zinc finger MYM-type protein 6

Overview
Namezinc finger MYM-type protein 6
Smed IDSMED30000218
Length (bp)3031
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of zinc finger MYM-type protein 6 (SMED30000218) t-SNE clustered cells

Violin plots show distribution of expression levels for zinc finger MYM-type protein 6 (SMED30000218) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of zinc finger MYM-type protein 6 (SMED30000218) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for zinc finger MYM-type protein 6 (SMED30000218) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000218

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000218SMESG000069407.1 Contig1573newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000218SMESG000069407.1 Contig1573uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30000218 SmedASXL_075176SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30000218 SmedASXL_075175SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000218 SmedASXL_075175SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZMYM6 (zinc finger MYM-type containing 6 [Source:HGNC Symbol;Acc:HGNC:13050])

HSP 1 Score: 260.381 bits (664), Expect = 4.050e-71
Identity = 144/367 (39.24%), Postives = 226/367 (61.58%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEE--DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIV-FNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG--*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQIIF 2335
            +LQI E+++I+ ++ L+ Y++++  +  D+ E  L C  +  + TG +IFE+IN+Y +   L W H   +CTDGAA++TG   G+K  I ++A +   F HC IHR+ LVA+ +   LHK+L     ++ +IK N+LNSR+ +ILC EMGSE  +L LH EVRW+SRG++L+ +F+LR+E+  FL +K   LA+ F +E+  GKL+ + DIF   N+LNLSLQG  TT   L +KI+ FK KL +      EN+  MFP FSEF+N + ++      II  HL  L + F+  F    D   G   I  PF  +  N+N+   ++E+L ++SSD  L+  F+S++  + W++ +  Y +L +R + F
Sbjct:  909 ALQIDESSEISNITLLLCYIRFIDYDCRDVKEELLFCIEMPTQITGFEIFELINKYIDSKSLNWKHCVGLCTDGAASMTGRYSGLKAKIQEVAMNTAAFTHCFIHRERLVAEKLSPCLHKILLQSAQILSFIKSNALNSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLKRLFELRHEIEIFLSQKHSDLAKYFHDEEWVGKLAYLSDIFSLINELNLSLQGTLTTFFNLCNKIDVFKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLNMTDITRIIFEHLEGLSQVFSDCFPPEQDLRSGNLWIIHPF-MNHQNNNLTDFEEEKLTELSSDLGLQALFKSVSVTQFWINAKTSYPELHERAMKF 1274          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 233.802 bits (595), Expect = 2.257e-69
Identity = 133/361 (36.84%), Postives = 209/361 (57.89%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYF-EENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNE--NNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG--*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFR-SLTCQKIWLSTENKYADL 2314
            SLQ+ E  DI  M  L+VYV++  ++DI E F     L    T  +++E +  Y   +  L +     +C+DGAA++TG +  V   I ++AP     HC IHR++L  K I  EL+ VL D+V +++YIK NSLNSRLFS+LC+ M ++ K LLLH E+RWLSRGK+L  +F++RNE+  FL  KK + +Q F + +   +L+ + DIF   NDLN S+QG++ T  +++ K+E  K KL   K  ++ +   MF   +   NE  N++D    + +IS HL  L E F   F    D  +G   I++PF     N N+ +  +++L+ +++DE L+I F  + +    W+  +N Y +L
Sbjct:  900 SLQLDECRDIANMIILLVYVRFEHDDDIKEEFFFSASLPTNTTSSELYEAVKNYIVNKCGLEFKFCVGVCSDGAASMTGKHSEVVTQIKELAPECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELLVFLQGKKPMWSQLFKDVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGNDLDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTVTLQDKLLKLATDEGLKISFENTASLPSFWIKAKNDYPEL 1260          

HSP 2 Score: 50.8322 bits (120), Expect = 2.257e-69
Identity = 27/59 (45.76%), Postives = 38/59 (64.41%), Query Frame = 1
Query: 2332 ILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +L+ F STY CE+ FS L VIKTK+ + L+    LR+A+S I P ++ + S  QA  SH
Sbjct: 1267 LLLLFPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH 1325          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 233.802 bits (595), Expect = 2.475e-69
Identity = 133/361 (36.84%), Postives = 209/361 (57.89%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYF-EENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNE--NNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG--*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFR-SLTCQKIWLSTENKYADL 2314
            SLQ+ E  DI  M  L+VYV++  ++DI E F     L    T  +++E +  Y   +  L +     +C+DGAA++TG +  V   I ++AP     HC IHR++L  K I  EL+ VL D+V +++YIK NSLNSRLFS+LC+ M ++ K LLLH E+RWLSRGK+L  +F++RNE+  FL  KK + +Q F + +   +L+ + DIF   NDLN S+QG++ T  +++ K+E  K KL   K  ++ +   MF   +   NE  N++D    + +IS HL  L E F   F    D  +G   I++PF     N N+ +  +++L+ +++DE L+I F  + +    W+  +N Y +L
Sbjct:  749 SLQLDECRDIANMIILLVYVRFEHDDDIKEEFFFSASLPTNTTSSELYEAVKNYIVNKCGLEFKFCVGVCSDGAASMTGKHSEVVTQIKELAPECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELLVFLQGKKPMWSQLFKDVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGNDLDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTVTLQDKLLKLATDEGLKISFENTASLPSFWIKAKNDYPEL 1109          

HSP 2 Score: 50.8322 bits (120), Expect = 2.475e-69
Identity = 27/59 (45.76%), Postives = 38/59 (64.41%), Query Frame = 1
Query: 2332 ILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +L+ F STY CE+ FS L VIKTK+ + L+    LR+A+S I P ++ + S  QA  SH
Sbjct: 1116 LLLLFPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH 1174          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 220.32 bits (560), Expect = 6.887e-64
Identity = 123/363 (33.88%), Postives = 197/363 (54.27%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIIS---HHLIKLGENFAKRFEKFPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            SLQ+ E+ D++ ++ L+V+V+Y F + I E  L C+ L+   TGE+IF  IN + +++++ W     +C+D + A+ G       LI  +AP    +HC+++R AL  K +   L  VL   V +I+YIK     SRL  ILC EMG++   LLL+TEVRWLSRGK+L  +F+LR E+  F+ +    L+    N     +L+ + DIF K N++NLS+QG++ T+ T+  K+ +   KL      + E N   FP  S+F  E  I+  + K+I S    HL  L     K F    D     +R+PF+  +  +++     E LID++SD  ++  F  L+    W S   +Y  + +R +
Sbjct:  274 SLQLDESADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTE--INSTVDKDICSAIVQHLRGLRATLLKYFPVTNDNNAW-VRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAV 632          

HSP 2 Score: 46.2098 bits (108), Expect = 6.887e-64
Identity = 25/65 (38.46%), Postives = 37/65 (56.92%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMS-SLQAQTSH 2508
            ++A  +L+ FA+ + CE+ FS     KTKY  RLD    +RI +S+I PN++ I     Q   SH
Sbjct:  629 RRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 693          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 220.32 bits (560), Expect = 6.887e-64
Identity = 123/363 (33.88%), Postives = 197/363 (54.27%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIIS---HHLIKLGENFAKRFEKFPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            SLQ+ E+ D++ ++ L+V+V+Y F + I E  L C+ L+   TGE+IF  IN + +++++ W     +C+D + A+ G       LI  +AP    +HC+++R AL  K +   L  VL   V +I+YIK     SRL  ILC EMG++   LLL+TEVRWLSRGK+L  +F+LR E+  F+ +    L+    N     +L+ + DIF K N++NLS+QG++ T+ T+  K+ +   KL      + E N   FP  S+F  E  I+  + K+I S    HL  L     K F    D     +R+PF+  +  +++     E LID++SD  ++  F  L+    W S   +Y  + +R +
Sbjct:  274 SLQLDESADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTE--INSTVDKDICSAIVQHLRGLRATLLKYFPVTNDNNAW-VRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAV 632          

HSP 2 Score: 46.2098 bits (108), Expect = 6.887e-64
Identity = 25/65 (38.46%), Postives = 37/65 (56.92%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMS-SLQAQTSH 2508
            ++A  +L+ FA+ + CE+ FS     KTKY  RLD    +RI +S+I PN++ I     Q   SH
Sbjct:  629 RRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 693          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 123.635 bits (309), Expect = 8.963e-34
Identity = 99/353 (28.05%), Postives = 167/353 (47.31%), Query Frame = 2
Query: 1310 KYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIK-IAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRF-----EK----FPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTC-------QKIWLSTENKYADLK 2317
            +YV  +   E  +    L+G+  GE I E + +   EN +   H  ++ TDGA ++ GS +G   L+ K +  +++  HC++H++AL A+    E   V+  V+ +++ I   +LN R F  L +E+ SE   LLLH +VRWLS+ ++LR        V  FL  K  I  Q   + +   KL  MVD+    N LN SLQ    T L +   + +F+ KL +   ++       FP   EF  E++ D  +  + + + ++ +   F  RF     EK    FP   L    DP         I  + + ++ DIS  +    +F+ LT        QK  L+  +K+++++
Sbjct:  200 RYVNSDGPQEEIIKLIPLKGQTRGEDICEAVLKCLNENGINTNHLISVATDGAPSMRGSKRGFVTLLQKALDRNLLAFHCILHQEALCAQTFPSECMVVMNLVIEMVNKIIAKALNHRQFRALLDEVDSEYSDLLLHNKVRWLSKDEVLRRFVACLEHVKTFLKSKDLIYPQ-LEDTEWLEKLHFMVDMTSHLNKLNESLQVRGNTALQMLEAVLSFERKLTVFARDVQRGTLSHFPSLREF-KESHQDHTINGDYLHNAIVDMQTAFESRFCEFRKEKMTLSFPVTPLE--IDPSLLSTFPGIIQADLEMEMADISDKDLWVSKFKRLTAELEDVTRQKAQLAQSHKWSEME 548          

HSP 2 Score: 41.5874 bits (96), Expect = 8.963e-34
Identity = 23/62 (37.10%), Postives = 37/62 (59.68%), Query Frame = 1
Query: 2332 ILIQFASTYSCESRFSKLVVIKTKY*SRLDPE---DDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +L  F STY CE  FS +  IK+KY +RL  E     ++I ++  +P++E + S ++ Q SH
Sbjct:  578 VLSIFGSTYLCEQIFSNMNYIKSKYRTRLTHESLQSCVKIKVTSYMPDVEKLSSDVRKQKSH 639          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 124.02 bits (310), Expect = 4.374e-33
Identity = 102/374 (27.27%), Postives = 175/374 (46.79%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEE-DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIA--PHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSE-DKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDK-------------ELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKK 2320
            S+ + E+ D+    Q  ++V++V E+  I E  L    L+ R  G  + E +    E+ +L  +   AI TDGA A+ GS +G+ GL       P     HC+IH++  V+K ++  L  +++ V+ ++++++ ++LN R F  L +E+  +    LL H  VRWLSRG +L   F+L N V  FL E KH       +      L+ +VD+    N LN+ LQG+   +  L   + AF NKL L K  L + +   FP   + + +            +  L  L ++F +RF     K             E G ++ P   D   S +      ++I++S D+ L+   R  T +   +    +Y ++K+
Sbjct:  186 SIALDESCDVQDKPQFAIFVRFVSEDCTIREELLDIVPLKDRTRGIDLKETLMTVVEKANLQLSKLTAIVTDGAPAMLGSERGLVGLCKADDRFPAFWTFHCIIHQEHWVSKKLN--LDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNPVKLFLAE-KHKEYPELHDPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLKLFKTHLQKRDYTHFPTLLKASGQKAEVVKGSTARYATLLENLEQSFEERFSNLQQKRQQITFLINPFTAESGCLKAPLVEDEAASQL------EMIELSEDDRLKSVLREGTVEFWKIVPVERYPNVKQ 550          

HSP 2 Score: 38.891 bits (89), Expect = 4.374e-33
Identity = 22/62 (35.48%), Postives = 37/62 (59.68%), Query Frame = 1
Query: 2332 ILIQFASTYSCESRFSKLVVIKTKY*SRLDP---EDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +L  F STY CE  FS L ++K+K+ S L     ++ LR+A +   P+++ I+ + + Q SH
Sbjct:  555 LLSMFGSTYVCELLFSTLKLVKSKHRSVLTDTHVKELLRVATTEYEPDLKKIVETKECQVSH 616          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 1.508e-27
Identity = 105/334 (31.44%), Postives = 157/334 (47.01%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEE-DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGN--SLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKK-------HILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNE--NNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG*IRDPFSFDIINSNIHLNQKEQ 2215
            S+ + E+TDIT   QL+++V+ V +E  ISE  L    L G   GE I+  +     +    ++    I TDGA A+ G N+G+ G + K        HC++H++ L    +  ++  ++  V  V + I+G   SL  R F     E+ +    LLLHT VRWLS GK L   F LR E++ +L + K       H+   SF+       L+ + DI +  N LNL+LQG    +  L S I AF+NKL L K  L +N+   F    E   E   N   + F   +    I + E F  RF+ F   E        SF + N+ I+ +   Q
Sbjct:  189 SIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVKATVTKYG-GFSSCTCIVTDGARAMVGRNQGLAGRLRKEGIDCHMFHCIVHQEVLCGTSL--KMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLT-----ALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHE-FNTRFQDFEGMEA-------SFKLFNNPINTDIAAQ 506          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 119.783 bits (299), Expect = 2.284e-27
Identity = 99/306 (32.35%), Postives = 147/306 (48.04%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEE-DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGN--SLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKK-------HILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNE--NNIDFMLFKNIISHHLIKLGENFAKRFEKF 2131
            S+ + E+TDIT   QL+++V+ V +E  ISE  L    L G   GE I+  +     +    ++    I TDGA A+ G N+G+ G + K        HC++H++ L    +  ++  ++  V  V + I+G   SL  R F     E+ +    LLLHT VRWLS GK L   F LR E++ +L + K       H+   SF+       L+ + DI +  N LNL+LQG    +  L S I AF+NKL L K  L +N+   F    E   E   N   + F   +    I + E F  RF+ F
Sbjct:  189 SIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVKATVTKYG-GFSSCTCIVTDGARAMVGRNQGLAGRLRKEGIDCHMFHCIVHQEVLCGTSL--KMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLT-----ALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHE-FNTRFQDF 485          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Xenopus
Match: ENSXETT00000028445.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:101734469])

HSP 1 Score: 70.8626 bits (172), Expect = 1.196e-13
Identity = 87/347 (25.07%), Postives = 159/347 (45.82%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEE-DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHF---FAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYI---KG--NSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKH--ILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENN-----IDFMLFKNIISHHLIKLGENFAKRFEKFP--DKELG*IRDPFSFDIINSNIHLNQKEQLIDISSD 2236
            SL + ETTD      L+++++ + +  +ISE  L C  L      E   +++N   + + L +  F    ++ T+G+ ++T  + G+  L+ K     V  HC++H + L+   +  ++  V++ VV + ++I   +G   ++  + F    +E+ +       H    W S G+ L   F LR E+Y FL +  +  IL +S  NED    L+ + D+    + L  +++ +   I  L + +  F NKL+L K  L  N+   F   +E   E       +DF  F   I      L ENF  RF+ F   +       +P + DII+  +  +   +L D+ +D
Sbjct:  178 SLALDETTDSCGTDLLVIFIRAIDDGFNISEDILKCVSLPKTAKEE---DLLNEA-KSSLLEYGGFDKCTSVMTNGSKSMTAKSLGLSALLRKEGADCVVLHCIMHEEMLIGTLL--KMSDVMEVVVKISNFILEKRGFITAVTKKKFKTFLDELSAAYGDFDSHKNAYWSSAGQCLFRFFSLRKEIYLFLKDTNYDPILTESLCNEDFLSSLAFLTDLTHYLHSLKKNIEAKDQLITQLYTHVSVFSNKLMLLKLNLISNDLTYFESCNELYREYEECNIFLDFSKFVEKIE----VLIENFNLRFQDFSKINSCFKLYNNPLTTDIISERMEYHM--ELCDLQAD 512          

HSP 2 Score: 26.9498 bits (58), Expect = 1.196e-13
Identity = 15/49 (30.61%), Postives = 29/49 (59.18%), Query Frame = 1
Query: 2344 FASTYSCESRFSKLVVIKTKY*SRLDP---EDDLRIAISHIVPNMEAIM 2481
            F STY CE  FS+L  +K+ Y + +     ++ L ++I++I  N + ++
Sbjct:  548 FGSTYICERAFSELNHLKSNYRNSISNRTLQEILHLSITNINLNFDELV 596          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 235.343 bits (599), Expect = 2.517e-72
Identity = 125/363 (34.44%), Postives = 202/363 (55.65%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKK-HILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNI-----ISHHLIKLGENFAKRFEKFPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKK 2320
            S+Q+ E+TD+    QL+VYV+Y+ + D  + FLCCK LE   T   +FE ++ +  +++++W     +CTDGA A  G   G + L++  +P  +  HCM+H Q L  K + ++  +V++ V+  ++++K +SLNSRLF  LC+++    KTLLLHTE RWLSRGK+L+ IF+LR+E+  F  +K        F +     K++ +VDIF   N+LNLSLQG ++T L LS KI +F+ KL L + +L+EN   M P  S F  E++I+    K I     +  HL  L    +  F   P+      R PFS  +   ++    +E    +++ +  R  F ++   + W+     Y  L +
Sbjct:  335 SIQLDESTDVANCLQLMVYVRYINDGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEISWKSICGVCTDGAPATLGCQSGFQRLVLNESPKAIGAHCMLHLQTLAMKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKVLKRIFELRDELKMFFNQKAIRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNSTCLDLSEKIHSFQMKLQLWQKKLDENKFYMLPTLSAFFEEHDIE--QHKRITVVISVKEHLDMLASEISWYFPNLPEIPFALARSPFS--VKAEDVPETAQEDFTRLTNSDAARADFSTMPVTQFWVKCLQSYPVLSE 693          

HSP 2 Score: 58.9214 bits (141), Expect = 2.517e-72
Identity = 28/59 (47.46%), Postives = 40/59 (67.80%), Query Frame = 1
Query: 2332 ILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +L+ F +TY CE+ FS L+VIK+KY SRL  EDDLR A++   P +  ++   Q+Q SH
Sbjct:  698 LLLPFPTTYLCETGFSSLLVIKSKYRSRLVVEDDLRCALAKTTPRISDLVRKKQSQPSH 756          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 219.55 bits (558), Expect = 3.852e-58
Identity = 124/365 (33.97%), Postives = 211/365 (57.81%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEE--DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIV-FNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG--*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            +LQ+ E+++ T++  L+ YV+++  +  D+ E  L C  +    T  ++FE+IN+Y +   L W H    CTDGAA++T     ++  I +IA + V F HC IHR+ L AK +   LH++L     ++ ++K ++ +S++ +ILC EMGSE   L L+ EVRWLSRG+IL  +F+LR+E+  FL +K   LA+ F +E+   KL+ + DIF   N LN SLQG  TT   L +K++ F+ +L +      EN+ GMFP FSEF + +++      +II  HL  L + F   +    D   G   + DPF+    ++N+  +++E+L  +S+D   +   +S++  + W++ +  Y  L ++ +
Sbjct:  741 ALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYIDSRSLNWNHCVGFCTDGAASMTDRYFRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFPLFSEFLDSSDVSVKNIASIIFEHLEGLSQIFHACYPPEEDLRSGNLWLTDPFA-TYHSNNLTDSEEEKLAVLSADTGFQSVHKSMSVTQFWVNAKTSYPKLHEKAL 1104          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 219.55 bits (558), Expect = 4.517e-58
Identity = 124/365 (33.97%), Postives = 211/365 (57.81%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEE--DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIV-FNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG--*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            +LQ+ E+++ T++  L+ YV+++  +  D+ E  L C  +    T  ++FE+IN+Y +   L W H    CTDGAA++T     ++  I +IA + V F HC IHR+ L AK +   LH++L     ++ ++K ++ +S++ +ILC EMGSE   L L+ EVRWLSRG+IL  +F+LR+E+  FL +K   LA+ F +E+   KL+ + DIF   N LN SLQG  TT   L +K++ F+ +L +      EN+ GMFP FSEF + +++      +II  HL  L + F   +    D   G   + DPF+    ++N+  +++E+L  +S+D   +   +S++  + W++ +  Y  L ++ +
Sbjct:  833 ALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYIDSRSLNWNHCVGFCTDGAASMTDRYFRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFPLFSEFLDSSDVSVKNIASIIFEHLEGLSQIFHACYPPEEDLRSGNLWLTDPFA-TYHSNNLTDSEEEKLAVLSADTGFQSVHKSMSVTQFWVNAKTSYPKLHEKAL 1196          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 117.857 bits (294), Expect = 2.222e-26
Identity = 92/347 (26.51%), Postives = 162/347 (46.69%), Query Frame = 2
Query: 1244 SVSLQIGETTDITKMSQLIVYVKYVFEE-DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKG-VKGLIIKIA-----PHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFP--DKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQF 2257
            + S+ I E TDI   +QL ++++ V +  D+SE  L    + G K+G +IF  + +  ++  + W+   ++ + G  A+  +N G V  L  + A       +    C+IH + L A+ +   +  V+  VV  +++I    LN   F+ L  E+ S+  +LL HT ++WL RG +LR  F+   E+ +F+  +   + Q   + D    L+ +VD+    N L+ SLQG S  +  +   I AF  KL L +  L  NN   FP     +   +        I     ++L   F +R   F   + EL     PFS  I   ++    + ++ID+  +  LR ++
Sbjct:  540 AYSIAIDEITDINDTTQLAIFIRGVDDNFDVSEELLDTVPMTGAKSGNEIFLRVEKSLKKFSIDWSKLVSVASTGTPAMMDANSGLVTKLRARAASCCKGADLKSVRCIIHPEWLCAQKL--RMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQYGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQ-LSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTLKSVSRSESDGLNYIPKI-----VELKAEFQRRLSDFKSCESELTLFSSPFSTTI--DSVREELQMEVIDLQCNTVLRTKY 876          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|O95789|ZMYM6_HUMAN (Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 1.945e-70
Identity = 144/367 (39.24%), Postives = 226/367 (61.58%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEE--DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIV-FNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG--*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQIIF 2335
            +LQI E+++I+ ++ L+ Y++++  +  D+ E  L C  +  + TG +IFE+IN+Y +   L W H   +CTDGAA++TG   G+K  I ++A +   F HC IHR+ LVA+ +   LHK+L     ++ +IK N+LNSR+ +ILC EMGSE  +L LH EVRW+SRG++L+ +F+LR+E+  FL +K   LA+ F +E+  GKL+ + DIF   N+LNLSLQG  TT   L +KI+ FK KL +      EN+  MFP FSEF+N + ++      II  HL  L + F+  F    D   G   I  PF  +  N+N+   ++E+L ++SSD  L+  F+S++  + W++ +  Y +L +R + F
Sbjct:  909 ALQIDESSEISNITLLLCYIRFIDYDCRDVKEELLFCIEMPTQITGFEIFELINKYIDSKSLNWKHCVGLCTDGAASMTGRYSGLKAKIQEVAMNTAAFTHCFIHRERLVAEKLSPCLHKILLQSAQILSFIKSNALNSRMLTILCEEMGSEHVSLPLHAEVRWISRGRMLKRLFELRHEIEIFLSQKHSDLAKYFHDEEWVGKLAYLSDIFSLINELNLSLQGTLTTFFNLCNKIDVFKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLNMTDITRIIFEHLEGLSQVFSDCFPPEQDLRSGNLWIIHPF-MNHQNNNLTDFEEEKLTELSSDLGLQALFKSVSVTQFWINAKTSYPELHERAMKF 1274          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|Q6R2W3|SCND3_HUMAN (SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED9 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 9.975e-69
Identity = 133/361 (36.84%), Postives = 209/361 (57.89%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYF-EENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNE--NNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG--*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFR-SLTCQKIWLSTENKYADL 2314
            SLQ+ E  DI  M  L+VYV++  ++DI E F     L    T  +++E +  Y   +  L +     +C+DGAA++TG +  V   I ++AP     HC IHR++L  K I  EL+ VL D+V +++YIK NSLNSRLFS+LC+ M ++ K LLLH E+RWLSRGK+L  +F++RNE+  FL  KK + +Q F + +   +L+ + DIF   NDLN S+QG++ T  +++ K+E  K KL   K  ++ +   MF   +   NE  N++D    + +IS HL  L E F   F    D  +G   I++PF     N N+ +  +++L+ +++DE L+I F  + +    W+  +N Y +L
Sbjct:  900 SLQLDECRDIANMIILLVYVRFEHDDDIKEEFFFSASLPTNTTSSELYEAVKNYIVNKCGLEFKFCVGVCSDGAASMTGKHSEVVTQIKELAPECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELLVFLQGKKPMWSQLFKDVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGNDLDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTVTLQDKLLKLATDEGLKISFENTASLPSFWIKAKNDYPEL 1260          

HSP 2 Score: 50.8322 bits (120), Expect = 9.975e-69
Identity = 27/59 (45.76%), Postives = 38/59 (64.41%), Query Frame = 1
Query: 2332 ILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +L+ F STY CE+ FS L VIKTK+ + L+    LR+A+S I P ++ + S  QA  SH
Sbjct: 1267 LLLLFPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH 1325          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|A4Z943|ZBED5_BOVIN (Zinc finger BED domain-containing protein 5 OS=Bos taurus OX=9913 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 4.445e-64
Identity = 124/363 (34.16%), Postives = 197/363 (54.27%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIIS---HHLIKLGENFAKRFEKFPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            SLQ+ E+ D++ ++ L+V+V+Y F + I E  L C+ L+   TGE+IF  IN + +++++ W     +C+D + A+ G       LI  +AP    +HC+++R AL  K +   L  VL   V +I+YIK     SRL  ILC EMG++   LLL+TEVRWLSRGK+L  +F+LR E+  F+ +    L+    N     +L+ + DIF K N++NLS+QG++ T+ T+  K+ +   KL      + E N   FP  S+F  E  I+  + KNI S    HL  L     K F    D     +R+PF+  +  +++     E LID++SD  ++  F  L+    W S   +Y  + +R +
Sbjct:  275 SLQLDESADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAMDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKTMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTE--INSTVDKNICSAIVQHLRGLRSTLLKYFPVTNDIHAW-VRNPFTVTVKPASLVARDYESLIDLTSDSQVKQSFSELSLNDFWSSLIQEYPSVARRAV 633          

HSP 2 Score: 46.2098 bits (108), Expect = 4.445e-64
Identity = 25/65 (38.46%), Postives = 37/65 (56.92%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMS-SLQAQTSH 2508
            ++A  +L+ FA+ + CE+ FS     KTKY  RLD    +RI +S+I PN++ I     Q   SH
Sbjct:  630 RRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 694          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|Q4R6P1|F200A_MACFA (Protein FAM200A OS=Macaca fascicularis OX=9541 GN=FAM200A PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 5.522e-64
Identity = 142/375 (37.87%), Postives = 215/375 (57.33%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIF-EIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPH--IVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTG--MFPCFSEFTNENNIDFMLFKNI---ISHHLIKLGENFAKRF--EKFPD-KELG*IRDPFSF----DIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            ++Q+ E+TDI     L+VYV+YV+++D  E  LCC  L    TG  +F E+ N    +  L W H   I +DGAA +TG +  +   +++ A H   ++NHC IHR+ALV+K+I   L  VL+  V ++++IKG+SLNSRL  ILC+E+G     LL HTEVRWLS+GK+L  +++LRNE+Y FLIEK+  LA  F N+    KL+ + DIF   N+LNL +QG++  I      I  F+  L+  +  L  N     MFP   +   EN I+    K I   I  HL  L + F   F  EKF   KE   ++DPF+F     II  N+   ++ +L+ +SS  TL+  +++L+    W+  ++++  L ++ I
Sbjct:  141 AIQLDESTDIASCPTLLVYVRYVWQDDFVEDLLCCLNLNSHITGLDLFTELENCIVGQYKLNWKHCKGISSDGAANMTGKHSRLTEKLLE-ATHNNALWNHCFIHREALVSKEISPSLMDVLKKAVKIVNFIKGSSLNSRLLEILCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNEIYIFLIEKQSHLANIFENDIWVTKLAYLSDIFGILNELNLKIQGKNNDIFQYLEHILGFQKTLLFWQARLKSNRPSYYMFPTLLQHIEENIINEDCLKEIKLEILLHLTSLSQTFNYYFPEEKFESLKENIWMKDPFAFQNPASIIKLNLEPEEENELLQLSSSFTLKNYYKTLSLSAFWIKIKDEFPLLSRKSI 514          

HSP 2 Score: 49.2914 bits (116), Expect = 5.522e-64
Identity = 26/64 (40.62%), Postives = 41/64 (64.06%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +K+  +L+ F +TY CE  FS L  +KTK  +RL+   D+R+A+S  VP+ + +M+  QA  SH
Sbjct:  511 RKSISLLLPFTTTYLCELGFSILTRLKTKKRNRLNSAPDMRVALSSCVPDWKELMNR-QAHPSH 573          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 2.131e-63
Identity = 123/363 (33.88%), Postives = 197/363 (54.27%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIIS---HHLIKLGENFAKRFEKFPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            SLQ+ E+ D++ ++ L+V+V+Y F + I E  L C+ L+   TGE+IF  IN + +++++ W     +C+D + A+ G       LI  +AP    +HC+++R AL  K +   L  VL   V +I+YIK     SRL  ILC EMG++   LLL+TEVRWLSRGK+L  +F+LR E+  F+ +    L+    N     +L+ + DIF K N++NLS+QG++ T+ T+  K+ +   KL      + E N   FP  S+F  E  I+  + K+I S    HL  L     K F    D     +R+PF+  +  +++     E LID++SD  ++  F  L+    W S   +Y  + +R +
Sbjct:  275 SLQLDESADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAMDGKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFM-DSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTE--INSTVDKDICSAIVQHLRGLRSTLLKYFPVTNDNNTW-VRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARRAV 633          

HSP 2 Score: 46.2098 bits (108), Expect = 2.131e-63
Identity = 25/65 (38.46%), Postives = 37/65 (56.92%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMS-SLQAQTSH 2508
            ++A  +L+ FA+ + CE+ FS     KTKY  RLD    +RI +S+I PN++ I     Q   SH
Sbjct:  630 RRAVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH 694          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: J9LNA1 (Reverse transcriptase domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 367.466 bits (942), Expect = 2.728e-115
Identity = 182/369 (49.32%), Postives = 264/369 (71.54%), Query Frame = 2
Query: 1226 NRIQNSSVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG*IRDPFSFDIINSNI-HLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            NR++ +  ++Q+ E+TDIT ++QL+VYV+Y++++ I E FL C+ LEGR TG  IF +IN + E N++ W+   +ICTDGAAALTGS KG K  +++++ +I+FNHCMIHR+AL +K +  +++KVL + + VI++IK  SLNSRLF+ILCNEMGS+ + LLLHTEVRWLSRGKIL  +F+LR+E   FL+E+ + L++ F++E     L  + DIF+K N LNLSLQG++T IL LS KI AFK K++L K  ++++   MF   SEF + N++D  + K II+ HLI L  NF  RFE FP + LG IR+PF F+I    + +L   E+LID+SSDE LRI+F+   C   W+S +++Y +L K+ I
Sbjct:  790 NRLRGNYYAMQLDESTDITNLAQLLVYVRYIYKDKIEEDFLFCQPLEGRTTGNDIFVLINNFLEINEIPWSMCVSICTDGAAALTGSKKGFKAKVLEVSSNIMFNHCMIHREALASKKLQPDVNKVLLNAICVINFIKSKSLNSRLFTILCNEMGSDHEKLLLHTEVRWLSRGKILSRLFELRDEARIFLLERNNKLSEHFLDEQWLAILGYLADIFEKLNCLNLSLQGKNTNILFLSDKINAFKKKILLWKNYIDDDKFEMFSYLSEFLSNNDVDINMIKEIITTHLISLQTNFNARFEDFPKESLGWIRNPFHFNINEIKLGNLKISEELIDLSSDENLRIRFQENACDTFWISIKSEYPELSKQAI 1158          

HSP 2 Score: 80.8777 bits (198), Expect = 2.728e-115
Identity = 39/64 (60.94%), Postives = 51/64 (79.69%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            K+A  IL+ FASTY CE+ FS L +IK KY SRL+ E DLR+A+S+I PN+E+IMS++QAQ SH
Sbjct: 1155 KQAISILLPFASTYLCETAFSTLTIIKNKYRSRLNVEADLRVAVSNIKPNIESIMSTMQAQVSH 1218          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: A0A2S2P4I2 (Uncharacterized protein (Fragment) OS=Schizaphis graminum OX=13262 GN=g.18992 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 7.377e-83
Identity = 135/247 (54.66%), Postives = 188/247 (76.11%), Query Frame = 2
Query: 1226 NRIQNSSVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNK 1966
            NR+Q++  ++Q+ E+TDI+  SQL+VYV+Y+++E+I E FL C+ L GR TG  IF +IN +FE N+++W+   AICTDGAAALTGS KG +  + +I+  I+F HCMIHR+AL +K ++  +++VLQD + VI++IK  +LNSRLF+ILCNEMGS+   LLLHTEVRWLSRGKIL  I +L++E+  FL+E K+ LA+ F+NE+    LS + DIF K N LNLSLQG++T IL LS KI+AF+ K
Sbjct:  122 NRLQSNYFAMQLDESTDISNFSQLLVYVRYIYKEEILEDFLFCQTLNGRTTGNDIFTLINTFFENNEISWSMCKAICTDGAAALTGSKKGFRAKVNEISQSILFTHCMIHREALASKKLEPFVNEVLQDAIRVINFIKSKALNSRLFTILCNEMGSDHTKLLLHTEVRWLSRGKILLRIVELKDEIRIFLLEHKNTLAEHFLNEEWLAILSYLADIFDKLNSLNLSLQGKNTNILILSDKIDAFQKK 368          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: A0A1A8P6Y3 (Dimer_Tnp_hAT domain-containing protein (Fragment) OS=Nothobranchius rachovii OX=451742 GN=KRBA2 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 1.358e-82
Identity = 154/372 (41.40%), Postives = 224/372 (60.22%), Query Frame = 2
Query: 1226 NRIQNSSVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRF--EKFPDKELG*IRDPFSFDIINSNIHLNQ--KEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            +R++    +LQ+ E+ D+   +QL+V+V+Y F+  + E  L C  L  + TGE IF  I++  +E  L+W    ++CTDGAAA+ G NKG+K  ++++APHI F HC+IHR+ L +K +D EL  VL+    ++++IK   LN+RLF+ LCNEMGSE ++LL HTEVRWLSRG +LR +F+LR+EV  FL+E    LA    + D   +L+ +  IF K N LN SLQ E+  I++L+ KI AFK KL      +      MFP   EF  EN++     K  I+ HL  L E+F K F  E  P+K    IR PF+   + S  HL+   ++ L+++SSD TL+  F S    + W+S E +Y  L K  I
Sbjct:   58 DRVKRGKYALQLDESIDVANSAQLLVFVRYSFDGKLHEDMLFCSTLSAKCTGEDIFTEIDKKMKEEGLSWDECISVCTDGAAAMLGKNKGLKARVVQVAPHINFTHCIIHREVLASKSLDPELKTVLESATKIVNHIKSRPLNTRLFAALCNEMGSEHQSLLFHTEVRWLSRGNVLRRLFELRDEVRLFLLEHGSHLAAHLTDPDWLTRLAYLACIFDKLNGLNTSLQVENANIMSLNDKINAFKRKLDRWSARVKTGCFDMFPELEEFLEENDLCVNTVKGYITMHLQTLLEHFIKFFPEETAPEK-YDWIRSPFT---VTSTHHLSSDIEDALVELSSDRTLKSAFNSKMLAEFWISVEREYPQLSKAAI 425          

HSP 2 Score: 63.929 bits (154), Expect = 1.358e-82
Identity = 34/67 (50.75%), Postives = 41/67 (61.19%), Query Frame = 1
Query: 2308 RFEKKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +  K A  IL+ F STY CE  FS L  IK KY SRL+ +DDLR+AIS I P M+ + S   A  SH
Sbjct:  419 QLSKAAIDILMPFGSTYLCEKTFSTLTYIKNKYRSRLNVQDDLRVAISKIKPRMDLLGSKHNAHPSH 485          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: A0A3Q1G3T1 (Uncharacterized protein OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 2.818e-82
Identity = 141/365 (38.63%), Postives = 224/365 (61.37%), Query Frame = 2
Query: 1226 NRIQNSSVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRF--EKFPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADL 2314
            + ++    +LQ+ E+TD++  +QL+V+V+YVF+E ++E  L C  LEG  TGE IF  ++   +E  ++W+   ++CTDGA A+ G  KG++  + ++APH+ F HC+IHR+AL  K +  EL  VL   V +++YIK   LN+RLF+ LCNEMG+E + LLLHTEVRWLSRG +L  + +LR EV  FL +++  LA+   + D   +L  +  +F K N LN+SLQGE+T+ILTL+ K++AF  KL   +      +  MF    +F  EN +   + +  ++ HL  L ++F K F  E  P++    IR PF+     +++  + ++ LI++SSD TLR  F + +  + W+S   +Y  L
Sbjct:  108 DAVKEGKYTLQLDESTDVSHCAQLLVFVRYVFKEKLNEEMLFCTPLEGACTGEDIFNKLDSKLKEEGMSWSECLSVCTDGAGAMLGKKKGLRARVQQVAPHVCFTHCIIHREALACKSLSAELKHVLDTAVKIVNYIKSRPLNTRLFATLCNEMGAEHQGLLLHTEVRWLSRGNVLSRLCELREEVRIFLADQRSPLAEHLSDPDWVARLVYLSSVFGKLNGLNMSLQGENTSILTLNDKVQAFVRKLERWRERAEAGHMDMFTELDDFIEENALSVNIVRASVADHLQSLVDHFKKYFPEETAPERH-DWIRSPFTAK--TNHLTSDFEDALIELSSDRTLRALFDAKSLDEFWISVRKEYPQL 469          

HSP 2 Score: 57.7658 bits (138), Expect = 2.818e-82
Identity = 30/58 (51.72%), Postives = 37/58 (63.79%), Query Frame = 1
Query: 2335 LIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            L+ F STY CE  FS L  IK K+ SRL+ EDDLRIA+S I P ++ + S   A  SH
Sbjct:  477 LMPFGSTYLCEKTFSALTYIKNKHRSRLNVEDDLRIAVSKIKPRLDLLCSVHIAHPSH 534          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: A9X5I1 (Transposase OS=Danio rerio OX=7955 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 9.464e-82
Identity = 148/363 (40.77%), Postives = 223/363 (61.43%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSE---FTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            SLQ+ E+TDI   +QL+VYV+++ ++   E  L CK LEGR TG+ I  +++++  +N + W+    +CTDGAAA+TG + GV  LI + AP++V  HCM+HR+ALVAK I+++LH+VL+DV+  ++Y+K   L  RLF +LC EMG++ + LLLH+EVRWLSRG +L  ++ LR E+  FL ++   LA+ F ++    KLSCM D F+  + LN S+QG +  IL    K+ AF  KL L + +L E  T MFP +++    T  +NI       II  HL  L   F + F    +  L  +RDPF+   + + + L  KEQLID+S+D   + +F SL   + W+S    Y  L ++ I
Sbjct:  193 SLQLDESTDIANQAQLMVYVRFLGKDTFIEELLFCKPLEGRTTGQDICNMMDQFMTDNSVDWSRCIGVCTDGAAAMTGKHSGVVTLIKEKAPNVVGTHCMLHREALVAKRIEDDLHQVLKDVIRTVNYVKSRPLKHRLFRLLCKEMGADYEGLLLHSEVRWLSRGAVLSRVYALRKELREFLSDENLELAKCFKDDTWILKLSCMADFFQHLSFLNQSMQGHNVHILNAQDKVRAFTQKLSLWESKLEEGVTEMFPLYNQERISTTADNI-----TPIIQSHLSHLQGYFKQYFPDLNNNHLDFVRDPFAPG-VGTYLDLAAKEQLIDLSNDGGRKTRFPSLPLSEFWMSVREDYPMLSEKAI 549          

HSP 2 Score: 54.299 bits (129), Expect = 9.464e-82
Identity = 26/64 (40.62%), Postives = 43/64 (67.19%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +KA   L+ FA+TY CE+ FS L V+++K+ +RL+ E D+R+A++ + P  + +  S QA  SH
Sbjct:  546 EKAIKCLLPFATTYLCEAGFSALKVLQSKHRARLEVESDMRLALTKMKPRYDKLCRSHQAHPSH 609          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.409 bits (581), Expect = 2.008e-70
Identity = 129/368 (35.05%), Postives = 204/368 (55.43%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRF-EKFP--DKELG*IRDPFSFDIIN---SNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQIIF 2335
            ++Q+ E+TDI  +S L+ +V+Y    +I E  L CK L  + T   IF+++N +   N + W+    + TDGA A+ G   GV   +  +AP     HC +HR+AL AK +  +L  VL + V ++++IK   L SRLF +LC EMGS    LLLHTEVRWLSRGK+L  +F+LR+EV  FL++    L+  F + +   KLS + DIF   N LN+SLQG+S T   + +KIEA   KL +    + ++N   F   S+F  + N       N +S  +++  ++   +  + FP  D     I +PF  DI     +++  +++++LID+S D  L++ F   +    WL   ++Y DL  + + F
Sbjct:  250 AIQLDESTDIANLSNLLAFVRYEHNREIFEDILFCKPLPTKTTAVAIFDVLNAFIVSNGIEWSKCVGVSTDGARAMMGQRSGVIARVKAVAPLATSVHCSLHREALAAKRMSRDLKIVLDEAVKIVNFIKSRPLQSRLFRVLCEEMGSSHVQLLLHTEVRWLSRGKVLARLFELRDEVRIFLLDSNFELSDRFTDFEWLAKLSYLSDIFTHLNGLNISLQGKSVTAFHVQNKIEATIKKLDMWTKRVEQSNYESFDNLSDFLTKENAS---LPNAVSRPIVEHLQSLKMQLRDYFPALDVHFSWIENPF-VDICQGAIASLSASEEDRLIDLSCDSALKLIFSQKSLVNFWLHARSEYPDLSDKAVRF 613          

HSP 2 Score: 59.3066 bits (142), Expect = 2.008e-70
Identity = 29/63 (46.03%), Postives = 43/63 (68.25%), Query Frame = 1
Query: 2320 KANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            KA   L+ F +TY CE+ FS LVV+KTKY +RL+ E DLR+ +S + P++  +++  Q Q SH
Sbjct:  609 KAVRFLMPFPTTYLCETGFSMLVVLKTKYRNRLNVEPDLRLQLSALQPDIHHLVAGKQHQPSH 671          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 225.328 bits (573), Expect = 1.534e-69
Identity = 129/368 (35.05%), Postives = 201/368 (54.62%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRF-EKFP--DKELG*IRDPFSFDIIN---SNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQIIF 2335
            ++Q+ E+TDI  +S L+ +V+Y    +I E  L CK L  + T E IF+++N     N + W+    + TDGA A+ G   GV   +  +AP     HC +HR+AL AK +  +L  VL + V ++++IK   L SRLF +LC EM S    LLLHTEVRWLS GK+L  +F+LR+EV  FL++    L+  F + +   KLS + DIF   N LNLSLQG+S T   + +KIEA   KL +    + ++N   F   S+F  + N       N +S  +++  ++   +  + FP  D     I +PF  DI     +++  +++++LID+S D  L+  F   +    WL   ++Y DL  + + F
Sbjct:  207 AIQLDESTDIANLSNLLAFVRYEHNREIFEDILFCKPLPTKTTAEAIFDVLNALIVSNGIEWSKCVGVSTDGARAMMGQRSGVIASVKAVAPLATSVHCSLHREALAAKRMSRDLKIVLDEAVKIVNFIKSRPLQSRLFRVLCEEMASSHVQLLLHTEVRWLSHGKVLARLFELRDEVRIFLLDSNFELSDRFTDFEWLAKLSYLSDIFTHLNGLNLSLQGKSVTAFHVQNKIEATIKKLDMWTKRVEQSNYESFDNLSDFLTKENAS---LPNAVSRPIVEHLQSLKMQLRDYFPALDVHFSWIENPF-VDICQGAFASLSASEEDRLIDLSCDSALKFIFSQKSLVNFWLHARSEYPDLSDKAVRF 570          

HSP 2 Score: 59.3066 bits (142), Expect = 1.534e-69
Identity = 29/63 (46.03%), Postives = 43/63 (68.25%), Query Frame = 1
Query: 2320 KANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            KA   L+ F +TY CE+ FS LVV+KTKY +RL+ E DLR+ +S + P++  +++  Q Q SH
Sbjct:  566 KAVRFLMPFPTTYLCETGFSMLVVLKTKYRNRLNVEPDLRLQLSALQPDIHHLVAGKQHQPSH 628          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 5.278e-42
Identity = 117/353 (33.14%), Postives = 176/353 (49.86%), Query Frame = 2
Query: 1241 SSVSLQIGETTDITKMSQLIVYVKYVFEE-DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCF-------SEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKE--LG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLT 2269
            S  S+ + E+TDIT  +QL +YV+ V +  +++E  L    + G+ T ++IF  +    E   L W  F  I TDGA ++TG   G++   ++ A  +   HC+IH+QAL +K +  +   V+  VV  I+ I+  SL  R F  L  EM SE   +L  TEVRWLSRG IL+  F+LR EV  F+ EK  +      +      L+ +VDI  + N LN  LQG+   +      + AF  KL+L K +L++ N   FP         + F+ E  +D +L           L E F  RF  F           DPFSFD+ ++   L    +LID+  +  LR +FR ++
Sbjct:  229 SVYSVALDESTDITDTAQLAIYVRGVDDNFEVTEELLTVIPMHGQTTAQEIFHQLCDAIENAGLPWKRFVGITTDGAPSMTGRKNGLEEESVEEAIAL---HCIIHQQALCSKCL--KFDNVMSVVVKCINQIRSRSLKHRRFRALLEEMESEYGDVLYFTEVRWLSRGNILKRFFELRAEVKAFM-EKDGVAVTVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLVSAAYDNVRAFSAKLMLWKAQLSQTNFCHFPACKALMDAGTPFSGEKYVDAILM----------LQEEFDHRFADFKTHRATFQIFADPFSFDVQDAPPVLQM--ELIDLQCNSELRAKFREVS 563          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000050151.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:23214084:23215952:-1 gene:ENSAMXG00000029603.1 transcript:ENSAMXT00000050151.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 1.569e-41
Identity = 109/381 (28.61%), Postives = 190/381 (49.87%), Query Frame = 2
Query: 1247 VSLQIGETTDITKMSQLIVYVKYVFEE--DISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNS-LNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFI----NEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNI-DFMLFKNIISHHLIKLGENFAKRFEKFP-DKELG-*IRDP--------FSFDIINSNIHLNQ---KEQLIDISSDETLRIQFRSLTCQKIWLS--TENKYADLKK 2320
            V L + E+TD++  +QL+VY++++  E  +  E  L    L+    GE I+  I     +  +      +I TDGA A+ G  KG    + +    ++  HC+IH QA++   + +E  +V++ ++ +I++++ +S    R+      E  +    LLLH  VRWLS+G++L   + +R EV  FL + +   A +F     +E   G ++ + DI    N LNL LQG++ +I  L + + +F+ KL + K +L  + T  FP   +     ++  F+ F +       KL ENF+KRF+ F   +EL   I++P        F+ D+ +     N    + Q+ID+ +D  L+ QF        WL   +E  + DLKK
Sbjct:  185 VGLAVDESTDVSDNAQLLVYIRFLNREKNEFCEDLLGVTPLQTTTKGEDIYLAIKEMLSKRGIEPKKVISITTDGAPAMIGRGKGAVARLKEDNADLISYHCIIH-QAVLCSALSDEYAEVMKTMMKIINFLRASSSCQHRMLREFLKETDANSDDLLLHNNVRWLSKGRVLERFWSIRREVTAFLEKLESQKAANFSVFLNDEKNMGIIAFLADIMSHLNGLNLQLQGKNNSICDLMTAVRSFQRKLQVFKEDLQGDYTH-FPKVKQVQGHRDVSSFVEFVD-------KLIENFSKRFDSFSIGEELKLFIQNPFLITDVRAFTNDVTHHFKWANTGPLQMQMIDLQADVALKEQFARTESTTFWLQMVSETAFPDLKK 556          

HSP 2 Score: 51.2174 bits (121), Expect = 1.569e-41
Identity = 28/69 (40.58%), Postives = 41/69 (59.42%), Query Frame = 1
Query: 2311 FEKKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPED---DLRIAISHIVPNMEAIMSSLQAQTSH 2508
             +K A +IL  F STYSCE+ FS + +IKTKY S+L  E     +R+A++   P  + +    +AQ SH
Sbjct:  554 LKKVALFILTMFGSTYSCEAAFSTMNIIKTKYRSKLTNEHLHMCMRMALTSFKPRFKMLAGQAKAQFSH 622          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000057314.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:4224188:4227217:-1 gene:ENSAMXG00000029268.1 transcript:ENSAMXT00000057314.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.532 bits (397), Expect = 5.304e-40
Identity = 102/356 (28.65%), Postives = 176/356 (49.44%), Query Frame = 2
Query: 1229 RIQNSSVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPD--KELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLS 2290
            +++ S  S+Q+ ETT + + + LIVY +Y+   ++ +  L    L+    GE IF  ++ Y   +++ + +  A CTDGAA++ G NKG    + + APH +  HCM+HR AL  K + E+L++ L+ VV ++++IK   +N R+F+ LC +     +TLLLHTEVRWLSRGK              FLI                 K + + DIF   N+ N  +QG   T++     ++AF  K+   + +L + +   FP   + +     D +  +   + H+ +L E    RF    +   +   + DPF     +   HL  +++L+DI S+      +     ++ WL+
Sbjct:  166 KLKTSPFSIQLDETTTVAEEAILIVYAQYIEGTEVKQDILMSVNLKSTTRGEDIFSAVDTYITSHNIPYKNIVACCTDGAASMMGKNKGFNSRLKEKAPHCLVFHCMVHRHALAGKHLCEDLNETLKTVVKIVNFIKARPVNRRIFAQLCED--ETHQTLLLHTEVRWLSRGK--------------FLI-----------------KTAYLADIFSLYNEANKRMQGADGTVIECKETVDAFVRKVEFRRNKLKKGDLQHFPLLLQQSGGVLPDALTTQ--FACHMDRLQEEMHSRFSDIHELVSKDAWVMDPF-LAKEDDVEHLQAEDELMDIKSNSVCMRFYDEHGFKQFWLA 485          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000035574.1 (pep primary_assembly:ASM223467v1:10:5595259:5596581:-1 gene:ENSORLG00000022539.1 transcript:ENSORLT00000035574.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 278.1 bits (710), Expect = 1.508e-83
Identity = 144/365 (39.45%), Postives = 217/365 (59.45%), Query Frame = 2
Query: 1244 SVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDK--ELG*IRDPFSFDIIN-SNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            S SLQ+ E+TD++  +QL+ +V+Y   +DI EH L CK +EGR TGE IF ++N +F  N ++W    ++CTD AA++TGS KG+   I K  P I + HC+IHR+AL +K +   LH VL D + VI++I+   LN+RLF  LC   G+E   LLLHTEVRWLSRG++L  +F+LR EV+ FL E     A  F N D   KL  + DIF+K N+LN+SLQG+ T+IL L  K+  F  K  + K   ++ +   FP    F +  ++     K +I  HL  L   F   F    +K  +L  +R+PF     N S + +  +E+L+++SSD  L+++F + T  + WL    ++ +L ++ +
Sbjct:   16 SFSLQLDESTDVSGHAQLVAFVRYTDTDDICEHILFCKEMEGRTTGEDIFNVVNMFFTRNAISWKSCSSVCTDAAASMTGSAKGLIARIKKENPDIKWTHCVIHREALASKKMSPVLHDVLNDSIKVINFIRSRPLNARLFRSLCENTGAEHTELLLHTEVRWLSRGRVLSRLFELRAEVHTFLTEHGSPHATMFENTDWLAKLCYLADIFRKLNELNMSLQGKDTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKFGASTLTQFWLCVRQEHPELGQKAL 380          

HSP 2 Score: 51.6026 bits (122), Expect = 3.169e-6
Identity = 28/64 (43.75%), Postives = 40/64 (62.50%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +KA   L+ FASTY CE+ FS +++IKTK  +RL  E  L  A++ + P M  I+S +QA   H
Sbjct:  377 QKALEQLLPFASTYLCEASFSAMMLIKTKQRNRLCLEKSLITAVASLPPRMTKILSEVQAHICH 440          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000030788.1 (pep primary_assembly:ASM223467v1:17:2264135:2274164:1 gene:ENSORLG00000023031.1 transcript:ENSORLT00000030788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 275.789 bits (704), Expect = 5.793e-82
Identity = 144/365 (39.45%), Postives = 217/365 (59.45%), Query Frame = 2
Query: 1244 SVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDK--ELG*IRDPFSFDIIN-SNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            S SLQ+ E+TD++  +QL+ +V+Y+  +DI EH L CK +EGR TGE IF ++N +F  N ++W    ++CTD AA++TGS KG+   I K  P I + HC+IHR+AL +K +   L  VL D + VI++IK   LN+RLF  LC   G E   LLLHTEVRWLSRG++L  +F+LR EV+ FL E     A  F N D   KL  + DIF+K N+LN+SLQG++T+IL L  K+  F  K  + K   ++ +   FP    F +  ++     K +I  HL  L   F   F    +K  +L  +R+PF     N S + +  +E+L+++SSD  L+++F + T  + WL    ++ +L ++ +
Sbjct:  157 SFSLQLDESTDVSGHAQLVAFVRYIDTDDICEHILFCKEMEGRTTGEDIFNVVNMFFTRNAISWKSCSSVCTDAAASMTGSAKGLIARIKKENPDIKWTHCVIHREALASKKMSPALQDVLNDSIKVINFIKSRPLNARLFCNLCENTGVEHTELLLHTEVRWLSRGRVLSRLFELRAEVHTFLTEHGSPHATMFENTDWLAKLCYLADIFRKLNELNMSLQGKNTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDTDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKFGASTLTQFWLCERQEHPELGQKAL 521          

HSP 2 Score: 50.447 bits (119), Expect = 5.793e-82
Identity = 28/64 (43.75%), Postives = 40/64 (62.50%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +KA   L+ FASTY CE+ FS +++IKTK  +R   E  L  A++ + P M  I+S +QA  SH
Sbjct:  518 QKALEQLLPFASTYLCEASFSAMMLIKTKQRNRRCLEKSLITAVASLPPRMTKILSEVQAHISH 581          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000028946.1 (pep primary_assembly:ASM223467v1:20:802231:804233:-1 gene:ENSORLG00000029187.1 transcript:ENSORLT00000028946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.478 bits (698), Expect = 1.728e-81
Identity = 141/365 (38.63%), Postives = 216/365 (59.18%), Query Frame = 2
Query: 1244 SVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDK--ELG*IRDPFSFDIIN-SNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            S SLQ+ E+TD++  +QL+ +V+Y+  +DI EH L CK +EGR TGE IF ++N +F  N ++W     +CTD AA++TGS KG+   I K  P I + HC+IHR+AL +K +   LH VL D + VI++I+   LN+RLF  LC   G+E   LLLHTEVRWLSRG+++  +F+LR EV+ FL E     A  F N D   KL  + DIF+K ++LN+SLQG+ T+IL L  K+  F  K  + K   ++ +   FP    F +  ++     K +I  HL  L   F   F    +K  +L  +R+PF     N S + +  +E+L++++SD  L+++F   T  + WL    ++ +L ++ +
Sbjct:   39 SFSLQLDESTDVSGHAQLLAFVRYIDTDDICEHILFCKEMEGRTTGEDIFNVVNMFFTRNAISWKSCSTVCTDAAASMTGSAKGLIARIKKENPDIKWTHCVIHREALASKTMSPVLHDVLMDSIKVINFIRSRPLNARLFRSLCENTGAEHTELLLHTEVRWLSRGRVMSRLFELRAEVHTFLTEHGSPHATMFENTDWLAKLCYLADIFRKLSELNMSLQGKDTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVASDRGLQMKFGVSTLTQFWLCERQEHPELGQKAL 403          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000040762.1 (pep primary_assembly:ASM223467v1:1:8553592:8557739:1 gene:ENSORLG00000022190.1 transcript:ENSORLT00000040762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.937 bits (694), Expect = 3.973e-81
Identity = 143/369 (38.75%), Postives = 218/369 (59.08%), Query Frame = 2
Query: 1244 SVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEK-FPDK-----ELG*IRDPFSFDIIN-SNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            S SLQ+ E+TD++  +QL+ +V+Y+  +DI EH L CK +EGR TGE IF ++N +F  N ++W    ++CT+ AA++TGS KG+   I K  P+I + HC+IHR+AL +K +   LH VL   + VI++I+   LN+RLF  LC   G+E   LLLHTEVRWLSRG++L  +F+LR EV+ FL E     A  F N D   KL  + DIF+K N+LN+SLQG+ T+IL L  K+  F  K  + K   ++ +   FP    F +  ++     K +I  H   L  N    F   FPD      +L  +R+PF     N S + +  +E+L+++SSD  L+++F + T  + WL    ++ +L ++ +
Sbjct:  230 SFSLQLDESTDVSGHAQLVAFVRYIDTDDICEHILFCKEMEGRTTGEDIFNVVNMFFTRNAISWKSCSSVCTETAASMTGSAKGLIARIKKENPNIKWTHCVIHREALASKKMSPALHDVLNHSIKVINFIRSRPLNARLFRSLCENTGAEHTELLLHTEVRWLSRGRVLSRLFELRAEVHTFLTEHGSPHATMFENTDWLAKLCYLADIFRKLNELNMSLQGKDTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKLVIVGH---LAANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKFGASTLTQFWLCVRQEHPELGQKAL 595          

HSP 2 Score: 51.6026 bits (122), Expect = 3.973e-81
Identity = 28/64 (43.75%), Postives = 40/64 (62.50%), Query Frame = 1
Query: 2317 KKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +KA   L+ FASTY CE+ FS +++IKTK  +RL  E  L  A++ + P M  I+S +QA   H
Sbjct:  592 QKALEQLLPFASTYLCEASFSAMMLIKTKQRNRLCLEKSLITAVASLPPRMTKILSEVQAHICH 655          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000031208.1 (pep primary_assembly:ASM223467v1:14:26692610:26696672:-1 gene:ENSORLG00000026199.1 transcript:ENSORLT00000031208.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 275.789 bits (704), Expect = 7.762e-81
Identity = 142/365 (38.90%), Postives = 217/365 (59.45%), Query Frame = 2
Query: 1244 SVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDK--ELG*IRDPFSFDIIN-SNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKRQI 2329
            S SLQ+ E+TD++  +QL+ +V+Y+  +DI EH L CK +EGR TGE IF ++N +F  N ++W    ++CTD AA++TGS KG+   I K  P I + HC+IHR+AL +K +   L  VL D + VI++I+   LN+RLF  LC   G+E   LLLH EVRWLSRG++L  +F+LR EV+ FL E     A  F N D   KL  + DIF+K N+LN+SLQG+ T+IL L  K+  F  K+ + K   ++ +   FP    F +  ++     K +I  HL  L   F   F    +K  +L  +R+PF     N S + +  +E+L+++SSD  L+++F + T  + WL    ++ +L ++ +
Sbjct:  180 SFSLQLDESTDVSGHAQLVAFVRYIDTDDICEHILFCKEMEGRTTGEDIFNVVNTFFTRNAISWKSCSSVCTDVAASMTGSAKGLIARIKKENPDIKWTHCVIHREALASKKMSPALQDVLNDSIKVINFIRSRPLNARLFRSLCENTGAEHTELLLHPEVRWLSRGRVLSRLFELRAEVHTFLTEHGSPHATMFENTDWLAKLCYLADIFRKLNELNMSLQGKDTSILNLYDKVGGFLKKVEMWKRACDQEDFTCFPQLDVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKFGASTLTQFWLCVRQEHPELGQKAL 544          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000019238.1 (SMESG000019238.1)

HSP 1 Score: 186.422 bits (472), Expect = 8.868e-51
Identity = 129/388 (33.25%), Postives = 202/388 (52.06%), Query Frame = 2
Query: 1214 HVI*NRIQNSSVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEF-----TNENNIDFMLFKNIISHHLIKLGENFAKRF---EKFPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYADLKKR--QIIF*FNS 2347
            H +  R+     S+Q+ ET D  K + LI YV +       E  L  K ++ R T   +F I++ +  E ++ W +   ICTDGA +++G  + ++ L+ + +   ++ HCMIH++AL +K++   L+ VL             SL SR+FS LC +MGS    LL H E RWLSRGK L+ +F+LR E+  FL E+    A  F N     KL  +VDIF+K N LNL LQG +T IL  +  + AF  K  L    L E    MFP  +EF     T + +I+ +L    I+ HL  L +NF K F   EKF       +RDP  +  +   +  +++E  I  +++  ++ QF   +  + W   ++++A LK+   QI+  F++
Sbjct:   76 HQLFARLCEKLFSIQLDETIDNNKDAHLIAYVHFCDGVSAVEELLFWKSIQQRATSPALFTILDNFINEANIEWENCVGICTDGARSMSGRFQSMQTLVKQKSSQCIWTHCMIHKEALASKEMSTGLNIVL-------------SLKSRMFSELCKDMGSVHTALLFHYEARWLSRGKFLKRVFELREEICIFLEEENRQEAVMFRNTVFIMKLGYIVDIFEKLNVLNLQLQGTNTYILETNDTVNAFCRKWHLWFRNLKEKKLKMFPNINEFVKTYKTEKVHINVILL--TINKHLSMLAKNFKKYFFAEEKFLASYEW-VRDP--YHNVPQGLSTSEEETFIAFTTNSEIKRQFNKKSIFEFWAGLDDEFAILKRTAFQILLPFST 445          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000028317.1 (SMESG000028317.1)

HSP 1 Score: 158.688 bits (400), Expect = 1.187e-46
Identity = 110/365 (30.14%), Postives = 177/365 (48.49%), Query Frame = 2
Query: 1226 NRIQNSS-VSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKI--APHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGES-TTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEFTNENNIDFMLFKNIISHHLIKLGENFAKRFEKFPDKELG*IRDPFSFDIINSNIHLNQKEQLIDISSDETLRIQFRSLTCQKIWLSTENKYA 2308
            +RI+ SS  ++Q+ ET D+T  +QL           + E  L C+ L  + TGE I++ I+ +F+ ++L W++   +C DGAA++TG NKG+  LI K     HI + HCMIH++AL +K+  + L K  + +              RLF+ +     S+ + L+ H E+RWLS+GK LR +FDL +EV  FL+ +   +   F N       + + DIF+K NDLN SLQG+    IL    KI +F  KL L + ++   N  MF    +F  +                                     I +PF  ++      L ++E+  ++  D TL++ F+     + WLS +N+Y 
Sbjct:  811 DRIKKSSKFAIQLEETNDVTNFAQL----------QLVEDLLFCQPLHEKTTGEDIYKKIDDFFKAHNLKWSNCVHVCKDGAASMTGKNKGLLALIRKFNNGSHIKYAHCMIHKEALASKNDHQNLTKFYEML--------------RLFARVYENSNSQFEILINHAEMRWLSKGKSLRRLFDLSDEVRTFLMAENPSMTDFFQNAQWLCTFAYLADIFEKLNDLNKSLQGKGCDKILFAYDKILSFVKKLALLQQKVGNGNIDMFSGCCDFIEK-------------------------------------IENPFRKNLSLEFFTLQEQEEFTELICDRTLKLMFQEKDLDEFWLSIQNEYP 1114          

HSP 2 Score: 48.9062 bits (115), Expect = 1.187e-46
Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 1
Query: 2323 ANYI---LIQFASTYSCESRFSKLVVIKTKY*SRLDP-EDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            +NY+   L+ FASTY CE+ FS L+ IK +Y +RL   E+ LRI+ S IV   + + S  Q Q SH
Sbjct: 1117 SNYVMNTLLPFASTYLCEAGFSALLYIKPQYRTRLTTVENALRISWSQIVLRFDMLCSMKQQQKSH 1182          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000073961.1 (SMESG000073961.1)

HSP 1 Score: 164.081 bits (414), Expect = 3.570e-42
Identity = 98/255 (38.43%), Postives = 145/255 (56.86%), Query Frame = 2
Query: 1370 RKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEF-----TNENNIDFMLFKNIISHHLIKLGENFAKR 2119
            R T   +F I++ +  E ++ W +   ICTDGA +++G  K ++ L+ + +   ++ H MI+R+AL +K++   L+ VL  VV V++YIK   L SR+FS LC  MGS    LL + E RWLSRGK L+ +F+ R E+  FL E+    A  F + +   KL  +VDIF+K N LNL LQG +T IL  + K+ AF  KL L    L E    MFP  +EF     T E +I+ +     I+ HL  L +N  ++
Sbjct:  336 RATLTALFTILDNFINEANIEWENCVGICTDGARSMSGRFKSMQTLVKQKSSQCIWTHYMIYREALASKEMSTGLNIVLSTVVTVVNYIKTRPLKSRMFSELCKGMGSVHTALLFYCEARWLSRGKFLKRVFESREEICIFLEEENRQEAVMFRDIEFIMKLGYLVDIFEKLNVLNLQLQGTNTYILETNDKVNAFCRKLDLWLRNLKEKKLEMFPSKNEFVKTYKTEEVHINVIFL--TINKHLSMLAKNVGRQ 588          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000006631.1 (SMESG000006631.1)

HSP 1 Score: 137.117 bits (344), Expect = 2.949e-35
Identity = 70/168 (41.67%), Postives = 100/168 (59.52%), Query Frame = 2
Query: 1226 NRIQNSSVSLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVR 1729
            N++ N + +LQI ETTDI++ + L+ ++++V E +I    LCCK L  R TGE I+  IN YFE  +L W     I TDGA ++ GS KG      +    I  NHC +HR+AL AK +  EL  VL +V  +++YIK   L  R+F  LC  M ++ + LL HTE+R
Sbjct:  144 NKLPNINFALQIDETTDISEKAILLGFIRFVNENEIVNELLCCKELSERTTGEAIYNQINSYFEHLNLNWGQCVEISTDGAPSMIGSVKGFVTYAKQQYSEIYLNHCFLHREALFAKTLPAELKSVLTNVTDMVNYIKTRPLKCRIFKQLCMAMEAKYEGLLYHTEIR 311          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000061577.1 (SMESG000061577.1)

HSP 1 Score: 128.257 bits (321), Expect = 1.269e-31
Identity = 84/261 (32.18%), Postives = 128/261 (49.04%), Query Frame = 2
Query: 1250 SLQIGETTDITKMSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAWAHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDIDEELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWLSRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKTNDLNLSLQGESTTILTLSSKIEAFKNKLIL*KGELNENNTGMFPCFSEF 2032
            S+Q+ E  D  K + LI YV++       E    CK ++ R T   +F I++ +  E ++ W +   ICTDGA +++G  + ++ L+ + +   ++  CMIHR+ALV+K++   L+ VL  VV V++YIK  SLN   F     +   E+  + L  E R        +     R+ V+                     KL  +VDIF+K N LNL LQG +T IL  + K+ AF  KL L    L E    MFP  +EF
Sbjct:   19 SIQLDEAIDNNKDAHLIAYVRFCDGLSAVEELRFCKPIQQRATSTALFTILDNFINEANIKWENCVGICTDGARSMSGKFQSMQTLVKQKSSQCIWTPCMIHREALVSKEMRTGLNIVLSTVVTVVNYIKTRSLNLECFLNFVKKWDQEEICIYLEEENR--------QEAMMFRDTVF-------------------IMKLGYLVDIFEKLNVLNLQLQGTNTYILETNDKVNAFSRKLDLWLRNLKEKKLEMFPNINEF 252          

HSP 2 Score: 50.447 bits (119), Expect = 5.379e-6
Identity = 24/65 (36.92%), Postives = 43/65 (66.15%), Query Frame = 1
Query: 2314 EKKANYILIQFASTYSCESRFSKLVVIKTKY*SRLDPEDDLRIAISHIVPNMEAIMSSLQAQTSH 2508
            ++ A  IL+ F+++Y CE+ FS +  +KTKY S+ + E +LR++IS I P+ + + +  Q Q S+
Sbjct:  311 KRGAFQILLPFSTSYLCETGFSAVASLKTKYRSQQNIEKELRVSISGITPSFQKLCNEKQDQGSY 375          
The following BLAST results are available for this feature:
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZMYM64.050e-7139.24zinc finger MYM-type containing 6 [Source:HGNC Sym... [more]
ZBED92.257e-6936.84zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED92.475e-6936.84zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED56.887e-6433.88zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED56.887e-6433.88zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CR392001.38.963e-3428.05pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
AL928808.14.374e-3327.27pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000016563.11.508e-2731.44pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
spag12.284e-2732.35sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000028445.11.196e-1325.07general transcription factor II-I repeat domain-co... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zbed52.517e-7234.44zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Zmym63.852e-5833.97zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym64.517e-5833.97zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Gtf2ird22.222e-2626.51GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95789|ZMYM6_HUMAN1.945e-7039.24Zinc finger MYM-type protein 6 OS=Homo sapiens OX=... [more]
sp|Q6R2W3|SCND3_HUMAN9.975e-6936.84SCAN domain-containing protein 3 OS=Homo sapiens O... [more]
sp|A4Z943|ZBED5_BOVIN4.445e-6434.16Zinc finger BED domain-containing protein 5 OS=Bos... [more]
sp|Q4R6P1|F200A_MACFA5.522e-6437.87Protein FAM200A OS=Macaca fascicularis OX=9541 GN=... [more]
sp|A4Z944|ZBED5_CANLF2.131e-6333.88Zinc finger BED domain-containing protein 5 OS=Can... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9LNA12.728e-11549.32Reverse transcriptase domain-containing protein OS... [more]
A0A2S2P4I27.377e-8354.66Uncharacterized protein (Fragment) OS=Schizaphis g... [more]
A0A1A8P6Y31.358e-8241.40Dimer_Tnp_hAT domain-containing protein (Fragment)... [more]
A0A3Q1G3T12.818e-8238.63Uncharacterized protein OS=Acanthochromis polyacan... [more]
A9X5I19.464e-8240.77Transposase OS=Danio rerio OX=7955 PE=4 SV=1[more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000051422.12.008e-7035.05pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000044261.11.534e-6935.05pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030525.15.278e-4233.14pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
ENSAMXT00000050151.11.569e-4128.61pep primary_assembly:Astyanax_mexicanus-2.0:17:232... [more]
ENSAMXT00000057314.15.304e-4028.65pep primary_assembly:Astyanax_mexicanus-2.0:1:4224... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035574.11.508e-8339.45pep primary_assembly:ASM223467v1:10:5595259:559658... [more]
ENSORLT00000030788.15.793e-8239.45pep primary_assembly:ASM223467v1:17:2264135:227416... [more]
ENSORLT00000028946.11.728e-8138.63pep primary_assembly:ASM223467v1:20:802231:804233:... [more]
ENSORLT00000040762.13.973e-8138.75pep primary_assembly:ASM223467v1:1:8553592:8557739... [more]
ENSORLT00000031208.17.762e-8138.90pep primary_assembly:ASM223467v1:14:26692610:26696... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019238.18.868e-5133.25SMESG000019238.1[more]
SMESG000028317.11.187e-4630.14SMESG000028317.1[more]
SMESG000073961.13.570e-4238.43SMESG000073961.1[more]
SMESG000006631.12.949e-3541.67SMESG000006631.1[more]
SMESG000061577.11.269e-3132.18SMESG000061577.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000218 ID=SMED30000218|Name=zinc finger MYM-type protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=3031bp
TTTTAAACAACGACAGCAATCTACAAAAAAAAATTCACCCAAATAAGAAA
TATGCCAAAGAATAAAATAATAATTATCATAATTTCTAATGTATTATATT
TGTAAATTGTATTGAAATAAAAAAGAATATTAAAATAATATTTTTGCATT
CTAAATTTTTTCTTGCTCAATATCGACCAAATGTTTAATCAAGAACCTCT
TTCCCCTGGTCCCATGGAGTCCCGCTTTACGAATGCTAAAATCCGGTCAC
TTTATCCTAGACCAGTGGTGCGCAACCCATGGGTCGCGAGAAAAATTTTC
AGGGTCGCCAAATTAAAAAACTTTATATGACAATAAAAAATATAGCGCGC
TCGTAAACCTGGTGTGTTGTCAATCAACGTTTTTCTAAGTATCGTACTAA
TGGTGTATCTAAAGTCACAGCACATCGTGTTCACTCTAAGGAATTTTAAT
GGCTCATGCTACCTTCGTGCATGTCGCAGGCGACAGACTCTGCCCCGTTC
CCACCCCAACCAGACGTCGAGTGTGTTTACTCGAATATTCAACTATTCAG
TAGAACGTTGGTTTTGTTCACGTTCGTATGGACATCGAGTGAGGTGCGTA
TTTATTTAACTTCTTTTTTTTTATCGTACAGTGTAGTAGTGTTTTCGATG
TGCAATAATAACATTTAATTATTAAATTAATATACAGTGGCTCACAGGGA
ATCAGATGCATGACGATTGTTTTTTTAATAAAAAGAAAACGTACTGTAAA
CAATATATTTTTAAAATTAACTGCACTACATTATATCAAAGTGCACATAT
TATTGTAATTATATCGAATAAAAATGAAAAAGATTTTCAATCAACTTTAG
CCTATTAAGAGCAGATTCTATTATTTAGGTTAATAATAGGATTTGTAATA
TTTATAATCAAAGTAAATAAACTAATAACAATTTTTTTTGTTTAATATGA
AGATTACAACAGGCTTAATAATTTATGTAAGTAAATCATTCAAAAAATTA
TATTAAAATAGTGATTAATCCCGAAAAAATACTTTATTTTGTGCTGCATC
ATTTTCACTGTGAGCCACTGTAGATATTAAAATTATAATAAACGAAAACT
TATAGTTTTGTTTCAGTTTTAATACCCTCATAATGGATAAGTTGCTAAAA
ATAGGTACACAATGCCCAGAAAATGACAAGAATGACAATAAAAATAATAA
TGATGGACCATATCACGTAATATAGAATCGAATACAAAACTCCAGTGTTT
CTCTACAAATTGGCGAAACTACAGACATTACTAAAATGTCCCAATTAATT
GTTTATGTGAAATACGTTTTTGAAGAAGACATATCAGAACATTTTTTATG
TTGTAAAAGGTTAGAAGGAAGAAAAACTGGAGAGAAAATATTTGAAATTA
TTAACAGATATTTTGAGGAAAATGACCTTGCTTGGGCCCACTTTTTCGCT
ATTTGTACAGATGGTGCTGCAGCATTAACAGGTAGTAATAAAGGAGTTAA
GGGGTTAATAATAAAAATTGCTCCCCATATAGTATTCAACCATTGCATGA
TACATAGACAAGCACTAGTTGCAAAAGACATCGATGAAGAATTGCACAAA
GTATTACAGGATGTTGTTATTGTAATTGATTACATTAAAGGCAACAGCCT
AAACAGTCGTCTCTTTTCAATACTCTGTAATGAGATGGGTTCTGAGGATA
AGACGTTATTACTACATACTGAAGTCAGATGGCTATCTCGCGGCAAAATA
TTGCGACATATTTTTGATTTGAGAAACGAAGTTTACAATTTTTTGATAGA
AAAGAAACATATATTGGCACAATCATTCATTAATGAAGATTGTTTCGGAA
AACTCAGTTGCATGGTTGACATTTTCAAAAAAACTAACGATTTGAATTTG
AGTTTGCAGGGTGAAAGTACAACCATTTTAACATTGAGCAGTAAAATCGA
AGCTTTTAAGAATAAGCTGATACTTTAAAAAGGAGAATTAAACGAAAACA
ACACAGGCATGTTTCCGTGCTTTTCAGAATTTACTAATGAAAATAATATA
GATTTCATGTTATTTAAAAACATCATTTCCCATCATTTGATAAAATTGGG
AGAAAACTTTGCGAAAAGGTTCGAAAAATTTCCAGATAAAGAATTAGGTT
AGATCCGTGATCCATTTTCGTTTGATATTATTAATTCCAATATCCATTTA
AATCAAAAAGAACAGTTAATTGATATTTCAAGCGACGAAACTCTGCGTAT
TCAATTTAGGTCTCTGACTTGTCAAAAAATTTGGTTATCAACTGAAAACA
AATATGCCGATTTGAAAAAAAGGCAAATTATATTTTGATTCAATTCGCAT
CGACCTACTCATGTGAATCCCGCTTTTCAAAATTAGTTGTCATTAAAACA
AAATATTGATCTCGATTAGATCCAGAGGATGACTTACGGATTGCGATTTC
CCATATAGTTCCGAACATGGAGGCGATCATGAGTTCTTTGCAAGCACAAA
CCTCACATTGAATTCTTATGAATAAATGTTTAAATGTATTTTTTTTATAA
AATAAATATTTGTACTCATATGCATAAATAAACCATTGTGTAAAAACCTC
TAATAAAAGGAAATTCCAGAAATAGTTTCATTTTTAACTACATTGACGAT
TAAAAAAACCTACTGTCTACTTAGGTATCGCGACAAATTTTTTCAAAAAA
AATGGGGGTCGCAAATAAAGATAGGTTGCGCACCACTGTCCTAGACAACA
CTATAATTTAAACACAGCATAATGTTTGAGTGGTTTCCCCTTCAACATCT
TCAGTGTCAATTTCACATAGCAATTTCAGGAGCATGAATCACACACCGAA
GGTTATTTTTAGGATTCAAAATTTAAGGGAAATTCGATTTATTTTATTTT
TTGTTAAATTTTGATGTATCAAATATTTTGCACATAATTCTGTGTATCCG
TTTTACTTTTATATAATCCCAATAGATGCATTTAGTCCATTGATTATTGT
CAAGGATATTGGGGAAATCGATTGCCCGGAC
back to top

protein sequence of SMED30000218-orf-1

>SMED30000218-orf-1 ID=SMED30000218-orf-1|Name=SMED30000218-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=231bp
MSQLIVYVKYVFEEDISEHFLCCKRLEGRKTGEKIFEIINRYFEENDLAW
AHFFAICTDGAAALTGSNKGVKGLIIKIAPHIVFNHCMIHRQALVAKDID
EELHKVLQDVVIVIDYIKGNSLNSRLFSILCNEMGSEDKTLLLHTEVRWL
SRGKILRHIFDLRNEVYNFLIEKKHILAQSFINEDCFGKLSCMVDIFKKT
NDLNLSLQGESTTILTLSSKIEAFKNKLIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007010cytoskeleton organization
GO:0007275multicellular organism development
GO:0022604regulation of cell morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR45935FAMILY NOT NAMEDcoord: 1..144
NoneNo IPR availablePANTHERPTHR45935:SF5PROTEIN FAM200Acoord: 1..144