKKYAQREKEKLAIAEEARKLRDNATDIEEAMNEIEGYQKRLELVAVEPQNCMPDVVIWMLNGNKRVAYHRIPAYEVLFSHSEQARGKHCGKVLSVFLKYPGKKQFDIEDHPEVPCKIDVALWLGLEKDQDAW 636          

HSP 2 Score: 164.466 bits (415), Expect = 1.312e-40
Identity = 91/319 (28.53%), Postives = 156/319 (48.90%), Query Frame = 2
Query: 2753 PEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            P  +  E  +   P  +I +     FQLRVYLF A +++ +D  GL+DP+AR++  +    +     T  P+WD+TLI ++++     +++  SPP +V+E+FD D    +E++GR    P+V + G      +L W+ + +G +  GEILAAF+L         +++ G+       +     +   Y  M+++   +P  IRP +     E+L WGVR +                K+F +  V+ P I  +  G+ + S  I +    PNF+  L F D+ LP    + PP+ I   ++  FG + IVG   I +L
Sbjct:  870 PAVFQMEGGNTSTPRMFIKFEKYQKFQLRVYLFQASDLLAADSDGLADPYARVVFQKQSQTTCTKYHTLCPMWDQTLIFEDVMIYRTQELVVESPPKIVIELFDKDQVGKDEYMGRCVATPEVKLHGQGPPAPRLLWYPVTKGDMEGGEILAAFELF--------LSIWGMRPCTKFLRGDEGADLPYYPPMNKDLYMVPSGIRPVVQRTAIEVLCWGVRNM----------------KKFQLASVSSPSIEFECGGHVVNSTIIKNTQKNPNFDQPLFFFDVYLPKEELYTPPMNIKVRDNRSFGRRPIVGVHCINSL 1164          
BLAST of Otoferlin vs. Ensembl Medaka
Match: otofa (otoferlin [Source:NCBI gene;Acc:101155482])

HSP 1 Score: 595.119 bits (1533), Expect = 8.381e-178
Identity = 348/1033 (33.69%), Postives = 556/1033 (53.82%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIK-----TSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKV----------------------ASEKEPTPENQYVH-SMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNR-ECFSG-----KMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P S +  D+QIS+T+VEAR L G N++P+  V  G  K+ T +K  TN P+YNE+F FD  +    + + IIK+  +   N      + +G ++G F +D  +VY    H F+ KWA L DP   T+G KGYVK DI+V+  GD  K P   +  +  +IE NLL+P  +    R+     V IY+AE LP MNT I++N+K A  GE + L D YV+V FAG  G+T V   +Y P WN+QI+FTE FPP   R+++ +RD+D V D  I T FIDL+KI   G K   GFLPT GP+W+N+YG+ R +T   L+   Q  N+ + EGV++R RL++++      T+     S   V V   + +S +  GK E + LFG   E T+++  +G   KP+TFE++IG  GN +D  +K                       +SE E   E   V  S T        D  YFH+PY  KKPC+++ +  +D R R++  NI++K+  +L E +     +I  EK    RR L+  +  L     + V+        A +T LD +  +    +L+ M  + + L  ++K++ V ++++   + ++ L     +PQ+ +PD+FI+M+  N R+AYARI +++I++S++  E G  CG +   +LK L          + +QA+L++YLWLG+ R  + +  GLP G+   +   G      +PP  + Y  + +FQLR +++ AR++  +D SGLSDPFAR+  S H   + + ++T  P WD+ L+ D++        L+  PP +VVEI+D D+    EF+GR F +P + +  + Y   +    L+++ IYRG   AGE+LAAF+L+++    K      LP ++          D+  G +    L +P  IRP LS +R E+L WG+R L+RI +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG  A+++L
Sbjct:  246 MEPGSGRPVDYQISITVVEARQLIGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEYFVFDFHVPPDVLFDKIIKLSVIHSKN-----LLRSGTLVGTFKMDVGTVYFQPEHQFYHKWAILSDPDDITAGCKGYVKCDIAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGIP-AERQWARFYVKIYRAEGLPKMNTTIMANVKKAFIGENRDLVDPYVQVQFAGQKGKTSVQKSSYEPIWNEQIVFTELFPPLCKRIKVQIRDSDKVNDVAIGTHFIDLRKISNDGDK---GFLPTLGPAWVNMYGSTRQYT---LMDEHQDLNEGIGEGVSFRARLLVSVAVEILDTTSPEIISSSDVQVEGVSNISESATGKMEEFFLFGSFLEATMVDRKIGD--KPITFEITIGNYGNQIDGVSKSPAAKKKKKDGENEEDENELILNSSEDEAEEEGDLVSVSTTPLMKPVITDRNYFHLPYFEKKPCVYIKSWWQDQRRRLYNSNIMDKIADKLEEGLNDVQEIIKTEKAFPERR-LRGVLEELSVGCSRFVALANKDVNLAGRTKLDRERLKSCMRELDSMGQQAKQLRTQVKKNTVKDRLKLAQSFLQRLRFLADEPQHSIPDVFIWMMSNNKRIAYARIPSKDILYSTVEEETGKDCGKVKAAFLK-LPGKKSFGPAGWTVQAKLELYLWLGVNRQRKDFLSGLPNGFEEVKAVEGGPGFLSLPPLSLVYSMKQVFQLRAHMYQARSLFAADSSGLSDPFARVFFSTHSQVTEVLSETLCPTWDQLLVFDDVELFGEASELREDPPIIVVEIYDQDTVGKAEFIGRTFAKPTIKMCDEHYGPPRFPPQLEYFQIYRGNCTAGELLAAFELLQIGQGGK----ADLPPIEG-------STDSERGPI----LPVPLGIRPVLSRYRIEVLFWGLRDLKRINLAQ----------------VDRPRVDIECAGRGVQSALIQNYKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYILVGTHAVSSL 1231          

HSP 2 Score: 476.478 bits (1225), Expect = 3.482e-137
Identity = 266/640 (41.56%), Postives = 395/640 (61.72%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSC--DPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            ++ ++++  ELE+  +FG F D   +F+LYRGK  +DD++  + DR  G FKG++C+Y +   +    +   +                                     + +++++   +P++ +VR+Y+++A +LHP+D+NGK+DPYI+++LG  EV+D+ENYI K LNPVFGK  ++E TFP ES L V +YDWD +  DDLIGET IDLENR+ S  + +CGI  SY  HGY  W+D   PT IL  LC+E  +  P Y     +V + +R F   T IED++G + ++ E LAL VL+HW EI   G KLVPE++ETRPL  P+KPGI+QG +EMWVDM+P+    P P +DI+PRK   YELR  +  T++V L + ++FT EK+ DIFV+ W+K    D Q TDVHY SL+G+G FNWRFV+ F+YL AE+ IV ++K S++  DE EYK P  L +QV D+    +D  +G  +  L++FP+ AK  + C  D  +        ++F+ K+V+GWWP +   ++++ +          VE E+ LVTAEEAE +PVGLGR EP PLE P RPD S + FL P  +I+YFI +  +W+++K   + + LL++ LF+Y+ PG     +V K+ G
Sbjct: 1365 VDELVVFNKELES--EFGNFEDWLHTFNLYRGKAGDDDEHALDDDRIVGRFKGSLCMYKLPLSEEITREAGYDP-----------------------------------NMGMFQSIPHNDPINVLVRIYVVRATDLHPADINGKADPYIVIRLGKTEVKDKENYISKQLNPVFGKSFDIEATFPMESMLTVSVYDWDLVGTDDLIGETKIDLENRFYSKFRATCGISSSYSVHGYNIWRDPMKPTQILTRLCKEGKIDGPHYGP-GGKVKVANRIFTGPTEIEDENGLKKQTEEHLALTVLNHWEEIPRVGCKLVPEHVETRPLLNPDKPGIEQGRIEMWVDMFPSDMPAPGPALDISPRKPKRYELRVIIWNTDEVILEDDDYFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRFVFPFEYLVAEEKIVISKKESMFSWDETEYKIPPRLTLQVWDADHFSADDFLGAIELDLNRFPRGAKTAKQCSLDMIRNEHELPTISIFKQKRVKGWWPFVARDENDEMELTGK------VEAELHLVTAEEAEKSPVGLGRNEPDPLEKPNRPDTSLMWFLGPLKSIRYFIWHNYRWLILKALGLILLLLMLGLFLYSIPG----YLVKKLLG 1956          

HSP 3 Score: 60.8474 bits (146), Expect = 1.862e-8
Identity = 35/127 (27.56%), Postives = 66/127 (51.97%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANI-YFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEY--FSPSTGS 508
            M+L V+LK +      GD+  K+ FR +   S   +   ++ +F + F WPIA ++D+N++L ++ +N ++V  ++L+G   +    +  E  + + + L+DE        V  EI Y     STG+
Sbjct:    1 MALVVHLKKVSHLRGKGDRIAKVSFRGLPLCSRVAENCGDVAHFNETFRWPIASRLDENEMLEIQVFNYSKVFSNRLVGTFCMVLQKVAEEGHLELTDTLIDENNTSIKTSVTIEIRYQAMDGSTGT 127          
BLAST of Otoferlin vs. Ensembl Medaka
Match: otofb (otoferlin-like [Source:NCBI gene;Acc:101160130])

HSP 1 Score: 572.392 bits (1474), Expect = 4.380e-172
Identity = 345/1032 (33.43%), Postives = 560/1032 (54.26%), Query Frame = 2
Query:  725 IDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIA-----IKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDY----AKVASEKEPTPENQYVHSMTQSRFAYTYD---------------NKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSG-----KMPPKYIDYLD-ESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNI-IFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAK----LQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENK-LRIPEFIRPHLSTFRFE-ILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNL 3709
            ++P S +  D+Q+SVT++EAR L G N++PM  V  G+ K+ T +K  TN P+YNE+F FD  +    M + I+K+  +   N      + +G ++G F +D  ++Y+ + H F+ KWA L DP   T+G KGYVK DI+V+  GD  K P   +  +  +IE+NLL+P  V    R+     + IY+AE LP MNT+I++N+K A  GE K L D YV+V FAG  G+T V    Y P WN+QI FTE FPP   R++I +RD+D V D  I T F+DL+ I   G K    FLPT GP+W+N+YG+ RTF+   L+   Q  N  L EGV++R RL+I+     + TS    S    V V     +S +  GK E + LFG   E T+I+  +G   KP+ FE++I   GN +D       K    K    E + +H+ ++       D               + YFH+PY  +KPC+++ +  +D + R++  NII+ +  +L + +   + +I  EK    RR L+  +  L    + +    K  +  + +T LD +  +L   ++E + ++ + +  ++K+S V +K++     +  L     +PQ+ +PD+FI+MI    R+AYARI +++I++SS+  EKG  CG + T++L R+          + +Q++++IYLWLGL R  + Y  GLP G+     S        PP  + Y+  + +FQLRV+++ AR++  +D +GLSDPFAR+  S     + +  +T  P WD+ L+ +N+ +F  A + L+  PP +V+EI+D D+    +F+GR F +P V +  + Y   +    L+++ IYRG  AAGE+LAAF+L+++    K      LP +            +   +MD    L +P  IRP LS +R E +L WG+R L+R+ +                  V++P++ I+ AG  ++S  I ++   PNF   + + ++ LP +    PP+ I   +   FG   +VG+ A+++L
Sbjct:   47 MEPSSGRPVDYQVSVTVIEARQLVGLNMDPMVCVEIGEDKKYTSMKESTNCPYYNEYFVFDFHVPPDVMFDKILKVSVIHSKN-----LLRSGTLVGTFKLDVGTIYS-QPHQFYHKWALLSDPDDITAGGKGYVKCDIAVVAKGDTIKTPHKANESDEDDIESNLLLPEGVP-AERQWARYYLKIYKAEGLPRMNTSIMANVKKAFIGENKDLVDPYVQVQFAGQKGKTSVQKSCYEPIWNEQIAFTEMFPPLCRRMKIQLRDSDKVNDVAIGTHFLDLRNISNDGDK----FLPTLGPAWVNMYGSTRTFS---LLDEYQELNDGLGEGVSFRARLLISLGVEILDTSSPEISCSTEVQVEGVPNISESATGKVEEFFLFGSFLEATMIDRKIGD--KPINFEVTI-YYGNEIDGALQPKPKGEKGKGDEEETELIHNSSEEEMEDDGDLTSVATTPPMKPVITDNYFHLPYFERKPCIYIKSLWQDQKRRLYNSNIIDNIADKLEDGLNDVNEIIKTEKAYPERR-LRGVLEELSQGCQFLALANKD-QNQSGRTKLDKERLKLCLSEVEAIGLQAKAMRSQVKKSTVRDKLKLSQNFLSKLRFLADEPQHSVPDVFIWMISNGKRIAYARIPSKDILYSSIDEEKGKDCGKVKTIFL-RIPGKKGFGPAGWTVQSKIEIYLWLGLTRQRKDYLNGLPNGFEENKLSKGPGLPSTPPISLTYMSVKQIFQLRVHMYQARSLFAADSTGLSDPFARVFFSTQSQVTEVLAETLCPTWDQLLVFENVELFGEAVE-LRDDPPIIVIEIYDQDTVGKADFMGRTFAKPVVKMADEHYGPPRFPPQLEYYQIYRGNCAAGEMLAAFELLQIGPNGK----ADLPPI------------DGPTDMDRGPILPVPLGIRPVLSKYRIEQVLFWGLRDLKRVNLAQ----------------VDRPRVDIECAGKGVQSALIPNFKKNPNFSTLVKWFEVDLPENELLHPPLNIRVVDCRAFGRYTLVGSNAVSSL 1025          

HSP 2 Score: 417.157 bits (1071), Expect = 6.319e-119
Identity = 238/573 (41.54%), Postives = 345/573 (60.21%), Query Frame = 2
Query: 4340 MYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDN-FENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVP-GKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAP-IDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEAC--AKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAP 6040
            +YP ELE+  +F  F D   +F L+RGK  +DDD    + DR  G FKG++C+Y +  +   D+  +                                       + +++N+ + +PV+ +VR+Y+++A +LHP+D+NGK+DPYI +KLG  E++D+ENYI K LNP+FG   ++E TFP +S L V IYDWD +  DDLIGET IDLENR+ S H+ +CG+     NHGY  W+D   PT IL  LC++  +  P Y     RV +++R F A T IED++  + K+ E LAL VL HW EI   G KLVPE++ETRPL  P+KPGI+QG +E+WVDM+P     P P +DI+PRK   +ELR  +  T++V L + + FT EK+ DIFV+ W+K    D Q TDVHY S++G+G FNWRFVY FDYL AE+ IV ++K S++  DE EYK P  LN+QV D+    +D  +   +  L++FP+ AK  + C    ++        ++F+ K+++GWWP +   ++++ +          VE E+ L+T EEAE +P G GR EP PLE P
Sbjct: 1112 VYPKELES--EFDNFEDWLHTFYLFRGKAGDDDDQTVADEDRIVGKFKGSMCMYKVSDDAPRDMSFDS-------------------------------------NMGMFQNIPNNDPVNVLVRIYVVRATDLHPADINGKADPYIAIKLGKTEIKDKENYISKQLNPLFG-SFDVEATFPMDSTLTVSIYDWDLVGTDDLIGETKIDLENRFYSKHRATCGVA----NHGYNVWRDPMKPTHILAKLCKDGKLDGPHYGP-GGRVKVENRVFMAPTEIEDENLKK-KTDEHLALCVLTHWEEIPRVGCKLVPEHVETRPLLHPDKPGIEQGRIELWVDMFPKEMTAPGPALDISPRKP-KFELRVIIWNTDEVVLEDDDIFTGEKSSDIFVR-WLKGQQEDKQDTDVHYHSITGEGNFNWRFVYPFDYLMAEEKIVISKKESMFAWDETEYKIPPRLNLQVWDADHFSADDFLA-IELDLNRFPRGAKTAKQCTIEMVTNEAEMPMVSIFKQKRIKGWWPFVARNEEDEFELTGK------VEAELHLLTGEEAEKSPAGEGRNEPEPLEKP 1629          
BLAST of Otoferlin vs. Ensembl Medaka
Match: ENSORLT00000022822.2 (pep primary_assembly:ASM223467v1:21:28315623:28320348:1 gene:ENSORLG00000018220.2 transcript:ENSORLT00000022822.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 335.109 bits (858), Expect = 2.042e-100
Identity = 219/628 (34.87%), Postives = 326/628 (51.91%), Query Frame = 2
Query: 4340 MYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEI-VPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVT 6217
            +Y  ELE   DFG F D   ++ L+RGK  E++ + +  +RF G FK   C+Y +  E+  +  D                                         R+ + +   +PV  ++RVY++ A NLHP+D +GK+DPYI+++LG  E++DR+NYIPK LNPVFG   E++ TFPQES L V IYD+D +  DDLIGET IDLENR+ S H+ +CG +P+ ++ GY  W+D   P+ +L  +C E+ +  P +     ++ + D+ F  +T+   +    ++S E L+L++LH W EI   G KLVPE+IETR LY   +PG+ QG ++MWVDM+P     P  P+DI+PRK   YELR  +  TE V L + NF T +++ DI+VK                                          +V  + +++ +D+ E K P  L +QV D   + SD  +G  +  L  FP  AK  ++C    L+    + ++F+ K+ RGWWP   + +               VE E  LVTAEEAE NPVG  R EP PL  P RPD SF  F+NP+    + +    K  +I   ++F+  L +AL  Y  PG+IS  ++ 
Sbjct:    1 LYNRELE--ADFGQFDDWVNTYELFRGKANEEEGSSD--ERFVGKFKARFCLYKLAEEEWGEGSDPGF-------------------------------------FRVSRGIPANSPVQVLIRVYVVSASNLHPADPDGKADPYIVLRLGKNEIKDRDNYIPKQLNPVFG-SFEMQATFPQESLLSVVIYDFDLVGGDDLIGETRIDLENRFYSRHRATCG-LPTEYSEGYNAWRDSLKPSELLSKMCRENGLDAPRFS--PGKISVADKVFHGKTLYMHE--QPVESYEHLSLKILHRWSEIPAVGCKLVPEHIETRVLYNKARPGMDQGQVQMWVDMFPMDLPHPGPPVDISPRKP-KYELRIIIWNTEDVILDDSNFLTGQQSSDIYVKV----------------------------------------VVVRKRDNIFSLDKTEQKLPAILILQVWDFETLSSDDFLGTLELDLHGFPPGAKTAKACKAEMLTGRTERISIFQQKRARGWWPFSKSGELTGK-----------VEAEFHLVTAEEAEKNPVGRARKEPEPLPKP-RPDTSFSWFMNPFKCFFHLVWRNYKKYIITALILFILALFLALLFYTLPGAISQKMIN 528          
BLAST of Otoferlin vs. Ensembl Medaka
Match: myof (myoferlin [Source:NCBI gene;Acc:101172285])

HSP 1 Score: 293.123 bits (749), Expect = 1.320e-79
Identity = 207/682 (30.35%), Postives = 348/682 (51.03%), Query Frame = 2
Query:  737 SLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGE--GKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDND-MVKDETISTIFIDLQKIMYTGS-------KEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIR--QTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEK-GIMCGMMNTVYLKR-LDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGY 2740
            + K +DFQI V +VEAR L GNNI P+ +V+   Q   T IK   N+PF++E F +++ M   ++ E  I  R +  S ++ A  +     +GEF +D   VY    H   RKW  L DP   +SG KGY+KV + V+  GD+P     D +++  +IE+NLL+P  ++    +   +++ +++AED+P M+   + +IK     E   K L D ++E  FAG    T+++ +N +P+WNQ +    +FP    R+++ V D D +  ++ + T ++DL KI  +G        + E GFLP +GP +INLYG+PR F  T L       N    EGVAYRGR+++ + T     + K   ++      ++ ++  R  Y L    +  ++I E     G+P+ FE+SIG  GN LD   K  +            S TQ   A    N+Y+++P+ N KP + + +  ED   R+   NII  +   L   +   + + L  +  N  A  +L+  +  LI  +E+  +      G +  T LD++ ++  R D+    +K   L +  + S + + + +  T V  L+    +PQ  +PD+ I+M++   RVAY+RI A EI+ S+ + +  G  CG   TV+LK  +D +         +  Q+++ +WLGL  D + +
Sbjct:  170 ATKPQDFQIRVRVVEARQLPGNNIKPVVKVHVCGQTHRTRIK-SGNNPFFDEMFFYNVHMLPSDLFEQSISFR-VYNSYSLRADSL-----MGEFKLDVGYVYDEPAHCVMRKWLLLNDPDDSSSGAKGYLKVSLFVIGTGDEPLVEKRDCDDDQDDIESNLLLPAGMT---LRWATLSLKVFRAEDIPQMDDAFVQSIKEIFGAEENKKNLVDPFLEARFAGKKLCTQIIEKNANPEWNQVLHLQVKFPSMCERVKLTVFDWDRLTGNDAVGTTYLDLAKIASSGGEIEGNPVESEVGFLPVFGPCYINLYGSPREF--TGLPDPYDDLNFGKGEGVAYRGRILVELSTKLDEKAEKTIDNIHIKR--TSIISILRRKYCLCAVFHSASMIQEP----GEPIQFEVSIGNYGNKLDTTCKPLA------------STTQYSCAVFDGNQYYYLPWANTKPVVVLTSFWEDISHRLNAVNIILCITHRLQSNLEAFKVAILAKVPDNKLAEVWLQL-LDQLIEDLERFPT--PELEGCSNLTSLDIQLKK--RRDITLNSIKEAVLRMRQEASEIRDTLSDIETWVDKLKQLAEEPQNSMPDVVIWMLRGEKRVAYSRIPAHEILFSTYSEQACGKNCGKTQTVFLKYPMDKA-----KGLKVPVQIRVSMWLGLSADEKKF 811          

HSP 2 Score: 160.229 bits (404), Expect = 1.162e-38
Identity = 112/416 (26.92%), Postives = 186/416 (44.71%), Query Frame = 2
Query: 2777 FSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKST-IFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGD 4021
            F    P     +    M+ LRVY++ ARN++  D    SDP+A +    H++K+T     T +P WD+TLI +++     P  +   PP+VV+E +D D    +E LGR  C P V +  +   + +L W  I +    AGE+L A +L+  D K+    +  LP ++                  EN   +P+ IRP +     EIL WG+R +                K + +  V+ P + ++  G R+E+  I +    PNF  N++F+ + LP    + PPI +   +   FG K +VG C I +L D ++CD                                I++EG       A +    +    P+ DV      T+E+  P+L + +E E+ DWW+++YA+ G+
Sbjct: 1071 FGANTPTVSCTFDRSYMYHLRVYVYQARNLMSMDKDSFSDPYAHVSFL-HVSKTTEKLKATLNPTWDQTLIFNSVEIYGDPQKIAHRPPDVVLEFYDEDQVGKDEMLGRSICTPLVKLSPEMDQSPRLFWHPIIQKGQRAGEVLVAAELILKD-KSGDSDLPLLPPMR-----------------AENLYMVPQGIRPVVQLTAVEILAWGLRNM----------------KPYQLASVSSPSLVVECGGQRVETAIIKNMKKSPNFPGNILFIKVLLPKDEMYTPPIVLKVIDHRPFGRKPVVGQCTIASLED-FRCDPY-----------------------------VIVSEG-------ARSSKMALMMASPHKDVAI----TMEESSPLL-EAQEKETVDWWSKFYASTGE 1409          
BLAST of Otoferlin vs. Ensembl Medaka
Match: myofl (myoferlin [Source:NCBI gene;Acc:101156429])

HSP 1 Score: 239.58 bits (610), Expect = 8.104e-63
Identity = 188/677 (27.77%), Postives = 317/677 (46.82%), Query Frame = 2
Query:  719 KHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEG--KALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKM-------ADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEK-GIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGL 2719
            K   P + + +DFQI V ++E R L G +I P+  V    +   T ++   N+PF++E F +++ MS  ++                                       ++ H+  RKW  L DP   T G +GY+KV I ++  GD+    +     E  ++E+NLL+P  VS    +   +++ +Y+AED+P  +   +  +K  + GEG  K L D Y+EVSFAG    TK++ +N +P+WNQ I                      VKD+ I T F++L +I ++G   E GFLP +GP ++NLYG+PR   Y  L    +  N    EGVAYRGR+++ + T       K  VD  P + V      +R  Y L    +   ++ E     G P+ FE+++G  GN LD   K             + S T + FA  +DN Y+++P+ + KP + + +  ED   R+   NI+     +L   +      IS ++       +   +++ I  IE++V  + +       T+LD++ + L     E     +  +A  +K     E+ R+  + V  +ED +        +PQ  +PD+ I+M +   RVAYAR+ A +I++SS + +  G  CG + T++++      +  N    I A+L+  +WLGL
Sbjct:  139 KRNKPLASEAQDFQIRVRVIEGRHLPGIDIKPVVRVLFDGKTHRTNVR-GGNNPFFDEMFFYNVNMSLSDL---------------------------------------SDEHAIMRKWLLLKDPDDSTMGARGYLKVSIIIMGTGDEAPIENRLFRAEQDDLESNLLVPAGVS---MRTATLSLKVYRAEDMP-QDDATVQTLKQFLGGEGDKKNLVDPYLEVSFAGKKVCTKIIQKNANPEWNQLISLN-------------------VKDDVIGTTFLNLSQISHSGGNVEVGFLPAFGPCFVNLYGSPR--EYGDLPDRFEELNFGNGEGVAYRGRVLVELSTHLDKKVEK-NVDDIPRDDVLVAQFQRRRRYSLCSVFHSACMLQEP----GGPIRFEVTLGNYGNKLDSTCKP------------LVSTTPNCFA-VFDNHYYYLPWADTKPVVILTSYWEDISHRLDAINILLFTADQLESNLNLLKTAISAKEPESRLTEIWLKLLDHI--IEELV--LPALEDRLNVTVLDLQKKNL----REAAVYNIMQMACCMK-----EEARDIGSTVADIEDWLDRIKQLAEEPQNSMPDVIIWMFRGEKRVAYARVPANQILYSSFSKQACGKHCGKIQTIFMQY----PMDKNKGVKIPAELRFNMWLGL 715          

HSP 2 Score: 210.69 bits (535), Expect = 4.546e-54
Identity = 158/503 (31.41%), Postives = 239/503 (47.51%), Query Frame = 2
Query: 4664 YKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSF----FAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPA-PIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCD----PFQLSEACAKF---NLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEP--MPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILI 6130
            +K L +  P + +VR+Y+++ I +   D NGK DPYI + LG K + DR+NY P TL+P FG   EL  T PQ+  L + +YD+D+ ++D+ +GET IDLE+R LS  +  CG +P  +  G  +W+D   P+ IL+++ +   VP P  ++    +    + +    FA  +I    G +    E L+L VL +         LVPE++ETR L    K  + QG ++MWVD++P    +P  P +I+PRKA  Y LR  +  T  V L + +  T EKT DI+VK                      +  +NW                         D+ EY+ P  L +Q+ D+  I  D  +   +  L +   PAK    C     P       +K    +LF  K VRGWWP        ++         G VE+ +E+V  +EAE  P G GR EP   P   P RP  SF  F N  + +K+  + + +WI +
Sbjct: 1375 FKELPESGPQECLVRIYVVRCIEVQSKDSNGKCDPYIKITLGKKTLDDRDNYKPNTLSPEFGM-FELSCTLPQDKDLKIAVYDFDKWSRDEEVGETVIDLEDRLLSYFRPCCG-LPQTYCSGVNQWRDQLKPSQILQNVAKMRGVPPPSIEEDGRSLLFSGKRYHLQDFANILIHSHLGPE---KERLSLHVLRNL-------GLVPEHVETRTLSSSYKSNLSQGRIQMWVDIFPKRLGLPGPPCEISPRKA-KYFLRVIIWNTSDVILDDAS-ITAEKTSDIYVKQ---------------------EQFWNW-------------------------DKTEYRNPPKLIVQIWDNDRISLDDYLS-VELDLLRLVPPAKTPEKCTLKMLPGMKGTVASKAKPTSLFSRKSVRGWWPC------ANAQNGSCVLTQGKVEMTLEIVDEKEAEERPAGRGRNEPNMNPKLDPPRPATSFAWFTNVSSILKFMTRIKFRWIFV 1810          

HSP 3 Score: 104.375 bits (259), Expect = 1.194e-21
Identity = 99/415 (23.86%), Postives = 172/415 (41.45%), Query Frame = 2
Query: 2783 GKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKST-IFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFE-ILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGD 4021
            G   P    +    ++ LRVY++  RN+   D +  S P+A +    H++K+T +   T +PIWD+TLI ++I  +  P  + S PP VV+E++D D    +E +G     P + ++ +     KLQW  I +    AGE+L A           K+    LP V   +               E    +P+ I+P +     E +L WG+R ++                 F + PV+ P + ++  G  +++  I ++   PNF  + V L   LP    + PPI +   +   FG K +VG C I +L ++    + D +R      +  R++ +    N   D E             AI+E  D                               E+ DWW+++Y+++G+
Sbjct:  965 GAKTPTVSCHFSSYIYHLRVYIYQGRNLCPMDHNSFS-PYAHVSFL-HMSKTTHVIQNTLNPIWDQTLIFEDIEIHGDPQTVASCPPEVVLELYDSDQVGKDEPMGHCKYPPLINLQPNIGCRPKLQWLPITKKGHNAGELLLA------AELLLKLDDDDLPIVPPRR--------------SEKLYMVPQGIKPVVQLTAIEQVLTWGLRNME----------------AFQLSPVSSPSLIVECGGETVKTAIIKNFKKNPNFPGS-VLLLKLLPKEEMYAPPIVLKVIDHKPFGWKPVVGQCTIRSLGEF----RCDPYRTNSDICMSSRAMMADAQENVVIDVE-----------SRAISETRD-------------------------------EAVDWWSKFYSSLGE 1294          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000010367.1 (SMESG000010367.1)

HSP 1 Score: 3776.48 bits (9792), Expect = 0.000e+0
Identity = 2016/2031 (99.26%), Postives = 2021/2031 (99.51%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVTLPSENSSDEDEEYYDSDDGDGRDNNIRDDISDISLLPDRDFKLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAK      PTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHL  LEKN+QARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIII EH+AKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNR+GEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPI+INCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLNDIEINVNSDEDEEDVVDIPDDEPKKKKKKKKKRKKKKRKFKNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERI MYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIDPEDAEDIDDEEEEDDFNDEDDEEEREEKERRREERELEKQEREDEKKKTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPT+ILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKDEDSDEEDGEEIGGCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKIFVIFMALLIIALFIYNFPGSISNAIVTKMFG
Sbjct:    1 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVTLPSENSSDEDEEYYDSDDGDGRDNNIRDDISDISLLPDRDFKLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAK------PTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHL-RLEKNIQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIIGEHVAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRFGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPISINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLNDIEINVNSDEDEEDVVDIPDDEPKKKKKKKKKRKKKKRKFKNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERITMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIDPEDAEDIDDEEEEDDFNDEDDEEEREEKERRREERELEKQEREDEKKKTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTVILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKDEDSDEEDGEEIGGCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKIFVIFMALLIIALFIYNFPGSISNAIVTKMFG 2024          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000010400.1 (SMESG000010400.1)

HSP 1 Score: 2539.99 bits (6582), Expect = 0.000e+0
Identity = 1285/2033 (63.21%), Postives = 1624/2033 (79.88%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXFKLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXNPFQ-PSTKELFLKEEPDNLRMESEYVTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            MSL V L+ L G  QG + +IK++FRD + ++   KT  +   G RF WPIARK+DK D L++K    NR G DKL GV+ I    L+ +  +N+ E  VDE+M+ITDI + FEIEY SP +G++N G   FN P YNL  L+R    + LPS+ SS E +     ++     +    D      L  +RDFKLPKHIDP SLKI+DFQISVTI EARGL G NINP+FEVYCGKQKQ TE+KMQTN+PFYNE+F+FD  +SRLE+ME II+I+ LSK +++V + IF GKV+GEFSIDAK+VY+NE HSFF KWA LIDPK+PTSGEKG+VKVD+SVLCAGDKPKRP+  D EE+PNIEAN+LIP  +  T R +CEM+V +YQAEDLPCMNT I+SNIK AI G+GKAL D YVEVSFAGYTG TKV++R+YSPDWNQQIIFTERFPP+V+RLRIAVRD+DM+KDETIST+FIDL KIM + +KEEEGFLPTYGPSWINLYGTPRT++Y ++IKGDQGQNQNLAEGVA+RGRL+IAIKT+ QPDS KIGVDVR CNPVSN VAGKRE+YLLF  I+E TLI +++GK  KPLTFE+SIG TG   D+Y+ +  +KE   E+QYVHS+T+ ++AYT+DN+YFHIPY++KKPCL+MI  SEDHRPR+FIPNI++KLK+EL E +RQ ++L S  K VQA RY+K S+     SI+KV+S +KSCRGTAKKT+LDVKYQ+LIR+ LEKMK+        L    +   +++ N+ VK L+DKM DPQ+GLPD+F+YMIQ+NIRVAY RI AR++IHS++ PEKG MCGM+NTVYLK+++ S+L   T+YNIQAQLQIYLWLGLL+DMR YKMGLPEG++++CF+ KMPPK IDY++ES FQLRVYL+M RN+IGSDDSGLSDPF ++II EHI KST+F +TRSPIWDET+IIDNI+FNY P ++K+ PP+VV+EIFDWDSDTDEEF+GRVFC+P V+I+GD+YT++KLQWW++YRGT+ AG+IL +FDL+E+D  +K+I V G P+++++ +MT+++NDN  GE DE KLRIP  +RP +  FR E+L+WGVRQLQRIE++  K++  +  KR GIFPVNQP+I I+I GYRI+SD I DW   PNF DNL+ + LRLP +++FWPP++INC N T+FGLKQ+VGN  IT+L++YY  D+++   ++D  +   +S+ +   F+   +++G+ N+ F+N+D     +     +    PDVT PVPG  EK+   +P+ EEMESADWWTRYYAT+GDL D  + K   E L ESES++E+   +     +  +S+++E++VV+IP+D PKKKKKKKKK+KKKK+K    FQ  STKELFLKE  ++L +E E ++DNSWIERI +Y CELEN+KD+GGF  PF+SFSLYRGKQEE+DD +E  DRF GVFKGNICIYN+          E+   + +  D++ +  +     E+ E + +E    +K  L+LYK L D + VDF+VRVY++K INLHP+D+NGK+DPYILV++G+KE+RDRENYIPKTLNP+FG+C E+EVTFPQESFLLVQ+YDWDRLTKDDLIGETTIDLENRWLSPH+G+CG+M +Y+NHGY+KWKD +LPT ILKSLCE++N+P P YDK+ D V+I  ++F +++MIEDDDGSQIKSLEPLAL VLH+W +IVP  KLV E+IETRPLY+ EKPGI+QGLLEMWVDM+P+GTAIP PIDI+PRK   YELR  ++QTE VRL + NFFT EK+VDI++K+WMKSTDIDLQKTD H++SLSGQGLFNWRFV+ FDYLKAED IVY  K++YEIDE EYKTPCFLNMQVLDS ++MSDTIIG+ K RLSKFP+PAK+Y+SCDPFQ S+ACAKFNLF+NKKVRGWWPL+YNPKDED +EE+G EIGG VE+EM+LV  EEAESNP GLGR EP+PLE P RPDGSFL+FLNPWNTIKYFIKYRLKWILIKI ++ + +LII LFIYNFPG+ S  IV K+ G
Sbjct:    1 MSLIVTLQSLTGVKQGQEGFIKVIFRDHQFRTPNFKTKPSTNLGSRFVWPIARKLDKVDSLVIKFILLNRFGPDKLTGVINIVLSTLMVQQCINLDETFVDEQMRITDIALNFEIEYNSPVSGNENLGKSDFNVPSYNLTKLERHEGHIRLPSDTSSVESDSDNGDNEPSDDIDVKDGDNYSELSLLPERDFKLPKHIDPLSLKIKDFQISVTIYEARGLSGKNINPLFEVYCGKQKQCTELKMQTNTPFYNEYFSFDFRISRLELMEQIIRIKALSKKSHIVTRHIFPGKVIGEFSIDAKTVYSNESHSFFYKWAVLIDPKAPTSGEKGWVKVDLSVLCAGDKPKRPNKTDKEEDPNIEANILIPQILCQTQRSICEMSVYVYQAEDLPCMNTKIMSNIKQAILGDGKALADPYVEVSFAGYTGSTKVISRSYSPDWNQQIIFTERFPPYVSRLRIAVRDSDMIKDETISTVFIDLHKIMNSANKEEEGFLPTYGPSWINLYGTPRTYSYAEMIKGDQGQNQNLAEGVAFRGRLLIAIKTTSQPDSIKIGVDVRSCNPVSNNVAGKRELYLLFASIFEATLITQEIGKKRKPLTFELSIGTTGICPDEYSHLP-KKEENFESQYVHSLTEPKYAYTFDNQYFHIPYRSKKPCLYMIAPSEDHRPRLFIPNILDKLKQELCEYVRQVNYLASRGKKVQAMRYIKKSMETFFISIDKVLSAIKSCRGTAKKTLLDVKYQKLIRMGLEKMKMSWSVTIECLSVCTIDMAIKDLNSFVKFLDDKMLDPQHGLPDVFLYMIQDNIRVAYTRILARDLIHSAIPPEKGQMCGMVNTVYLKKMNFSILPQKTNYNIQAQLQIYLWLGLLKDMRLYKMGLPEGFHKDCFTSKMPPKIIDYMEESDFQLRVYLYMGRNLIGSDDSGLSDPFVKVIIGEHIRKSTVFHETRSPIWDETIIIDNIVFNYNPKIVKTCPPDVVLEIFDWDSDTDEEFIGRVFCRPSVFIRGDEYTSSKLQWWNVYRGTMPAGDILVSFDLIEIDPFSKRIYVPGFPSLENLMEMTAQVNDNSKGEKDEEKLRIPFDVRPPIGLFRLELLIWGVRQLQRIEIISPKRHAVIPIKRMGIFPVNQPRIIIEIGGYRIKSDIIEDWWTHPNFNDNLISVILRLPVNSKFWPPMSINCINYTMFGLKQVVGNHVITDLIEYYVEDKIN--EDLDHESDHLQSLTA--QFDMKANSDGVSNKAFDNKDEKGPEKTKAGVKSDAKPDVTNPVPGEPEKLIRFVPK-EEMESADWWTRYYATLGDLDDPNLYKPEDEILVESESEDEIRRDIFLGYRVETHSEDEEDEVVEIPEDIPKKKKKKKKKKKKKKKKRL--FQHKSTKELFLKEVQEHLILEDEKLSDNSWIERIKIYSCELENIKDYGGFKQPFRSFSLYRGKQEEEDDGYEIQDRFAGVFKGNICIYNV---------QEDNIHEKDLFDEDHDESKLASFGEQDENKTEEELLNEKSNLKLYKFLSDPHSVDFIVRVYVVKGINLHPADINGKADPYILVRIGNKEIRDRENYIPKTLNPIFGRCFEMEVTFPQESFLLVQVYDWDRLTKDDLIGETTIDLENRWLSPHRGTCGLMSTYNNHGYMKWKDSQLPTAILKSLCEKNNIPPPKYDKMNDTVEIMGKTFNSDSMIEDDDGSQIKSLEPLALVVLHNWEDIVPECKLVKEHIETRPLYLQEKPGIEQGLLEMWVDMFPSGTAIPPPIDISPRKPASYELRIVILQTENVRLTDTNFFTKEKSVDIYLKAWMKSTDIDLQKTDTHFRSLSGQGLFNWRFVFQFDYLKAEDSIVYKNKNIYEIDENEYKTPCFLNMQVLDSDLLMSDTIIGRLKFRLSKFPKPAKYYKSCDPFQHSDACAKFNLFKNKKVRGWWPLVYNPKDEDEEEENGLEIGGTVEMEMDLVLGEEAESNPAGLGREEPLPLEKPNRPDGSFLNFLNPWNTIKYFIKYRLKWILIKILIVLIFVLIIVLFIYNFPGNFSRVIVDKITG 2016          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000010367.1 (SMESG000010367.1)

HSP 1 Score: 2262.65 bits (5862), Expect = 0.000e+0
Identity = 1231/1237 (99.51%), Postives = 1235/1237 (99.84%), Query Frame = 2
Query: 2519 MIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLXXXXXXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXXXXXNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIVTKMFG 6229
            MIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIII EH+AKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNR+GEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPI+INCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLNDIEINVNSDEDEEDVVDIPDDEPKKKKKKKKKRKKKKRKFKNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERI MYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIDPEDAEDIDDEEEEDDFNDEDDEEEREEKERRREERELEKQEREDEKKKTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPT+ILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKDEDSDEEDGEEIGGCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKIFVIFMALLIIALFIYNFPGSISNAIVTKMFG
Sbjct:    1 MIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIIGEHVAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRFGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPISINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDMKEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDSTIVKEVIEKLSESESDEEVTGFVLNDIEINVNSDEDEEDVVDIPDDEPKKKKKKKKKRKKKKRKFKNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERITMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIDPEDAEDIDDEEEEDDFNDEDDEEEREEKERRREERELEKQEREDEKKKTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTVILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEACAKFNLFRNKKVRGWWPLIYNPKDEDSDEEDGEEIGGCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKIFVIFMALLIIALFIYNFPGSISNAIVTKMFG 1237          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000010367.1 (SMESG000010367.1)

HSP 1 Score: 1177.93 bits (3046), Expect = 0.000e+0
Identity = 616/616 (100.00%), Postives = 616/616 (100.00%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFKLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEK 1984
            MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVTLPSENSSDEDEEYYDSDDGDGRDNNIRDDISDISLLPDRDFKLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEK
Sbjct:    1 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVTLPSENSSDEDEEYYDSDDGDGRDNNIRDDISDISLLPDRDFKLPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDADDNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIGVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEK 616          
BLAST of Otoferlin vs. Planmine SMEST
Match: SMESG000037807.1 (SMESG000037807.1)

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 496/1320 (37.58%), Postives = 781/1320 (59.17%), Query Frame = 2
Query:  137 MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWPIARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLVDERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFK--------LPKHIDPQSLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFYNEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAKSVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGD----KPK----RPDADDNEENPNIEANLLIPLCV-SNTPRKMCEMAVLIYQAEDLPCMNTNIISNIKHAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPFVTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWINLYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKI--GVDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIGITGNLLDDYAKVASEKEPTPENQ--------YVHSMTQSRFAYTYDNKYFHIPYKNKKPCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARRYLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVKLQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENIRVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQAQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQLRVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLIIDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGDQYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIKKMTSEINDNRY-------------------GEMDENK-----------LRIPEFIRPHLSTFRFEILMWGVRQLQRIEVVHLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNLVFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQVDNFREIDKTTIDERSVKSLNLFNAGND-------TEGILNEGFENEDGSAINELTDMKEEKPN 3904
            M+L +NLKY+D      D+ +K+ FRD EK +  ++   +IYFG++F WP+ RK+D  D L L+ Y  ++   +KL+G + I+   L+ +  ++ +ENL+D    I  I V+FE+ Y+SP +   N+  D F  P+ + K        +      S         + +    +    D+ S  S   D  F         +P  + P   K ED+QIS+T++EAR L G NINP+ EV  G++ + TE++M TNSP+YN++  F+  MS+ E+ + +I++R L+  N  ++ R+  G ++GEF +D ++VY    H F  KWA L+DPK   SG KGYVKVD++++  G+    KPK    +P  +D+E+   IEANLL+P  + + T R+M E+ V IY+AEDLP MNT+I++ IK AI G+ K L D +V+VSFAG+TGRTKV    Y+P+WN++I+FTE FP    R+R++V D D V +E I+T +IDL +IM  G   + GFLPT+GPSW+NLYGTPR +TY Q+++  +  N+ L EGVAYRGRL+IAIKT  + +S  +  G  V    P+S+   GK+E +LL G  YE ++I+ ++GK  +P+ FE+S+G TGN LD  A    EKE    NQ        + HS T+     T D +YFH+ +  KKPCL+MI+  EDH+ R FIPNI+EKLK E S  + +  H + + +       +K ++   I +IE  ++ +K  R  + KT+LD +  +L ++ LEKM+VK + +  +  ++N+  +++EC  ++K L + + +PQ GLPDIFI++IQ+  R+A+ARI AREI++S++  EKG+    + TV+L++     +   + + +Q QL++YLWLGLLRDM+ ++ GLP GY+ +CF  + PP  I Y ++S FQLR ++FMARN+IGSD+SGLSD FARI++++H+  + +  +T SP WD+TLIID++IF Y+ D++ S+PP +VVE+FD D     EFLGR FC+P V ++ ++Y + +L WW IYRG + AGE+LAAF+L+++          G+P ++ + + +S I   R                    G++  N+           + +P+ IRP L  +R E L WGVR++QR++++                 V++P+ITI+     + SD I    ++PNF + L ++D+ LP +  +WPP+ I C +   FG   ++GN  I+N+  Y    ++       K   +  S    N      D        EG+ N  + +++ +A   L+  ++   N
Sbjct:    1 MALVLNLKYVDNLDNRCDRIVKINFRDFEKTTKVVRGKDSIYFGEQFQWPMGRKLDPIDTLELRLYQYSKYLNNKLIGSMTISLQKLLEDYKISYKENLIDSNHSIIRITVSFELTYYSPDSQIANWRQDEFENPITDRKLSDADDISIDSHGMGSDKRTLIDPQTGEIGEFNYGQTDNESVESGEDDESFAATNARTLGVPLALHPTLHKTEDWQISITVIEARQLAGANINPLIEVRIGEKTKTTEVQMSTNSPYYNQYLCFEFHMSKAELFDQVIRLRCLAMGNMAIS-RLLPGDLIGEFRMDVRTVYNAPDHMFLHKWAMLVDPKDILSGAKGYVKVDLTIMGKGEQVKHKPKSATKKPKDNDDED---IEANLLLPQTIKTGTKRQMAEICVKIYKAEDLPRMNTDIMATIKMAITGDSKPLVDPFVQVSFAGHTGRTKVKKNTYTPEWNEEIVFTEMFPTLCNRIRVSVYDWDTVFNECIATHYIDLSQIMNEG---DTGFLPTFGPSWVNLYGTPRNYTYDQMMRPKEELNRGLGEGVAYRGRLLIAIKTVLRSESGGLPAGAKVYSVPPISDGTCGKKEPFLLIGAFYEASVIDSEIGKKKQPIYFELSVGTTGNRLDSEANEEEEKEVPSVNQGNRPKIPKWCHSTTEPMLPDTNDQEYFHLSFNEKKPCLYMISYHEDHKSRDFIPNILEKLKNEFSNAV-EILHELHMNERRGTHLRMKNALDTFIENIESSLNSIKCVRHVSPKTLLDKERIKLTKVCLEKMRVKAKTMYQDCTKANLAIRLKECRAIIKKLNELIPNPQNGLPDIFIWLIQDTKRMAFARIPAREILYSAIPEEKGVKNSEVVTVFLQKPGRFGMG-PSGWTLQGQLKMYLWLGLLRDMKTFQQGLPLGYSNDCFKFRRPPMEIIYTEKSYFQLRAHMFMARNLIGSDESGLSDAFARILVNDHVVTTKVVYETLSPKWDQTLIIDHMIFYYSKDLIMSNPPVLVVEMFDEDQMGKSEFLGRCFCKPTVALEEEEYKSPRLTWWEIYRGQMNAGELLAAFELIQVFPDEGYRLANGIPRIEQMIRSSSPIGSLRSNSVFSQKELLLANMEGDINGDITPNEGVTVTAEGHFVVPVPKEIRPSLVPYRVEFLFWGVREMQRVQLMS----------------VDKPRITIEFGSSHLISDVIPSCKVKPNFSNPLKYMDIMLPENLLYWPPLMIQCEDLRQFGRTILIGNHVISNVTKYVIKGKIPTEEPAKKVITNTSSPNQQNNLETPEDKIAIPAIIEGVDNPAYIDDETTAAGNLSSARKSSTN 1295          

HSP 2 Score: 544.658 bits (1402), Expect = 2.227e-159
Identity = 291/638 (45.61%), Postives = 412/638 (64.58%), Query Frame = 2
Query: 4325 IERIMMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGNICIYNIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKLGDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDDLIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCEEHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHHWHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAG-TAIPAPIDITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDIDLQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQK-SVYEIDECEYKTPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSE--ACAKFNLFRNKKVRGWWPLIY----NPKXXXXXXXXXXXXXXCVELEMELVTAEEAESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKXXXXXXXXXXXXXXXYNFPGSISNAIV 6214
            IER  +YPC LE VK+F GF    ++F L +G+Q++D+++ +N  R  G FKGN+ IY +D E+     D                                        L LYK+L + +PV  +VR+Y+I+A +LHP+D NGKSDPY+L++LG+K + ++ENYIPK LNP+FGKC EL+V FPQES LL+Q+ DWD ++ DD+IGET IDLENR+ S H+  CG+   + NHGY KW+D +LPT++L  LC+E+    P Y+ L ++V + + +F+A+  IE+D+G + +S EPLALEV+ +W ++  G  LVPE++ETRPL+  EKPGIQQG LEMW+DM+P    A P PIDI PR+ I YELR  +  TE V L +    T EK+ DIFVK WMK   ID Q TDVHY+SLSG+G FNWRF++NFDY+KAED IVY  K S + IDE E K+PC L +QV D+ ++ +D  +G  +  LSK P+ AK  ++C   QL++  + +  ++F+NK+ RGWWP       +PK+ D + +        ++ E +L++ EE E+ PVGLGR EP  L +P RPD SFL+F+NP  ++KY I  + KW LIK  +I   L ++ LFIYN PG ++  ++
Sbjct: 1562 IERFKVYPCPLEEVKEFEGFAAFIQTFPLQKGRQDDDEESSDN--RIVGNFKGNLNIYKVDDEEFGVEVDVH-------------------------------------KLMLYKSLPNNDPVQILVRIYVIRANDLHPADPNGKSDPYLLLRLGNKVINEKENYIPKQLNPIFGKCFELDVKFPQESNLLIQVMDWDLVSGDDIIGETKIDLENRYYSKHKALCGLGQIFENHGYNKWRDIQLPTMMLAKLCKEYGFDPPKYEALVNKVTVAEVAFYADAEIEEDNGEKKQSNEPLALEVMKNWSKVPNGCLLVPEHMETRPLFNSEKPGIQQGSLEMWIDMFPKELGAPPLPIDIAPRQPISYELRVIIWNTEDVILSDGGVLTGEKSSDIFVKGWMKGLGIDDQVTDVHYRSLSGEGNFNWRFIFNFDYIKAEDKIVYKIKDSPFAIDETEIKSPCKLYLQVWDADLVTADDFLGGLELILSKIPRGAKSPQTCGLHQLNKDGSVSTISIFKNKRYRGWWPFTGENEDDPKELDVNGK--------LDAEFQLLSKEEGEACPVGLGRNEPNALPSPNRPDSSFLNFMNPLKSLKYLICNKFKWFLIKALIISALLALLVLFIYNAPGYLAKRML 2152          
The following BLAST results are available for this feature:
BLAST of Otoferlin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OTOF4.668e-17833.72otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
OTOF6.135e-17833.72otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
FER1L63.748e-15631.17fer-1 like family member 6 [Source:HGNC Symbol;Acc... [more]
OTOF2.603e-14341.06otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
OTOF2.113e-14040.60otoferlin [Source:HGNC Symbol;Acc:HGNC:8515][more]
back to top
BLAST of Otoferlin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fer-14.502e-2427.06Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-15.170e-2427.06Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
fer-15.170e-2427.06Sperm vesicle fusion protein fer-1 [Source:UniPro... [more]
snt-52.873e-835.71SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700... [more]
snt-53.068e-835.71SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:O16700... [more]
back to top
BLAST of Otoferlin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfr3.928e-8233.69gene:FBgn0266757 transcript:FBtr0273291[more]
mfr5.791e-7833.69gene:FBgn0266757 transcript:FBtr0273287[more]
mfr1.408e-7733.69gene:FBgn0266757 transcript:FBtr0273290[more]
mfr1.872e-7733.69gene:FBgn0266757 transcript:FBtr0273289[more]
mfr1.254e-7433.92gene:FBgn0266757 transcript:FBtr0273285[more]
back to top
BLAST of Otoferlin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otofa4.031e-14634.17otoferlin a [Source:NCBI gene;Acc:557476][more]
otofa3.949e-14434.17otoferlin a [Source:NCBI gene;Acc:557476][more]
otofb3.682e-13834.30otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
fer1l68.196e-14631.30fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GE... [more]
fer1l48.376e-14429.42fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Otoferlin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2v21.183e-17232.88ubiquitin conjugating enzyme E2 V2 [Source:Xenbase... [more]
ube2v22.429e-16132.20ubiquitin conjugating enzyme E2 V2 [Source:Xenbase... [more]
ube2v23.586e-16032.48ubiquitin conjugating enzyme E2 V2 [Source:Xenbase... [more]
FER1L65.136e-16029.69fer-1-like family member 6 [Source:NCBI gene;Acc:1... [more]
FER1L67.430e-15229.81fer-1-like family member 6 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Otoferlin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Otof3.777e-17933.62otoferlin [Source:MGI Symbol;Acc:MGI:1891247][more]
Otof8.625e-17933.62otoferlin [Source:MGI Symbol;Acc:MGI:1891247][more]
Fer1l65.627e-15629.89fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:M... [more]
Fer1l65.627e-15629.89fer-1-like 6 (C. elegans) [Source:MGI Symbol;Acc:M... [more]
Fer1l42.326e-13828.24fer-1-like 4 (C. elegans) [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Otoferlin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SPC5|OTOF_DANRE5.207e-18034.17Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1[more]
sp|Q9ESF1|OTOF_MOUSE6.489e-17833.62Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV... [more]
sp|Q9HC10|OTOF_HUMAN2.242e-17733.72Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=... [more]
sp|Q9ERC5|OTOF_RAT3.380e-17733.53Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE... [more]
sp|Q2WGJ9|FR1L6_HUMAN1.800e-15531.17Fer-1-like protein 6 OS=Homo sapiens OX=9606 GN=FE... [more]
back to top
BLAST of Otoferlin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3PC420.000e+034.88Otoferlin b OS=Gasterosteus aculeatus OX=69293 PE=... [more]
A0A5N4D7Q00.000e+033.74Otoferlin OS=Camelus dromedarius OX=9838 GN=Otofer... [more]
A0A5N4D7X00.000e+033.54Otoferlin OS=Camelus dromedarius OX=9838 GN=Otofer... [more]
A0A2D0RKB50.000e+033.83otoferlin-like isoform X2 OS=Ictalurus punctatus O... [more]
A0A2D0RLD50.000e+033.74otoferlin-like isoform X1 OS=Ictalurus punctatus O... [more]
back to top
BLAST of Otoferlin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otofa5.816e-17833.65otoferlin a [Source:NCBI gene;Acc:557476][more]
otofb9.892e-17533.56otoferlin b [Source:ZFIN;Acc:ZDB-GENE-110406-5][more]
fer1l64.552e-14630.90fer-1 like family member 6 [Source:ZFIN;Acc:ZDB-GE... [more]
fer1l41.822e-10535.60fer-1 like family member 4 [Source:ZFIN;Acc:ZDB-GE... [more]
dysf4.240e-9442.47dysferlin, limb girdle muscular dystrophy 2B (auto... [more]
back to top
BLAST of Otoferlin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008905.11.702e-13831.06pep scaffold:Pmarinus_7.0:GL477019:1719:83156:1 ge... [more]
ENSPMAT00000004363.13.226e-15233.67pep scaffold:Pmarinus_7.0:GL477737:887:58689:-1 ge... [more]
ENSPMAT00000001654.11.681e-14247.57pep scaffold:Pmarinus_7.0:GL479999:3392:42224:1 ge... [more]
ENSPMAT00000001770.12.537e-7830.23pep scaffold:Pmarinus_7.0:GL479034:2422:33544:1 ge... [more]
ENSPMAT00000002265.11.037e-6136.05pep scaffold:Pmarinus_7.0:GL483084:292:10410:1 gen... [more]
back to top
BLAST of Otoferlin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TCB38.346e-626.97Cortical ER protein involved in ER-plasma membrane... [more]
back to top
BLAST of Otoferlin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474152.326e-17532.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430881.056e-8834.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368634.907e-7629.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341411.013e-7236.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368661.730e-7027.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Otoferlin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otofa8.381e-17833.69otoferlin [Source:NCBI gene;Acc:101155482][more]
otofb4.380e-17233.43otoferlin-like [Source:NCBI gene;Acc:101160130][more]
ENSORLT00000022822.22.042e-10034.87pep primary_assembly:ASM223467v1:21:28315623:28320... [more]
myof1.320e-7930.35myoferlin [Source:NCBI gene;Acc:101172285][more]
myofl8.104e-6327.77myoferlin [Source:NCBI gene;Acc:101156429][more]
back to top
BLAST of Otoferlin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010367.10.000e+099.26SMESG000010367.1[more]
SMESG000010400.10.000e+063.21SMESG000010400.1[more]
SMESG000010367.10.000e+099.51SMESG000010367.1[more]
SMESG000010367.10.000e+0100.00SMESG000010367.1[more]
SMESG000037807.12.227e-15937.58SMESG000037807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000223 ID=SMED30000223|Name=Otoferlin|organism=Schmidtea mediterranea sexual|type=transcript|length=6318bp
GTTGACTAAGGGCCACGTGGTGCGCGTTTAGTGATTTTGGTGCTGATAAA
AATCATTTTACAGAATTGCCAAAAATCGATATCAGAATTGTGTTTAAGAG
TAAACATTTTGCTTATTTGTTTACTATTGGATAAACATGTCACTGAGCGT
CAATTTGAAGTATTTGGACGGCGCCGCTCAAGGCGGGGATAAATATATCA
AGCTCATGTTTCGAGATGTGGAGAAAAAGTCTAACAGATTAAAAACCAGC
GCAAATATCTATTTCGGCCAACGCTTCAACTGGCCCATTGCCCGAAAAAT
GGATAAAAATGACATTTTGATCCTGAAATGTTACAATGCAAACCGAGTCG
GAGGGGACAAATTACTCGGTGTGCTACAAATTGCTACTGGGAATCTGATA
AATGAACCTTCTATGAACGTTCGAGAAAACTTGGTGGACGAAAGAATGAA
AATAACAGATATTATTGTCGCGTTTGAAATCGAATACTTCTCCCCTTCAA
CTGGCAGTGACAACTTCGGAAGTGACGCATTCAATTTTCCCGTTTACAAC
TTGAAAACTTTGAAAAGAACTTCTAAAAAAGTTACGCTCCCATCGGAAAA
TTCTAGTGATGAAGACGAAGAATACTACGACAGCGACGATGGAGATGGAA
GAGACAATAACATCCGAGATGACATATCAGACATTTCTTTACTACCAGAT
AGAGACTTCAAACTGCCGAAGCACATTGATCCTCAGTCTCTTAAGATAGA
AGACTTTCAAATCTCCGTAACCATTGTTGAGGCGAGAGGTCTTTGTGGAA
ATAACATTAATCCGATGTTTGAAGTATATTGTGGAAAACAGAAACAGAAC
ACTGAAATCAAAATGCAAACCAATTCTCCGTTTTATAACGAGTTTTTCAC
ATTTGATTTGACGATGTCACGGTTGGAAATGATGGAGCTAATCATTAAGA
TAAGAGGTCTTTCAAAAAGTAACAACGTAGTCGCACAGAGAATATTTACA
GGGAAAGTTTTGGGGGAATTTTCAATTGATGCAAAATCCGTTTATACAAA
TGAAGGTCATTCTTTTTTCCGAAAATGGGCACCATTAATAGATCCAAAAT
CACCAACATCGGGAGAAAAAGGTTATGTTAAAGTAGATATTTCTGTTTTG
TGTGCCGGAGACAAACCAAAGAGGCCCGATGCAGATGATAATGAAGAAAA
TCCAAACATCGAAGCAAATCTTCTCATTCCTCTTTGCGTAAGCAATACCC
CTCGAAAAATGTGTGAAATGGCCGTATTAATTTATCAAGCCGAAGACTTA
CCTTGTATGAATACCAATATTATCTCCAATATTAAACACGCTATTTACGG
AGAAGGAAAGGCTTTAACTGATGCTTACGTCGAAGTGTCTTTCGCCGGTT
ATACGGGCAGAACCAAAGTTGTTAACCGGAACTATTCCCCGGATTGGAAC
CAACAAATAATATTTACGGAAAGATTCCCTCCGTTTGTTACCAGATTGCG
TATAGCAGTTCGAGATAATGACATGGTAAAAGATGAAACAATTTCCACAA
TTTTTATTGATCTCCAAAAAATTATGTACACCGGTAGTAAAGAAGAGGAA
GGCTTTCTACCAACTTACGGACCAAGTTGGATAAATCTTTATGGAACACC
TAGAACATTTACCTACACTCAGTTGATTAAAGGGGATCAAGGACAAAATC
AGAATCTTGCAGAAGGGGTCGCTTATAGAGGAAGACTCATGATTGCAATT
AAGACATCATATCAACCAGACAGTTCGAAGATTGGAGTTGACGTACGACC
ATGTAACCCTGTATCAAATACGGTCGCCGGCAAACGGGAAATGTATCTAT
TGTTTGGTGGAATATATGAAACTACTTTGATCAACGAGGATTTGGGTAAA
AATGGAAAACCATTGACATTTGAAATGTCCATTGGAATAACCGGAAACCT
CCTTGACGATTATGCAAAAGTTGCATCTGAAAAAGAGCCTACCCCTGAAA
ACCAGTATGTCCACAGCATGACACAATCTAGATTCGCTTATACATATGAC
AATAAATATTTCCACATTCCTTACAAAAACAAGAAACCTTGTCTCTTTAT
GATCACCCAAAGTGAGGATCACCGGCCAAGAATGTTCATTCCCAATATTA
TTGAGAAATTAAAACGAGAATTGAGCGAAATCATCCGACAAACATCTCAT
CTTATAAGCCTTGAAAAGAACGTCCAGGCCAGACGATACCTAAAAACGAG
TATTATAAATTTAATTCCCAGCATTGAAAAAGTGGTATCCGGAGTGAAGT
CGTGTCGAGGAACAGCAAAAAAGACCATGCTTGACGTGAAATATCAAAGG
CTGATTAGACTAGATTTGGAAAAAATGAAGGTAAAACTTCAGAATCTCGC
ACTAGAACTCAAAAGATCCAATGTGTATGAAAAAATGCGCGAGTGCAATA
CATTAGTAAAGTTATTAGAAGATAAAATGGCGGATCCTCAATACGGATTG
CCAGACATATTCATATACATGATTCAAGAAAATATTAGAGTAGCCTATGC
TAGAATAAAAGCCAGAGAAATTATCCACTCCTCAATGGCCCCAGAAAAGG
GAATCATGTGCGGAATGATGAACACAGTCTACCTAAAAAGACTGGACAAC
TCGTTATTGAAATTGAATACTTCTTATAACATCCAAGCTCAACTGCAAAT
ATATTTATGGCTAGGACTGTTGAGAGACATGCGTGGATATAAAATGGGCC
TCCCAGAAGGTTACAATCGGGAATGTTTTAGTGGGAAAATGCCTCCAAAA
TATATTGATTACCTCGACGAAAGTATGTTTCAATTGAGAGTCTACCTCTT
TATGGCTCGCAACGTCATTGGATCCGATGATTCTGGCCTTTCTGACCCTT
TTGCCAGAATCATCATTAGTGAGCATATAGCCAAATCTACAATTTTCACA
CAGACTCGAAGTCCAATTTGGGATGAAACTTTGATCATTGACAACATAAT
ATTTAATTACGCTCCTGATGTATTGAAATCTTCTCCACCAAATGTCGTTG
TTGAAATCTTTGATTGGGATTCCGATACCGACGAAGAATTTCTTGGACGA
GTATTTTGCCAACCAAAGGTCTACATCAAAGGCGACCAATATACAACAGC
TAAGTTGCAATGGTGGAGCATCTACAGGGGTACTTTAGCCGCAGGAGAAA
TTTTGGCTGCATTCGATCTTGTCGAAATGGACATGAAAACAAAAAAAATT
ACCGTTAAAGGCCTGCCAACAGTAAAGGATATTAAAAAAATGACATCGGA
AATAAACGACAATAGATACGGAGAAATGGATGAAAATAAACTAAGAATTC
CTGAGTTTATAAGACCCCATTTATCAACATTTAGATTCGAGATCTTAATG
TGGGGAGTAAGGCAGTTACAACGAATAGAAGTAGTCCATTTGAAAAAGAA
TCCTTTTGTTGCTTCTAAACGATTTGGAATATTCCCAGTAAATCAACCTA
AGATCACCATTGACATTGCCGGATACAGAATCGAGTCGGATAAAATTACA
GATTGGACAATTCAACCAAATTTCGAAGATAACCTAGTTTTTTTGGACCT
GAGGTTACCCACAAGCACACAGTTCTGGCCTCCGATAGCGATTAACTGCA
CTAATAGCACCGTGTTTGGGTTGAAGCAAATTGTCGGAAACTGCGCCATT
ACAAACTTAGTTGACTACTATCAATGTGATCAAGTTGATAACTTCAGAGA
AATAGATAAAACTACGATTGACGAAAGAAGTGTAAAAAGTCTAAACTTAT
TTAATGCTGGAAATGATACAGAAGGGATTTTGAATGAAGGATTTGAAAAT
GAGGACGGATCAGCAATAAATGAATTGACAGATATGAAGGAGGAAAAACC
TAACCCTGACGTTACGGCTCCAGTCCCAGGAACAGTGGAAAAAGTGAAAC
CGGTACTGCCACAGACGGAGGAAATGGAGTCCGCGGACTGGTGGACAAGA
TATTATGCAACAATCGGAGATTTAGGAGATTCCACTATTGTAAAGGAAGT
CATTGAAAAATTATCCGAAAGTGAGAGTGACGAAGAAGTGACTGGATTCG
TACTCAACGACATCGAAATTAATGTGAACAGCGACGAGGACGAAGAGGAT
GTAGTTGATATACCTGACGATGAACCAAAAAAAAAGAAGAAAAAAAAGAA
AAAAAGAAAGAAGAAAAAGCGAAAATTTAAAAACCCTTTTCAACCTTCTA
CCAAAGAATTATTCCTAAAGGAAGAGCCGGATAATTTGAGGATGGAAAGT
GAATATGTTACAGACAATTCATGGATAGAAAGAATAATGATGTATCCTTG
CGAGCTGGAAAATGTAAAAGATTTTGGAGGATTTCATGATCCATTCAAAT
CGTTCTCACTATACCGGGGCAAACAGGAAGAAGACGATGATAATTTTGAA
AACCCCGACCGTTTCGGTGGAGTATTTAAAGGTAACATCTGCATTTATAA
TATTGACCCAGAAGATGCCGAAGACATAGACGATGAAGAAGAAGAGGATG
ATTTTAATGACGAAGATGATGAAGAAGAAAGAGAAGAAAAAGAACGCAGA
AGAGAAGAACGAGAACTCGAAAAACAAGAGAGAGAAGATGAAAAAAAGAA
AACCTTAAGGTTATATAAAAATTTACGAGACATCAACCCAGTGGATTTCG
TTGTCAGAGTTTATATAATAAAGGCAATCAATCTCCATCCATCGGATTTA
AATGGGAAATCTGATCCCTATATTTTGGTGAAATTGGGCGACAAAGAAGT
GAGAGACCGGGAAAACTATATTCCAAAGACGTTGAATCCAGTTTTTGGAA
AATGCATTGAACTAGAAGTTACATTCCCGCAAGAAAGCTTTCTATTGGTT
CAAATTTACGATTGGGATCGACTGACTAAGGATGACTTGATTGGTGAAAC
GACGATAGATTTGGAAAACCGATGGCTCAGCCCCCATCAAGGTTCTTGCG
GAATAATGCCGTCCTATCACAATCATGGCTATTTGAAATGGAAAGATTAC
AGACTTCCAACAATCATATTGAAGTCTCTGTGTGAAGAGCATAATGTCCC
ACTTCCAATATACGATAAACTGACGGATCGTGTTGACATAGACGATCGCA
GCTTCTTTGCCGAAACGATGATAGAAGATGACGACGGATCTCAAATAAAG
TCATTGGAACCGTTAGCCTTAGAGGTATTGCACCACTGGCATGAAATCGT
ACCAGGAAAAAAGCTCGTTCCAGAATACATAGAAACAAGACCTTTGTATA
TGCCAGAGAAACCGGGTATTCAACAAGGTCTCTTGGAAATGTGGGTGGAC
ATGTACCCAGCCGGAACTGCAATACCTGCTCCGATAGACATTACTCCTAG
AAAAGCAATCGGTTACGAGCTAAGGTGTACCGTAATACAAACGGAAAAAG
TACGTTTAATAAATGTAAACTTTTTCACAAATGAGAAAACTGTTGATATC
TTTGTCAAATCCTGGATGAAATCTACAGACATTGACCTACAGAAAACCGA
TGTCCATTACAAATCTTTATCTGGCCAAGGGTTGTTCAATTGGCGTTTCG
TTTACAATTTTGACTATTTGAAAGCGGAAGATTGTATTGTTTATACTCAA
AAAAGTGTCTACGAAATAGACGAATGCGAATATAAAACTCCCTGTTTTCT
CAACATGCAAGTCCTAGATTCAGGAATTATTATGTCTGACACAATAATCG
GTAAATTTAAATGTAGACTAAGCAAATTTCCTCAGCCAGCAAAGTTCTAC
AGATCCTGCGATCCGTTTCAACTTTCTGAAGCGTGCGCTAAATTTAATCT
TTTTAGAAATAAAAAGGTTAGAGGATGGTGGCCATTGATTTACAACCCAA
AGGATGAAGATTCAGATGAAGAAGACGGTGAAGAAATCGGGGGTTGTGTG
GAATTGGAAATGGAATTGGTCACAGCAGAAGAAGCAGAGTCAAATCCTGT
CGGACTGGGGAGGGCAGAGCCGATGCCGCTAGAAGCACCAATGAGACCCG
ACGGATCGTTCCTCAGCTTCCTCAATCCGTGGAACACCATCAAATACTTT
ATAAAGTACCGATTGAAATGGATCTTGATAAAGATTTTTGTCATTTTTAT
GGCTTTATTGATCATTGCTCTTTTCATTTACAATTTTCCCGGAAGCATTT
CCAATGCAATTGTAACCAAAATGTTTGGATAGATATTACCTTTGGATTTG
ACCTCTTCAATAATCAGATGACCTTTATGCATGCCTGTTGACCTTTACAT
TTTGTATGAACGATATGT
back to top

protein sequence of SMED30000223-orf-1

>SMED30000223-orf-1 ID=SMED30000223-orf-1|Name=SMED30000223-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2032bp
MSLSVNLKYLDGAAQGGDKYIKLMFRDVEKKSNRLKTSANIYFGQRFNWP
IARKMDKNDILILKCYNANRVGGDKLLGVLQIATGNLINEPSMNVRENLV
DERMKITDIIVAFEIEYFSPSTGSDNFGSDAFNFPVYNLKTLKRTSKKVT
LPSENSSDEDEEYYDSDDGDGRDNNIRDDISDISLLPDRDFKLPKHIDPQ
SLKIEDFQISVTIVEARGLCGNNINPMFEVYCGKQKQNTEIKMQTNSPFY
NEFFTFDLTMSRLEMMELIIKIRGLSKSNNVVAQRIFTGKVLGEFSIDAK
SVYTNEGHSFFRKWAPLIDPKSPTSGEKGYVKVDISVLCAGDKPKRPDAD
DNEENPNIEANLLIPLCVSNTPRKMCEMAVLIYQAEDLPCMNTNIISNIK
HAIYGEGKALTDAYVEVSFAGYTGRTKVVNRNYSPDWNQQIIFTERFPPF
VTRLRIAVRDNDMVKDETISTIFIDLQKIMYTGSKEEEGFLPTYGPSWIN
LYGTPRTFTYTQLIKGDQGQNQNLAEGVAYRGRLMIAIKTSYQPDSSKIG
VDVRPCNPVSNTVAGKREMYLLFGGIYETTLINEDLGKNGKPLTFEMSIG
ITGNLLDDYAKVASEKEPTPENQYVHSMTQSRFAYTYDNKYFHIPYKNKK
PCLFMITQSEDHRPRMFIPNIIEKLKRELSEIIRQTSHLISLEKNVQARR
YLKTSIINLIPSIEKVVSGVKSCRGTAKKTMLDVKYQRLIRLDLEKMKVK
LQNLALELKRSNVYEKMRECNTLVKLLEDKMADPQYGLPDIFIYMIQENI
RVAYARIKAREIIHSSMAPEKGIMCGMMNTVYLKRLDNSLLKLNTSYNIQ
AQLQIYLWLGLLRDMRGYKMGLPEGYNRECFSGKMPPKYIDYLDESMFQL
RVYLFMARNVIGSDDSGLSDPFARIIISEHIAKSTIFTQTRSPIWDETLI
IDNIIFNYAPDVLKSSPPNVVVEIFDWDSDTDEEFLGRVFCQPKVYIKGD
QYTTAKLQWWSIYRGTLAAGEILAAFDLVEMDMKTKKITVKGLPTVKDIK
KMTSEINDNRYGEMDENKLRIPEFIRPHLSTFRFEILMWGVRQLQRIEVV
HLKKNPFVASKRFGIFPVNQPKITIDIAGYRIESDKITDWTIQPNFEDNL
VFLDLRLPTSTQFWPPIAINCTNSTVFGLKQIVGNCAITNLVDYYQCDQV
DNFREIDKTTIDERSVKSLNLFNAGNDTEGILNEGFENEDGSAINELTDM
KEEKPNPDVTAPVPGTVEKVKPVLPQTEEMESADWWTRYYATIGDLGDST
IVKEVIEKLSESESDEEVTGFVLNDIEINVNSDEDEEDVVDIPDDEPKKK
KKKKKKRKKKKRKFKNPFQPSTKELFLKEEPDNLRMESEYVTDNSWIERI
MMYPCELENVKDFGGFHDPFKSFSLYRGKQEEDDDNFENPDRFGGVFKGN
ICIYNIDPEDAEDIDDEEEEDDFNDEDDEEEREEKERRREERELEKQERE
DEKKKTLRLYKNLRDINPVDFVVRVYIIKAINLHPSDLNGKSDPYILVKL
GDKEVRDRENYIPKTLNPVFGKCIELEVTFPQESFLLVQIYDWDRLTKDD
LIGETTIDLENRWLSPHQGSCGIMPSYHNHGYLKWKDYRLPTIILKSLCE
EHNVPLPIYDKLTDRVDIDDRSFFAETMIEDDDGSQIKSLEPLALEVLHH
WHEIVPGKKLVPEYIETRPLYMPEKPGIQQGLLEMWVDMYPAGTAIPAPI
DITPRKAIGYELRCTVIQTEKVRLINVNFFTNEKTVDIFVKSWMKSTDID
LQKTDVHYKSLSGQGLFNWRFVYNFDYLKAEDCIVYTQKSVYEIDECEYK
TPCFLNMQVLDSGIIMSDTIIGKFKCRLSKFPQPAKFYRSCDPFQLSEAC
AKFNLFRNKKVRGWWPLIYNPKDEDSDEEDGEEIGGCVELEMELVTAEEA
ESNPVGLGRAEPMPLEAPMRPDGSFLSFLNPWNTIKYFIKYRLKWILIKI
FVIFMALLIIALFIYNFPGSISNAIVTKMFG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000136whole organism
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000008C2_dom
IPR012561Ferlin_B-domain
IPR012968FerIin_dom
IPR032362Ferlin_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20