CDP-diacylglycerol--inositol 3-phosphatidyltransferase

Overview
NameCDP-diacylglycerol--inositol 3-phosphatidyltransferase
Smed IDSMED30000221
Length (bp)1015
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CDP-diacylglycerol--inositol 3-phosphatidyltransferase (SMED30000221) t-SNE clustered cells

Violin plots show distribution of expression levels for CDP-diacylglycerol--inositol 3-phosphatidyltransferase (SMED30000221) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CDP-diacylglycerol--inositol 3-phosphatidyltransferase (SMED30000221) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CDP-diacylglycerol--inositol 3-phosphatidyltransferase (SMED30000221) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000221

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000221SMESG000008297.1 dd_Smed_v6_8397_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30000221SMESG000008297.1 SMED30000221smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30000221SMESG000071704.1 SMESG000008297.1 OX_Smed_1.0.01742ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Human
Match: CDIPT (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:HGNC Symbol;Acc:HGNC:1769])

HSP 1 Score: 260.766 bits (665), Expect = 2.041e-86
Identity = 128/208 (61.54%), Postives = 160/208 (76.92%), Query Frame = 1
Query:   58 NIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKD 669
            NIFLFVPN+IGY RI+ AIISF+FM   P+  +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRC+TMCLLV L   YP   + FQISMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  LF++CAGNELFY +LYL HFS GP    VG++ +   +T P+A++K+ IS+IHL  A+ N+A +D  DR K 
Sbjct:    5 NIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKK 212          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Human
Match: CDIPT (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:HGNC Symbol;Acc:HGNC:1769])

HSP 1 Score: 260.766 bits (665), Expect = 2.041e-86
Identity = 128/208 (61.54%), Postives = 160/208 (76.92%), Query Frame = 1
Query:   58 NIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKD 669
            NIFLFVPN+IGY RI+ AIISF+FM   P+  +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRC+TMCLLV L   YP   + FQISMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  LF++CAGNELFY +LYL HFS GP    VG++ +   +T P+A++K+ IS+IHL  A+ N+A +D  DR K 
Sbjct:    5 NIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKK 212          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Human
Match: CDIPT (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:HGNC Symbol;Acc:HGNC:1769])

HSP 1 Score: 260.766 bits (665), Expect = 2.041e-86
Identity = 128/208 (61.54%), Postives = 160/208 (76.92%), Query Frame = 1
Query:   58 NIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKD 669
            NIFLFVPN+IGY RI+ AIISF+FM   P+  +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRC+TMCLLV L   YP   + FQISMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  LF++CAGNELFY +LYL HFS GP    VG++ +   +T P+A++K+ IS+IHL  A+ N+A +D  DR K 
Sbjct:    5 NIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKK 212          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Human
Match: CDIPT (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:HGNC Symbol;Acc:HGNC:1769])

HSP 1 Score: 193.356 bits (490), Expect = 7.288e-61
Identity = 95/145 (65.52%), Postives = 114/145 (78.62%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAG 486
              NIFLFVPN+IGY RI+ AIISF+FM   P+  +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRC+TMCLLV L   YP   + FQISMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  L+  C+G
Sbjct:    3 DENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRLALWD-CSG 146          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Human
Match: CDIPT (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:HGNC Symbol;Acc:HGNC:1769])

HSP 1 Score: 182.57 bits (462), Expect = 1.867e-56
Identity = 88/153 (57.52%), Postives = 115/153 (75.16%), Query Frame = 1
Query:  223 GTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKD 669
            GT+FGAMLDMLTDRC+TMCLLV L   YP   + FQISMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  LF++CAGNELFY +LYL HFS GP    VG++ +   +T P+A++K+ IS+IHL  A+ N+A +D  DR K 
Sbjct:   15 GTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKK 167          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Celegans
Match: pisy-1 (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9U2G1])

HSP 1 Score: 192.971 bits (489), Expect = 2.708e-60
Identity = 101/207 (48.79%), Postives = 138/207 (66.67%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPVGIWF----VICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDR 660
            + N++LF PN+IGY RI+LAI++ ++M + P     CY LS  LDAFDG AAR  NQ ++FGAMLD LTDRCA + L++AL  FYP  + L Q+S  IDIASHWLH+H + + G+ SHK    S+N++L  YYT+R  L  MC GNE FY +LY+  F  GP+   F    +  ++ FP+A VK+ IS++HLY A+  +   DVK R
Sbjct:    9 NNNVWLFYPNLIGYGRIVLAILAMYYMSSAPWCAMFCYALSAGLDAFDGWAARTYNQSSRFGAMLDQLTDRCALLALVMALCKFYPDHLFLLQLSAVIDIASHWLHLHATDLSGATSHKQ---SSNWLLNLYYTDRLFLGFMCGGNEAFYILLYIRAFWAGPLIFNFHFMSIFPLIAFPIAFVKSAISVVHLYTAAEMVVAHDVKLR 212          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Fly
Match: Pis (gene:FBgn0030670 transcript:FBtr0074058)

HSP 1 Score: 220.705 bits (561), Expect = 7.215e-71
Identity = 108/209 (51.67%), Postives = 148/209 (70.81%), Query Frame = 1
Query:   58 NIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPV----GIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH 672
            N+F+FVPN+IGY RI+LA+I+FWFM  N VI+  CY+ S LLDA DG AAR  NQ T+FGAMLD LTDRC T  LLV L +FYP +M  FQ+S++ID+A HWL M  S++ G +SHK   +++NFI+  YY  + +L  MC  NELFY  LYL HF+YGP+     ++ ++  LT P AV+K  IS++H Y A ++LA +DV++R++  
Sbjct:    8 NVFIFVPNLIGYARIVLALIAFWFMSTNYVISGWCYVTSALLDAVDGQAARAFNQSTRFGAMLDQLTDRCGTTGLLVTLAYFYPRYMFWFQLSIAIDVACHWLFMQTSVVVGRSSHK---VNDNFIMRLYY-QKDILTFMCCVNELFYVCLYLLHFTYGPLIFGASLFKILAFLTGPFAVLKALISVMHAYVAGIDLAAVDVRERQERR 212          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Fly
Match: Pis (gene:FBgn0030670 transcript:FBtr0074059)

HSP 1 Score: 77.7962 bits (190), Expect = 7.122e-18
Identity = 35/55 (63.64%), Postives = 43/55 (78.18%), Query Frame = 1
Query:   58 NIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQ 222
            N+F+FVPN+IGY RI+LA+I+FWFM  N VI+  CY+ S LLDA DG AAR  NQ
Sbjct:    8 NVFIFVPNLIGYARIVLALIAFWFMSTNYVISGWCYVTSALLDAVDGQAARAFNQ 62          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Zebrafish
Match: cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) [Source:ZFIN;Acc:ZDB-GENE-040426-2536])

HSP 1 Score: 254.603 bits (649), Expect = 3.274e-84
Identity = 127/214 (59.35%), Postives = 156/214 (72.90%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP-------VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH 672
              NIFLFVPN+IGY RI+LA++SF+ M   P     CYLLS LLDAFDGHAAR LNQGTKFGAMLDMLTDRCATMCLLV L   YPS+  LFQ+SM +D+ASHWLH+H S+M+G+ SHK++DLS N IL  YYT+R VLF MC GNELF+ +LY+ ++   P       +G+  V+C+L       K+GIS +HL  AS N+A IDV DREK+ 
Sbjct:    3 EENIFLFVPNLIGYARIVLALVSFFLMPCCPGPAVFCYLLSALLDAFDGHAARALNQGTKFGAMLDMLTDRCATMCLLVNLALLYPSYTFLFQLSMCLDVASHWLHLHSSMMKGATSHKAIDLSGNPILRLYYTSRPVLFFMCMGNELFFCLLYIMYYIEEPQVWLQWLLGVCGVVCLL-------KSGISFLHLITASRNMAAIDVADREKER 209          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Zebrafish
Match: si:ch1073-145m9.1 (si:ch1073-145m9.1 [Source:ZFIN;Acc:ZDB-GENE-131127-570])

HSP 1 Score: 62.7734 bits (151), Expect = 3.541e-11
Identity = 31/71 (43.66%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   49 MSTNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTD 261
            M   + L+VPN+IGY RI+L +I+ W +  +P      Y+LS +LD  DG  AR L Q ++FGA LD++ D
Sbjct:    1 MGFQVILYVPNLIGYIRILLVLIA-WILYRDPHCFVPLYVLSVILDGVDGWVARRLRQTSRFGAWLDVVID 70          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Xenopus
Match: cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:NCBI gene;Acc:779827])

HSP 1 Score: 271.552 bits (693), Expect = 9.635e-91
Identity = 131/215 (60.93%), Postives = 166/215 (77.21%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP---------VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKD 669
              NIFLFVPN+IGY RI+ A ++F+FM  +PV+ +  YLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLV L   YPS+ +LFQ+SMS+DIASHWLH+H S+++GS SHK+++L+ N +L  YYT+R VLF MCAGNELFY MLYL HF+ GP         +G++ +I  L  P++++K+ ISLIHL  AS N+A +D  +R K 
Sbjct:    3 QENIFLFVPNLIGYARIVFAFVAFYFMPTSPVLASTFYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVNLSLLYPSYTLLFQLSMSLDIASHWLHLHSSILKGSESHKTINLAGNPVLRLYYTSRPVLFFMCAGNELFYCMLYLLHFTEGPSVILGPVGAIGLFRLIVWLCCPISLIKSLISLIHLVTASSNIASLDCAERSKK 217          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Xenopus
Match: cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:NCBI gene;Acc:779827])

HSP 1 Score: 203.371 bits (516), Expect = 3.562e-64
Identity = 93/135 (68.89%), Postives = 115/135 (85.19%), Query Frame = 1
Query:   58 NIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRK 462
            NIFLFVPN+IGY RI+ A ++F+FM  +PV+ +  YLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLV L   YPS+ +LFQ+SMS+DIASHWLH+H S+++GS SHK+++L+ N +L  YYT+R 
Sbjct:    5 NIFLFVPNLIGYARIVFAFVAFYFMPTSPVLASTFYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVNLSLLYPSYTLLFQLSMSLDIASHWLHLHSSILKGSESHKTINLAGNPVLRLYYTSRS 139          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Mouse
Match: Cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) [Source:MGI Symbol;Acc:MGI:105491])

HSP 1 Score: 260.381 bits (664), Expect = 2.007e-86
Identity = 128/211 (60.66%), Postives = 160/211 (75.83%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH 672
              NIFLFVPN+IGY RI+ AIISF+FM   P   +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRCATMCLLV L   YP   +LFQ+SMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  LF++CAGNELFY +LYL +FS GP    VG++ +   +T P+A++K+ IS+IHL  A+ N+A +D  DR K  
Sbjct:    3 EENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFNFSEGPLVGSVGLFRMGLWVTAPIALLKSVISVIHLITAARNMAALDAADRAKKK 213          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Mouse
Match: Cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) [Source:MGI Symbol;Acc:MGI:105491])

HSP 1 Score: 220.32 bits (560), Expect = 3.345e-71
Identity = 108/180 (60.00%), Postives = 137/180 (76.11%), Query Frame = 1
Query:  142 PVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKD 669
            P   +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRCATMCLLV L   YP   +LFQ+SMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  LF++CAGNELFY +LYL +FS GP    VG++ +   +T P+A++K+ IS+IHL  A+ N+A +D  DR K 
Sbjct:    5 PFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFNFSEGPLVGSVGLFRMGLWVTAPIALLKSVISVIHLITAARNMAALDAADRAKK 184          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Mouse
Match: Cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) [Source:MGI Symbol;Acc:MGI:105491])

HSP 1 Score: 195.667 bits (496), Expect = 8.930e-62
Identity = 95/140 (67.86%), Postives = 112/140 (80.00%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLF 471
              NIFLFVPN+IGY RI+ AIISF+FM   P   +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRCATMCLLV L   YP   +LFQ+SMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+RK L+
Sbjct:    3 EENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRKSLW 142          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Mouse
Match: Cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) [Source:MGI Symbol;Acc:MGI:105491])

HSP 1 Score: 194.897 bits (494), Expect = 1.905e-61
Identity = 93/137 (67.88%), Postives = 109/137 (79.56%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRK 462
              NIFLFVPN+IGY RI+ AIISF+FM   P   +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRCATMCLLV L   YP   +LFQ+SMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R 
Sbjct:    3 EENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRP 139          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Mouse
Match: Cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) [Source:MGI Symbol;Acc:MGI:105491])

HSP 1 Score: 194.897 bits (494), Expect = 9.887e-61
Identity = 94/141 (66.67%), Postives = 112/141 (79.43%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFS 474
              NIFLFVPN+IGY RI+ AIISF+FM   P   +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRCATMCLLV L   YP   +LFQ+SMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  L++
Sbjct:    3 EENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRSALWA 143          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. UniProt/SwissProt
Match: sp|O14735|CDIPT_HUMAN (CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Homo sapiens OX=9606 GN=CDIPT PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 9.802e-86
Identity = 128/208 (61.54%), Postives = 160/208 (76.92%), Query Frame = 1
Query:   58 NIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKD 669
            NIFLFVPN+IGY RI+ AIISF+FM   P+  +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRC+TMCLLV L   YP   + FQISMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  LF++CAGNELFY +LYL HFS GP    VG++ +   +T P+A++K+ IS+IHL  A+ N+A +D  DR K 
Sbjct:    5 NIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKK 212          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. UniProt/SwissProt
Match: sp|Q8VDP6|CDIPT_MOUSE (CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Mus musculus OX=10090 GN=Cdipt PE=1 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.404e-85
Identity = 128/211 (60.66%), Postives = 160/211 (75.83%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH 672
              NIFLFVPN+IGY RI+ AIISF+FM   P   +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRCATMCLLV L   YP   +LFQ+SMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  LF++CAGNELFY +LYL +FS GP    VG++ +   +T P+A++K+ IS+IHL  A+ N+A +D  DR K  
Sbjct:    3 EENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFNFSEGPLVGSVGLFRMGLWVTAPIALLKSVISVIHLITAARNMAALDAADRAKKK 213          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. UniProt/SwissProt
Match: sp|P70500|CDIPT_RAT (CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Rattus norvegicus OX=10116 GN=Cdipt PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 1.823e-85
Identity = 128/211 (60.66%), Postives = 160/211 (75.83%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH 672
              NIFLFVPN+IGY RI+ AIISF+FM   P   +  YLLSGLLDAFDGHAAR LNQGT+FGAMLDMLTDRCATMCLLV L   YP   +LFQ+SMS+D+ASHWLH+H S+++GS SHK +DLS N +L  YYT+R  LF++CAGNELFY +LYL +FS GP    VG++ +   +T P+A++K+ IS+IHL  A+ N+A +D  DR K  
Sbjct:    3 EENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFNFSEGPLVGSVGLFRMGLWITAPIALLKSIISVIHLVTAARNMAALDAADRAKKK 213          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. UniProt/SwissProt
Match: sp|Q8SX37|CDIPT_DROME (CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Drosophila melanogaster OX=7227 GN=Pis PE=1 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 7.233e-70
Identity = 108/209 (51.67%), Postives = 148/209 (70.81%), Query Frame = 1
Query:   58 NIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPV----GIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH 672
            N+F+FVPN+IGY RI+LA+I+FWFM  N VI+  CY+ S LLDA DG AAR  NQ T+FGAMLD LTDRC T  LLV L +FYP +M  FQ+S++ID+A HWL M  S++ G +SHK   +++NFI+  YY  + +L  MC  NELFY  LYL HF+YGP+     ++ ++  LT P AV+K  IS++H Y A ++LA +DV++R++  
Sbjct:    8 NVFIFVPNLIGYARIVLALIAFWFMSTNYVISGWCYVTSALLDAVDGQAARAFNQSTRFGAMLDQLTDRCGTTGLLVTLAYFYPRYMFWFQLSIAIDVACHWLFMQTSVVVGRSSHK---VNDNFIMRLYY-QKDILTFMCCVNELFYVCLYLLHFTYGPLIFGASLFKILAFLTGPFAVLKALISVMHAYVAGIDLAAVDVRERQERR 212          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. UniProt/SwissProt
Match: sp|Q10153|PIS_SCHPO (CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pis1 PE=3 SV=2)

HSP 1 Score: 182.956 bits (463), Expect = 5.182e-55
Identity = 99/226 (43.81%), Postives = 142/226 (62.83%), Query Frame = 1
Query:   46 KMSTNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFS--------YGPVGIWF------------VICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDRE 663
            +   N++ FVPN+IG+TR+ L +IS +FM  +P   T+ YL S LLDAFDG AAR L+Q T FGA+LDM+TDRCAT CLL  L   YP + I+FQ+ +S+D+ASH++HM+ +L QG++SHK+V   +N++L  YY N KVLF  CA NE+F+  LYL  F+        Y PV  +             ++ VL  P+ + K  I+++ L  A+  L  +DV+ R 
Sbjct:    6 QKDPNVYFFVPNLIGFTRVFLVLISLYFMSWHPNYCTIVYLYSSLLDAFDGWAARKLHQATNFGAILDMVTDRCATSCLLCFLCAAYPKYAIIFQLLVSLDLASHYMHMYSTLHQGASSHKTVTKKHNWMLRLYYGNNKVLFIFCAANEMFFVALYLLSFTPRTPPKLGYLPVPSFIYSTGELPLSYPTLLAVLCGPICLAKQIINVVQLVNAANALVKMDVEQRR 231          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. TrEMBL
Match: A0A3M7S2U8 (CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Brachionus plicatilis OX=10195 GN=BpHYR1_054510 PE=3 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 8.405e-92
Identity = 138/213 (64.79%), Postives = 165/213 (77.46%), Query Frame = 1
Query:   49 MSTNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP-----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH 672
            MS NIFLFVPN+IGY RI+LAIISF+FM   P ++  CYLLSGLLDAFDGHAAR LNQGTKFGAMLDMLTDRCATMCL V L  FYP W ILFQ+SMS+D+ASHWLHMH S+M+GS SHK++DLS N IL  YYT+R  LF MCAGNELF+SMLYL +F  GP     +G++ ++  L+ PVA+ K  IS +HL  A+ NLA ID  +R+ + 
Sbjct:    1 MSENIFLFVPNIIGYFRILLAIISFYFMPTCPTVSIFCYLLSGLLDAFDGHAARYLNQGTKFGAMLDMLTDRCATMCLCVVLAMFYPKWAILFQLSMSLDMASHWLHMHSSMMKGSTSHKTIDLSGNPILRIYYTSRSFLFFMCAGNELFFSMLYLLNFYEGPSVVGSLGLFRLVLCLSAPVAIGKAAISGVHLVTAARNLAAIDEAERQVEK 213          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. TrEMBL
Match: A0A267FAL2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013600g2 PE=3 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 8.078e-91
Identity = 133/210 (63.33%), Postives = 166/210 (79.05%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPV----GIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKD 669
              N+FLFVPN+IGY RI+LAI++ ++M  + V  T  YLLSGLLDAFDGHAARLLNQ TKFGAMLDMLTDRCATMCLL  L  FYP +M+ FQ+S ++DIASHWLH+H S+++G+ SHK+VDLS+N ILY+YY +R VLF MCAGNELFY+ LYL HF+ GP+    G+   + VLTFPVA VK+ IS +HLY ASVN+A +D K+R + 
Sbjct:    6 EQNVFLFVPNLIGYARILLAILACYYMPFDHVRATWAYLLSGLLDAFDGHAARLLNQSTKFGAMLDMLTDRCATMCLLFVLAQFYPRYMLAFQLSAALDIASHWLHLHSSIVRGAQSHKAVDLSSNPILYYYYNSRVVLFCMCAGNELFYAALYLMHFTRGPILLGFGLVPTLAVLTFPVAAVKSAISAVHLYVASVNMAALDTKERAEQ 215          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. TrEMBL
Match: A0A0R3SQL2 (CDP-diacylglycerol--inositol 3-phosphatidyltransferase OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7366 PE=3 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 2.525e-90
Identity = 133/210 (63.33%), Postives = 164/210 (78.10%), Query Frame = 1
Query:   49 MSTNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREK 666
            M+ NIFLFVPN+IGY RI+L I + W+M  +P+   V Y LS LLDA DGHAARLLNQ TKFGAMLDML+DRC TMCLL  LG FYP +++LFQ+S +IDIASHWLH+HVS+  GS+SHK++DL  N +L  YYTNRKVLF MCAGNELFY MLYL HF  GP    VG+++ +  L+ P+A++KT ISL+HLYAAS+N+AG+D  DR  
Sbjct:    1 MTENIFLFVPNIIGYARILLLIAACWYMPLDPIRAIVAYFLSALLDAVDGHAARLLNQSTKFGAMLDMLSDRCTTMCLLFVLGTFYPRYLLLFQLSAAIDIASHWLHVHVSIQSGSSSHKTIDLDGNSLLRIYYTNRKVLFGMCAGNELFYGMLYLIHFFEGPKFLGVGVFYWLLFLSLPIALLKTFISLVHLYAASINIAGLDAIDRRN 210          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. TrEMBL
Match: A0A087UH71 (CDP-diacylglycerol--inositol 3-phosphatidyltransferase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_27245 PE=3 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 3.801e-90
Identity = 136/208 (65.38%), Postives = 163/208 (78.37%), Query Frame = 1
Query:   49 MSTNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP----VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDR 660
            M+ NIFLFVPN+IGY RI+LAIISF+FM  + V  T+CYLLSG LDA DGHAAR LNQGTKFGAMLD LTDRCATMCLLV L  FYP WM+LFQ+SM+IDIASHW+H   SLMQG  SHK +D S N I+  YYT+R VLF MCAGNELFYSMLYL HF+ GP     G++++I  ++ P+A+VKT ISL+ L  AS+N++ ID  +R
Sbjct:    1 MAENIFLFVPNLIGYGRILLAIISFYFMPFDHVKATICYLLSGFLDAIDGHAARWLNQGTKFGAMLDQLTDRCATMCLLVTLSCFYPKWMLLFQLSMTIDIASHWIHQQASLMQGKTSHKFIDASANPIIRIYYTSRPVLFVMCAGNELFYSMLYLVHFTAGPTVLGTGLFYLILYISTPIAIVKTFISLLQLVIASINISIIDTNER 208          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. TrEMBL
Match: A0A267DYQ4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014367g2 PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 7.382e-90
Identity = 131/210 (62.38%), Postives = 165/210 (78.57%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPV----GIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKD 669
              N+FLFVPN+IGY RI+LAI++ ++M  + V  T  YLLSGLLDAFDGHAARLLNQ TKFGAMLDMLTDRCATMCLL  L  FYP +M+ FQ+S ++DIASHWLH+H S+++G+ SHK+VDLS+N ILY+YY +R VLF MCAGNELFY+ LY+ HF+ GP+    G+   +  LTFPVA VK+ IS +HLY ASVN+A +D K+R + 
Sbjct:    6 EQNVFLFVPNLIGYARILLAILACYYMPFDHVRATWAYLLSGLLDAFDGHAARLLNQSTKFGAMLDMLTDRCATMCLLFVLAQFYPRYMLAFQLSAALDIASHWLHLHSSIVRGAQSHKAVDLSSNPILYYYYNSRVVLFCMCAGNELFYAALYVMHFTRGPILLGFGLVPTLAALTFPVAAVKSAISAVHLYVASVNMAALDTKERAEQ 215          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Cavefish
Match: cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:NCBI gene;Acc:103029119])

HSP 1 Score: 259.996 bits (663), Expect = 1.664e-86
Identity = 128/214 (59.81%), Postives = 159/214 (74.30%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGP-------VGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH 672
              NIFLFVPN+IGY RI+LA++SF+ M   P     CYLLS LLDAFDGHAAR LNQGTKFGAMLDMLTDRCATMCLLV L   YPS+  LFQ+SMS+D+ASHWLH+H S+M+G++SHK++DLS N IL  YYT+R VLF MC GNELFY +LY+ ++   P       +G+  V+C+L       K+GIS++HL  AS N+A IDV DRE++ 
Sbjct:    3 EENIFLFVPNLIGYARIVLALLSFYLMPCCPAPAVFCYLLSALLDAFDGHAARALNQGTKFGAMLDMLTDRCATMCLLVNLALLYPSYTFLFQLSMSLDVASHWLHLHSSMMKGASSHKTIDLSGNPILRIYYTSRPVLFFMCMGNELFYCLLYVMYYIEEPQVWLQCLLGVCGVVCLL-------KSGISVLHLITASCNMAAIDVADRERER 209          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Yeast
Match: PIS1 (Phosphatidylinositol synthase; required for biosynthesis of phosphatidylinositol, which is a precursor for polyphosphoinositides, sphingolipids, and glycolipid anchors for some of the plasma membrane proteins [Source:SGD;Acc:S000006317])

HSP 1 Score: 162.925 bits (411), Expect = 2.437e-49
Identity = 90/211 (42.65%), Postives = 127/211 (60.19%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPV-GIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH*IY 681
            + ++  ++PN IGY R+I A +SF+ M N+P   T  Y  S LLDA DG  AR  NQ +  GA+LDM+TDR +T  L+  L   YP W + FQ+ + +DI SH++HM+ SL  G  SHKSV    + +L+ YYT R VLF++CA NELFY+ LYL  FS     G W  I  ++FP  V K   +++ L  A++ LA  D K+  + +  Y
Sbjct:   12 AEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDGTMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYASLSAGKTSHKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTTI--ISFPGYVFKQTANVVQLKRAALILADNDAKNANEKNKTY 220          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Nematostella
Match: EDO31331 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY82])

HSP 1 Score: 214.542 bits (545), Expect = 4.037e-69
Identity = 105/212 (49.53%), Postives = 147/212 (69.34%), Query Frame = 1
Query:   55 TNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPV--------GIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREK 666
            T++FLF+PN+IGY RIILA  SF++M ++ V   V Y++SG LDAFDGHAAR  NQ TKFGA LDMLTDRC T  L++ LG FYP ++ LFQ  + +DI SHW+H+  ++++G +SHK +DLS N+ L  YY  + VLF+ CAGNELF+  LYL HF+ GP+        G+W ++  +T P+ ++K  +S+I L+AA  N   +D  +R K
Sbjct:    2 TSVFLFIPNLIGYLRIILAFASFYYMPSDHVKAAVMYVISGFLDAFDGHAARYFNQSTKFGAFLDMLTDRCVTTALIMMLGVFYPKFLFLFQFLVCLDITSHWIHVQSAMLKG-DSHKKIDLSGNYFLRVYY-KKVVLFTFCAGNELFFCCLYLAHFTPGPIISLAGHSAGLWIILAYVTAPICLLKQLVSVIQLWAACYNTVLVDESERAK 211          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Nematostella
Match: EDO39676 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9B7])

HSP 1 Score: 53.5286 bits (127), Expect = 5.324e-8
Identity = 27/68 (39.71%), Postives = 43/68 (63.24%), Query Frame = 1
Query:   58 NIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTD 261
            N+FLF PN++GY R+   ++++  +   P+   + Y +S +LD  DG+ AR  NQ + FGA LD+L D
Sbjct:    5 NVFLFYPNIVGYFRLAFLVLAWVNIDCCPLTFLLYYGISAILDGVDGYVARSFNQTSAFGAWLDVLID 72          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Medaka
Match: cdipt (CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Source:NCBI gene;Acc:101167290])

HSP 1 Score: 240.736 bits (613), Expect = 5.300e-79
Identity = 122/205 (59.51%), Postives = 151/205 (73.66%), Query Frame = 1
Query:   52 STNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPVGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREK 666
              NIFLFVPN+IGY R++LA++SF+ M   P      YLLSGLLDAFDGHAAR LNQ TKFGAMLDMLTDRCATMCLLV L   YP++  LFQ+SM +D+ASHWLH+H S ++GS SHKS+DLS N +L  YYT++ VLF MCAGNELF+ +LYL H    P G+  +IC+L       K+ IS++HL  AS N+A +D  +REK
Sbjct:    3 QENIFLFVPNLIGYARVLLALLSFFLMPIWPWPAIFFYLLSGLLDAFDGHAARALNQSTKFGAMLDMLTDRCATMCLLVNLSLLYPAYAFLFQLSMCLDVASHWLHLHSSTIKGSASHKSIDLSGNPVLRIYYTSKPVLFVMCAGNELFFCLLYLLHHIQEP-GLCGLICLL-------KSAISVLHLVTASQNMAALDAAEREK 199          
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Planmine SMEST
Match: SMESG000008297.1 (SMESG000008297.1)

HSP 1 Score: 372.474 bits (955), Expect = 2.226e-131
Identity = 180/181 (99.45%), Postives = 180/181 (99.45%), Query Frame = 1
Query:  130 MLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPVGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDVKDREKDH 672
            MLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPVGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGID KDREKDH
Sbjct:    1 MLNNPVITTVCYLLSGLLDAFDGHAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSIDIASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELFYSMLYLCHFSYGPVGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGIDAKDREKDH 181          
The following BLAST results are available for this feature:
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDIPT2.041e-8661.54CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
CDIPT2.041e-8661.54CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
CDIPT2.041e-8661.54CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
CDIPT7.288e-6165.52CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
CDIPT1.867e-5657.52CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pisy-12.708e-6048.79CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pis7.215e-7151.67gene:FBgn0030670 transcript:FBtr0074058[more]
Pis7.122e-1863.64gene:FBgn0030670 transcript:FBtr0074059[more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdipt3.274e-8459.35CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
si:ch1073-145m9.13.541e-1143.66si:ch1073-145m9.1 [Source:ZFIN;Acc:ZDB-GENE-131127... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cdipt9.635e-9160.93CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
cdipt3.562e-6468.89CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdipt2.007e-8660.66CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
Cdipt3.345e-7160.00CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
Cdipt8.930e-6267.86CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
Cdipt1.905e-6167.88CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
Cdipt9.887e-6166.67CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O14735|CDIPT_HUMAN9.802e-8661.54CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
sp|Q8VDP6|CDIPT_MOUSE1.404e-8560.66CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
sp|P70500|CDIPT_RAT1.823e-8560.66CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
sp|Q8SX37|CDIPT_DROME7.233e-7051.67CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
sp|Q10153|PIS_SCHPO5.182e-5543.81CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7S2U88.405e-9264.79CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
A0A267FAL28.078e-9163.33Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A0R3SQL22.525e-9063.33CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
A0A087UH713.801e-9065.38CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
A0A267DYQ47.382e-9062.38Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdipt1.664e-8659.81CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PIS12.437e-4942.65Phosphatidylinositol synthase; required for biosyn... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO313314.037e-6949.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396765.324e-839.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdipt5.300e-7959.51CDP-diacylglycerol--inositol 3-phosphatidyltransfe... [more]
back to top
BLAST of CDP-diacylglycerol--inositol 3-phosphatidyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008297.12.226e-13199.45SMESG000008297.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000221 ID=SMED30000221|Name=CDP-diacylglycerol--inositol 3-phosphatidyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1015bp
TTTTAACAGTATATTGTAAAATTAATTCTTTACAAATCACTATATAAAAT
GTCAACTAACATATTTCTCTTTGTTCCAAATGTTATTGGTTATACAAGAA
TTATTTTAGCAATAATCTCATTTTGGTTTATGCTTAATAATCCGGTAATA
ACAACTGTTTGTTATTTACTATCTGGACTTTTGGATGCTTTTGATGGTCA
TGCTGCAAGATTACTGAATCAAGGTACTAAATTCGGTGCAATGCTTGATA
TGTTAACCGATAGATGTGCTACTATGTGTCTACTCGTCGCTCTTGGACAT
TTTTATCCAAGTTGGATGATATTGTTTCAAATCAGTATGTCTATTGACAT
TGCAAGTCACTGGTTGCATATGCATGTATCGTTAATGCAAGGAAGTAACA
GTCACAAATCTGTTGATTTAAGCAATAACTTTATTTTATATCACTATTAC
ACAAACAGAAAAGTTTTATTCTCAATGTGTGCTGGCAATGAGCTTTTCTA
TTCAATGCTGTATTTATGTCATTTCTCTTACGGCCCAGTTGGAATCTGGT
TTGTCATATGCGTTTTAACATTCCCCGTCGCTGTTGTGAAAACCGGTATA
AGTCTTATCCATTTATATGCTGCATCGGTGAATTTGGCTGGAATTGATGT
CAAAGATCGAGAAAAGGATCATTAAATATATTATTGAAATTATTGTTGCA
CTTGTTTAATCTCATGATAATCTCAGTTAAATATTTAATTGAAATTCAAT
TCCGTAGACGAGCTGCTATGTCGGCAGGTGACAATCTTTTTTATCATTCA
ATAGTCGATGCAAGCAATTTACGAAATGATTTGCATTACTTTTCCATTGA
TCTATTTTTTCACAATTTTTATTGAAATATTTGTCTCGTTTTATTAATGC
TTGATTTTTTGGTAGATTTTATTTATTGAATAATAATTCAATTGTGGTTT
TTCGCTTTATAATTTCATTGAAAATATTTGTGTTTCGGAATTTGTCTTGA
TTGTGTAATTTGTGC
back to top

protein sequence of SMED30000221-orf-1

>SMED30000221-orf-1 ID=SMED30000221-orf-1|Name=SMED30000221-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=209bp
MSTNIFLFVPNVIGYTRIILAIISFWFMLNNPVITTVCYLLSGLLDAFDG
HAARLLNQGTKFGAMLDMLTDRCATMCLLVALGHFYPSWMILFQISMSID
IASHWLHMHVSLMQGSNSHKSVDLSNNFILYHYYTNRKVLFSMCAGNELF
YSMLYLCHFSYGPVGIWFVICVLTFPVAVVKTGISLIHLYAASVNLAGID
VKDREKDH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043130CDP-OH_PTrfase_TM_dom
IPR000462CDP-OH_P_trans
IPR014387CDP_diag_ino_3_P_euk
Vocabulary: biological process
TermDefinition
GO:0008654phospholipid biosynthetic process
GO:0006629lipid metabolic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005794Golgi apparatus
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016780phosphotransferase activity, for other substituted phosphate groups
GO:0003881CDP-diacylglycerol-inositol 3-phosphatidyltransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR043130CDP-alcohol phosphotransferase, transmembrane domainGENE3DG3DSA:1.20.120.1760coord: 2..188
e-value: 5.3E-16
score: 61.0
IPR014387CDP-diacylglycerol-inositol 3-phosphatidyltransferase, eukaryotePIRSFPIRSF000848CDP_diag_ino_3_Pcoord: 1..208
e-value: 7.4E-84
score: 278.3
IPR000462CDP-alcohol phosphatidyltransferasePFAMPF01066CDP-OH_P_transfcoord: 9..71
e-value: 8.7E-13
score: 48.8
IPR000462CDP-alcohol phosphatidyltransferasePROSITEPS00379CDP_ALCOHOL_P_TRANSFcoord: 49..71
NoneNo IPR availablePANTHERPTHR15362PHOSPHATIDYLINOSITOL SYNTHASEcoord: 3..205
NoneNo IPR availablePANTHERPTHR15362:SF4CDP-DIACYLGLYCEROL--INOSITOL 3-PHOSPHATIDYLTRANSFERASEcoord: 3..205
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 158..180
NoneNo IPR availableTMHMMTMhelixcoord: 76..98