Glutamate receptor, metabotropic

Overview
NameGlutamate receptor, metabotropic
Smed IDSMED30000203
Length (bp)3357
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor, metabotropic (SMED30000203) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor, metabotropic (SMED30000203) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor, metabotropic (SMED30000203) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor, metabotropic (SMED30000203) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000203

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000203SMESG000064049.1 dd_Smed_v4_11092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000203SMESG000064049.1 dd_Smed_v4_11092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000203SMESG000064049.1 dd_Smed_v4_11092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000203SMESG000064049.1 dd_Smed_v4_11092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000203SMESG000064049.1 dd_Smed_v4_11092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor, metabotropic vs. Ensembl Human
Match: GRM5 (glutamate metabotropic receptor 5 [Source:HGNC Symbol;Acc:HGNC:4597])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 360/859 (41.91%), Postives = 527/859 (61.35%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK------------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QPT++  + R+CG +RE+YG+ RVE +L T++ IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL   E+            S     KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  LL +M +L +  + +L++G+DGWADR D+    +         A+G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY KTC    +L    +VQDSK+GFV+ ++ ++A+GLHN+   +C        G C      +G+ LL+ ++   F+    +T+ FD  GD PGRY+IMN++     +  +  + Y  +GSW    L ++D  + W K           I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ T+ +  +F  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD-MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGE-FLLLGSDGWADRYDVTDGYQ-------REAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTL-KTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP----GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFK-----EMGKDYFDYINVGSWDNGELKMDDDEV-WSK-------KSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV---FDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 851          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Human
Match: GRM5 (glutamate metabotropic receptor 5 [Source:HGNC Symbol;Acc:HGNC:4597])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 360/859 (41.91%), Postives = 527/859 (61.35%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK------------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QPT++  + R+CG +RE+YG+ RVE +L T++ IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL   E+            S     KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  LL +M +L +  + +L++G+DGWADR D+    +         A+G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY KTC    +L    +VQDSK+GFV+ ++ ++A+GLHN+   +C        G C      +G+ LL+ ++   F+    +T+ FD  GD PGRY+IMN++     +  +  + Y  +GSW    L ++D  + W K           I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ T+ +  +F  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD-MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGE-FLLLGSDGWADRYDVTDGYQ-------REAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTL-KTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP----GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFK-----EMGKDYFDYINVGSWDNGELKMDDDEV-WSK-------KSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV---FDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 851          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Human
Match: GRM5 (glutamate metabotropic receptor 5 [Source:HGNC Symbol;Acc:HGNC:4597])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 360/859 (41.91%), Postives = 527/859 (61.35%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK------------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QPT++  + R+CG +RE+YG+ RVE +L T++ IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL   E+            S     KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  LL +M +L +  + +L++G+DGWADR D+    +         A+G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY KTC    +L    +VQDSK+GFV+ ++ ++A+GLHN+   +C        G C      +G+ LL+ ++   F+    +T+ FD  GD PGRY+IMN++     +  +  + Y  +GSW    L ++D  + W K           I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ T+ +  +F  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD-MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGE-FLLLGSDGWADRYDVTDGYQ-------REAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTL-KTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP----GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFK-----EMGKDYFDYINVGSWDNGELKMDDDEV-WSK-------KSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV---FDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 851          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Human
Match: GRM1 (glutamate metabotropic receptor 1 [Source:HGNC Symbol;Acc:HGNC:4593])

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 372/861 (43.21%), Postives = 527/861 (61.21%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQ-EKSQVN-------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S+ R    + G ++IGALF +H QP       R+CGEIRE+YG+ RVE +  T+ +IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL S++ EK  +N               KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +A+++++  + W+Y+S ++++G+YGE G+   +E L     +C     +I  N  E      L     +  K +V++CFC+G TV  LL +M +L +  + + +IG+DGWADR ++   IE   +E    A G ITI+L S  +  FDDYF      +   NPWF EFW+ +F C +  +  ++  + + CT  ESL    YVQDSK+GFV+ ++  +A GL N++  +C      +  C      +G  LLD +I   F     E V FD KGD PGRYDIMN QY     T    Y Y  +G+W E  L I+D+ IQ         N    ++S CS+PC   QI++ R+ +  CCW C  C ENE     F   +C +C  G+ PN+D + C  IP  +L+WS+   I+AI FS +G+++T+ +  IF  Y +TPVVKS +REL Y+IL G+ L Y+  F L+ KPTT SC L R++ GLS ++ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ++I  +L  V++ ++  +I    P     Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+ CFA+  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK
Sbjct:   33 SSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKE-LAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGE-FSLIGSDGWADRDEV---IEGYEVE----ANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESL-EENYVQDSKMGFVINAIYAMAHGLQNMHHALC---PGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY-----TEANRYDYVHVGTWHEGVLNIDDYKIQM--------NKSGVVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEYVQDEF---TCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGK 864          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Human
Match: GRM1 (glutamate metabotropic receptor 1 [Source:HGNC Symbol;Acc:HGNC:4593])

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 372/861 (43.21%), Postives = 527/861 (61.21%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQ-EKSQVN-------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S+ R    + G ++IGALF +H QP       R+CGEIRE+YG+ RVE +  T+ +IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL S++ EK  +N               KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +A+++++  + W+Y+S ++++G+YGE G+   +E L     +C     +I  N  E      L     +  K +V++CFC+G TV  LL +M +L +  + + +IG+DGWADR ++   IE   +E    A G ITI+L S  +  FDDYF      +   NPWF EFW+ +F C +  +  ++  + + CT  ESL    YVQDSK+GFV+ ++  +A GL N++  +C      +  C      +G  LLD +I   F     E V FD KGD PGRYDIMN QY     T    Y Y  +G+W E  L I+D+ IQ         N    ++S CS+PC   QI++ R+ +  CCW C  C ENE     F   +C +C  G+ PN+D + C  IP  +L+WS+   I+AI FS +G+++T+ +  IF  Y +TPVVKS +REL Y+IL G+ L Y+  F L+ KPTT SC L R++ GLS ++ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ++I  +L  V++ ++  +I    P     Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+ CFA+  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK
Sbjct:   33 SSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKE-LAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGE-FSLIGSDGWADRDEV---IEGYEVE----ANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESL-EENYVQDSKMGFVINAIYAMAHGLQNMHHALC---PGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY-----TEANRYDYVHVGTWHEGVLNIDDYKIQM--------NKSGVVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEYVQDEF---TCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGK 864          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Celegans
Match: mgl-2 (Metabotropic GLutamate receptor family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU50])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 332/851 (39.01%), Postives = 512/851 (60.16%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLS----LQEKSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKN-TTDICTDEGLEIDN-KEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKL---NMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYP---KTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSK-SDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKTEYE 2756
            + G + IGALFPIH Q  + GS S  CGEI E+YG+ R E+ + T+K++NE    LP   LG+ IRDSCW   IA+EQ+I F++  ++     Q       S P+V +IGP  S  T+ VQNLLQ+F+IPQ+GYSAT+ DLS K  + YF+RVVPSD+ Q +A+  LL ++ W+Y+++L S G+YGE+G + L++ + + ++ +C     +I     E      L     +  +P+V++CFC+G ++    ++   L    M  K +  IG+DGWADR D++  +E       E A GS +IR+H+  IP F  Y+      +   NPWF+EFW++KFNC    +K DK     + C+  E+L +  Y +D KL  V+ S+  +A GL  +YQ  C   N TL  C   + RNG LL + ++++ +S    + V FD  GDPP  YDI+NY  G  +  N     Y  +GS+K  +    + L    KS   ++      +S CS PC   Q +  RE   CCW C+ C + +  NKT     C +C  G  PN++R+ C  I    + W+    I+A++ ++ G+I ++  + +F ++N+TPVVKS TREL Y+IL G+   Y  +F L+  P+T SC ++R++P ++F++++ +L+TKTNRI RIL+ SKK+I+ +K RFLTT +Q+VI ++L  V+ +I+ V +  ++P +  + Y++   + L C+TE++   I   +D  L+  CT YAFKTRNLPENFNEAKFIGFTMY T ++WI  +V+++ T  K + + F+   +A++ +  LF PKLYIIL  PE+N R+++TTT  IRCH G+ +  Y+
Sbjct:   33 IHGEIQIGALFPIHRQ--IAGSES--CGEIWEQYGIQRSEIAMLTVKQLNEE---LP-FKLGLSIRDSCWTERIAMEQTIAFLREGVAQCSCCQTPGCNKKSVPVVAVIGPGKSSSTIAVQNLLQVFRIPQVGYSATTPDLSDKEQFGYFLRVVPSDVFQAQAINRLLHHYNWTYVAVLYSAGNYGEKGFESLEKLIAHRSSSVCIAYSEKIKTLASEQEYRQVLTRLDSQNSRPQVVVCFCEGASMRMFFKAQKHLADGKMQMKRFQWIGSDGWADRNDVVEDLE-------EEAEGSFSIRIHAPKIPGFRQYYTALHPENNTMNPWFREFWQQKFNCQFAVSKEDKNNENIRICSGDENL-DEQYKEDPKLSQVINSIRVVALGLKAMYQDRC-RDNSTL--CTEMLSRNGTLLYEYLLNVTYSDQFKQPVYFDRNGDPPAWYDILNY-IGTKDLDN----PYNEVGSFKSINDYGVEELDMTAKSMFFDKTELLP-ESVCSRPCGIGQRQ--RETMACCWICESCLDIQYVNKT--TNQCMNCTLGSWPNANRTGCEYIIPEVVSWTSFGHILALVLAVTGIITSMATLAVFLRHNSTPVVKSTTRELSYIILSGLVACYAVSFALLATPSTTSCFITRVIPPIAFAVVYSALLTKTNRIARILAGSKKRILTKKPRFLTTFSQVVITWILVAVQCVIVGVGLMRDWPDATYAKYALPRKLILECDTETKSFLIPFFWDFFLITLCTLYAFKTRNLPENFNEAKFIGFTMYCTVVVWIAFLVLHMGTTHKALVMSFSYSLSASVALALLFFPKLYIILMHPEKNIRASYTTTKLIRCHFGNSQAAYD 854          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Celegans
Match: mgl-2 (Metabotropic GLutamate receptor family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU50])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 332/851 (39.01%), Postives = 512/851 (60.16%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLS----LQEKSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKN-TTDICTDEGLEIDN-KEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKL---NMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYP---KTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSK-SDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKTEYE 2756
            + G + IGALFPIH Q  + GS S  CGEI E+YG+ R E+ + T+K++NE    LP   LG+ IRDSCW   IA+EQ+I F++  ++     Q       S P+V +IGP  S  T+ VQNLLQ+F+IPQ+GYSAT+ DLS K  + YF+RVVPSD+ Q +A+  LL ++ W+Y+++L S G+YGE+G + L++ + + ++ +C     +I     E      L     +  +P+V++CFC+G ++    ++   L    M  K +  IG+DGWADR D++  +E       E A GS +IR+H+  IP F  Y+      +   NPWF+EFW++KFNC    +K DK     + C+  E+L +  Y +D KL  V+ S+  +A GL  +YQ  C   N TL  C   + RNG LL + ++++ +S    + V FD  GDPP  YDI+NY  G  +  N     Y  +GS+K  +    + L    KS   ++      +S CS PC   Q +  RE   CCW C+ C + +  NKT     C +C  G  PN++R+ C  I    + W+    I+A++ ++ G+I ++  + +F ++N+TPVVKS TREL Y+IL G+   Y  +F L+  P+T SC ++R++P ++F++++ +L+TKTNRI RIL+ SKK+I+ +K RFLTT +Q+VI ++L  V+ +I+ V +  ++P +  + Y++   + L C+TE++   I   +D  L+  CT YAFKTRNLPENFNEAKFIGFTMY T ++WI  +V+++ T  K + + F+   +A++ +  LF PKLYIIL  PE+N R+++TTT  IRCH G+ +  Y+
Sbjct:   33 IHGEIQIGALFPIHRQ--IAGSES--CGEIWEQYGIQRSEIAMLTVKQLNEE---LP-FKLGLSIRDSCWTERIAMEQTIAFLREGVAQCSCCQTPGCNKKSVPVVAVIGPGKSSSTIAVQNLLQVFRIPQVGYSATTPDLSDKEQFGYFLRVVPSDVFQAQAINRLLHHYNWTYVAVLYSAGNYGEKGFESLEKLIAHRSSSVCIAYSEKIKTLASEQEYRQVLTRLDSQNSRPQVVVCFCEGASMRMFFKAQKHLADGKMQMKRFQWIGSDGWADRNDVVEDLE-------EEAEGSFSIRIHAPKIPGFRQYYTALHPENNTMNPWFREFWQQKFNCQFAVSKEDKNNENIRICSGDENL-DEQYKEDPKLSQVINSIRVVALGLKAMYQDRC-RDNSTL--CTEMLSRNGTLLYEYLLNVTYSDQFKQPVYFDRNGDPPAWYDILNY-IGTKDLDN----PYNEVGSFKSINDYGVEELDMTAKSMFFDKTELLP-ESVCSRPCGIGQRQ--RETMACCWICESCLDIQYVNKT--TNQCMNCTLGSWPNANRTGCEYIIPEVVSWTSFGHILALVLAVTGIITSMATLAVFLRHNSTPVVKSTTRELSYIILSGLVACYAVSFALLATPSTTSCFITRVIPPIAFAVVYSALLTKTNRIARILAGSKKRILTKKPRFLTTFSQVVITWILVAVQCVIVGVGLMRDWPDATYAKYALPRKLILECDTETKSFLIPFFWDFFLITLCTLYAFKTRNLPENFNEAKFIGFTMYCTVVVWIAFLVLHMGTTHKALVMSFSYSLSASVALALLFFPKLYIILMHPEKNIRASYTTTKLIRCHFGNSQAAYD 854          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Celegans
Match: mgl-2 (Metabotropic GLutamate receptor family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU50])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 332/851 (39.01%), Postives = 512/851 (60.16%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLS----LQEKSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKN-TTDICTDEGLEIDN-KEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKL---NMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYP---KTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSK-SDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKTEYE 2756
            + G + IGALFPIH Q  + GS S  CGEI E+YG+ R E+ + T+K++NE    LP   LG+ IRDSCW   IA+EQ+I F++  ++     Q       S P+V +IGP  S  T+ VQNLLQ+F+IPQ+GYSAT+ DLS K  + YF+RVVPSD+ Q +A+  LL ++ W+Y+++L S G+YGE+G + L++ + + ++ +C     +I     E      L     +  +P+V++CFC+G ++    ++   L    M  K +  IG+DGWADR D++  +E       E A GS +IR+H+  IP F  Y+      +   NPWF+EFW++KFNC    +K DK     + C+  E+L +  Y +D KL  V+ S+  +A GL  +YQ  C   N TL  C   + RNG LL + ++++ +S    + V FD  GDPP  YDI+NY  G  +  N     Y  +GS+K  +    + L    KS   ++      +S CS PC   Q +  RE   CCW C+ C + +  NKT     C +C  G  PN++R+ C  I    + W+    I+A++ ++ G+I ++  + +F ++N+TPVVKS TREL Y+IL G+   Y  +F L+  P+T SC ++R++P ++F++++ +L+TKTNRI RIL+ SKK+I+ +K RFLTT +Q+VI ++L  V+ +I+ V +  ++P +  + Y++   + L C+TE++   I   +D  L+  CT YAFKTRNLPENFNEAKFIGFTMY T ++WI  +V+++ T  K + + F+   +A++ +  LF PKLYIIL  PE+N R+++TTT  IRCH G+ +  Y+
Sbjct:   33 IHGEIQIGALFPIHRQ--IAGSES--CGEIWEQYGIQRSEIAMLTVKQLNEE---LP-FKLGLSIRDSCWTERIAMEQTIAFLREGVAQCSCCQTPGCNKKSVPVVAVIGPGKSSSTIAVQNLLQVFRIPQVGYSATTPDLSDKEQFGYFLRVVPSDVFQAQAINRLLHHYNWTYVAVLYSAGNYGEKGFESLEKLIAHRSSSVCIAYSEKIKTLASEQEYRQVLTRLDSQNSRPQVVVCFCEGASMRMFFKAQKHLADGKMQMKRFQWIGSDGWADRNDVVEDLE-------EEAEGSFSIRIHAPKIPGFRQYYTALHPENNTMNPWFREFWQQKFNCQFAVSKEDKNNENIRICSGDENL-DEQYKEDPKLSQVINSIRVVALGLKAMYQDRC-RDNSTL--CTEMLSRNGTLLYEYLLNVTYSDQFKQPVYFDRNGDPPAWYDILNY-IGTKDLDN----PYNEVGSFKSINDYGVEELDMTAKSMFFDKTELLP-ESVCSRPCGIGQRQ--RETMACCWICESCLDIQYVNKT--TNQCMNCTLGSWPNANRTGCEYIIPEVVSWTSFGHILALVLAVTGIITSMATLAVFLRHNSTPVVKSTTRELSYIILSGLVACYAVSFALLATPSTTSCFITRVIPPIAFAVVYSALLTKTNRIARILAGSKKRILTKKPRFLTTFSQVVITWILVAVQCVIVGVGLMRDWPDATYAKYALPRKLILECDTETKSFLIPFFWDFFLITLCTLYAFKTRNLPENFNEAKFIGFTMYCTVVVWIAFLVLHMGTTHKALVMSFSYSLSASVALALLFFPKLYIILMHPEKNIRASYTTTKLIRCHFGNSQAAYD 854          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 389.037 bits (998), Expect = 2.088e-118
Identity = 263/868 (30.30%), Postives = 436/868 (50.23%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ---VNFSKP----------IVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXX----XXXXXXXXXXXXXVILCFCQGDTVTKLLR-SMTKLNMT---KKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRT--KTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESL--FNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVC---IVKNFTL-------EGCANFILRNGK-LLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNR------TEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAI---FLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNF--PKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLST----NLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNER 2693
            + G ++IG +FP+H + +LNG     CGEI E  G+HRVE +L  + +IN  ++ L    LG  I DSC     AL QS+DF+++ +   E S    ++ S P          +  ++G + S V+VQ+ NLL+LF+I Q+  ++T+ DLS KN ++YF R VPSD  Q  A++ +   FKWSY+SL+ S   YGE G    ++  +    IC      I NK+E+           L+  K     V++ F   + +  +LR +  ++ +T   KK  + + ++ W DR +   T  + R+    AA G+I + L S+ +P F++YF +    + +   N W +E W+ K+ C  +        +    K+S   FN     D K+ FV+ +V  IA GL ++ Q +C    ++N  +       E C      +G     + ++ + F+    +  RF  +GD P  Y I+ Y+    +K  R      +   Y  IG W EN+L I +  + W         + T + S CS PCK    +   + ++CCW C  C + E      H   C  C++G+ P  DR  C ++      +++W     +V  I ++ G+I T+ ++ ++  YN TPVVK+  REL Y++L+ + + Y  TF L+ KP+   C + R   G +FS ++ ++  KTN     +         ++ RF++  +Q+V+  +L  V+  +I  +IW +   P  +  Y     V L CN        S+ +D  L+  CT YA KTR +PENFNE KFIGF+MYTTC++W+  +  +  T     ++  SLC ++  +A + +  +F PKL+IILF+  +N R
Sbjct:   38 IPGDILIGGVFPVHSK-SLNGD--EPCGEIAETRGVHRVEAMLYALDQINSQNDFLRGYKLGALILDSCSNPAYALNQSLDFVRDMIGSSEASDYVCLDGSDPNLKKQSQKKNVAAVVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQAMAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEARK-KGICIALEERIQNKKESFTESINNLVQKLQPEKNVGATVVVLFVGTEYIPDILRYTAERMKLTSGAKKRIIWLASESW-DRNNDKYTAGDNRL----AAQGAIVLMLASQKVPSFEEYFMSLHPGTEAFERNKWLRELWQVKYKCEFDTPPGSTASRCEDIKQSTEGFNA----DDKVQFVIDAVYAIAHGLQSMKQAICPDDAIENHWISRYSKQPEICHAMQNIDGSDFYQNYLLKVNFTDIVGKRFRFSPQGDGPASYTILTYKPKSMDKKRRMTDDESSPSDYVEIGHWSENNLTIYEKNLWWDP-------DHTPV-SVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLINETH---CVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTN----RIFRIFSTRSAQRPRFISPISQVVMTAMLAGVQ--LIGSLIWLSVVPPGWRHHYPTRDQVVLTCNVPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVR 875          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 388.652 bits (997), Expect = 3.375e-118
Identity = 263/868 (30.30%), Postives = 436/868 (50.23%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ---VNFSKP----------IVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXX----XXXXXXXXXXXXXVILCFCQGDTVTKLLR-SMTKLNMT---KKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRT--KTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESL--FNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVC---IVKNFTL-------EGCANFILRNGK-LLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNR------TEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAI---FLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNF--PKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLST----NLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNER 2693
            + G ++IG +FP+H + +LNG     CGEI E  G+HRVE +L  + +IN  ++ L    LG  I DSC     AL QS+DF+++ +   E S    ++ S P          +  ++G + S V+VQ+ NLL+LF+I Q+  ++T+ DLS KN ++YF R VPSD  Q  A++ +   FKWSY+SL+ S   YGE G    ++  +    IC      I NK+E+           L+  K     V++ F   + +  +LR +  ++ +T   KK  + + ++ W DR +   T  + R+    AA G+I + L S+ +P F++YF +    + +   N W +E W+ K+ C  +        +    K+S   FN     D K+ FV+ +V  IA GL ++ Q +C    ++N  +       E C      +G     + ++ + F+    +  RF  +GD P  Y I+ Y+    +K  R      +   Y  IG W EN+L I +  + W         + T + S CS PCK    +   + ++CCW C  C + E      H   C  C++G+ P  DR  C ++      +++W     +V  I ++ G+I T+ ++ ++  YN TPVVK+  REL Y++L+ + + Y  TF L+ KP+   C + R   G +FS ++ ++  KTN     +         ++ RF++  +Q+V+  +L  V+  +I  +IW +   P  +  Y     V L CN        S+ +D  L+  CT YA KTR +PENFNE KFIGF+MYTTC++W+  +  +  T     ++  SLC ++  +A + +  +F PKL+IILF+  +N R
Sbjct:   49 IPGDILIGGVFPVHSK-SLNGD--EPCGEIAETRGVHRVEAMLYALDQINSQNDFLRGYKLGALILDSCSNPAYALNQSLDFVRDMIGSSEASDYVCLDGSDPNLKKQSQKKNVAAVVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQAMAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEARK-KGICIALEERIQNKKESFTESINNLVQKLQPEKNVGATVVVLFVGTEYIPDILRYTAERMKLTSGAKKRIIWLASESW-DRNNDKYTAGDNRL----AAQGAIVLMLASQKVPSFEEYFMSLHPGTEAFERNKWLRELWQVKYKCEFDTPPGSTASRCEDIKQSTEGFNA----DDKVQFVIDAVYAIAHGLQSMKQAICPDDAIENHWISRYSKQPEICHAMQNIDGSDFYQNYLLKVNFTDIVGKRFRFSPQGDGPASYTILTYKPKSMDKKRRMTDDESSPSDYVEIGHWSENNLTIYEKNLWWDP-------DHTPV-SVCSLPCKIGFRKQLIKDEQCCWACSKCEDYEYLINETH---CVGCEQGWWPTKDRKGCFDLSLSQLKYMRWRSMYSLVPTILAVFGIIATLFVIVVYVIYNETPVVKASGRELSYILLISMIMCYCMTFVLLSKPSAIVCAIKRTGIGFAFSCLYSAMFVKTN----RIFRIFSTRSAQRPRFISPISQVVMTAMLAGVQ--LIGSLIWLSVVPPGWRHHYPTRDQVVLTCNVPDHHFLYSLAYDGFLIVLCTTYAVKTRKVPENFNETKFIGFSMYTTCVVWLSWIFFFFGTGSDFQIQTSSLCISISMSANVALACIFSPKLWIILFEKHKNVR 886          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Fly
Match: mGluR (gene:FBgn0019985 transcript:FBtr0089184)

HSP 1 Score: 433.335 bits (1113), Expect = 2.001e-134
Identity = 289/900 (32.11%), Postives = 457/900 (50.78%), Query Frame = 3
Query:  216 PSNTRKTGFVS----GHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQVN-------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFN-------------------MPYVQDSKLGFVVKSVMTIAWGLHNIYQKVC-----------------------IVKNFTLEGCANFILRNGKLLLDE-MIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTN----LKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIR 2723
            PSNT     VS    G +++G LFP+HE+          CG      G+ R+E +L  I  +N + NILP +T+GV I D+C     AL QS+ F++ SL+  + S                 S P+ G+IG + S V++QV NLL+LF IPQ+  ++T+  LS K  +  F R VP D  Q  AL+++L  F WSY+S ++S+GSYGE GI+ L +      ++C     ++ +  +   FD++  KL KK   + ++ F + +   ++L++  + N+++  +  I +DGW  +  +L  +E       + A G+IT+ L S+ I DFD Y    T  +   NPWF E+WE  FNC +  T     P T     S  N                   + Y Q+SK  FVV +V   A+ LHN++   C                       I  +   + C +    +GK   +  ++++ F       V+FD +GD   RYDI+NYQ     + N + Y Y+ IG W  N L +    + W K  E          S CS PC+   I+  ++   CCW C  C   E     F   +C  C  G  P +D+ +C  +   ++KW+    ++ +  +I G+ +T I++ +FAK ++TP+V++  REL Y +L G+ + Y  TF L+ KPT  SC+L R   G+ FS+I+ +L+TKTNRI RI   + K   R K  +++  +Q+VI   L  ++++I  + +    P ++  Y     V L C  +      S  ++ +L+  CT YA KTR +PENFNE+KFIGFTMYTTCIIW+  V IY  T     ++  +LC ++  +A++ +V L+ PK+YI++F P++N R     +T  R
Sbjct:   28 PSNTHTQDSVSVSLPGDIILGGLFPVHEK-----GEGAPCGPKVYNRGVQRLEAMLYAIDRVNNDPNILPGITIGVHILDTCSRDTYALNQSLQFVRASLNNLDTSGYECADGSSPQLRKNASSGPVFGVIGGSYSSVSLQVANLLRLFHIPQVSPASTAKTLSDKTRFDLFARTVPPDTFQSVALVDILKNFNWSYVSTIHSEGSYGEYGIEALHKE-ATERNVCIAVAEKVPSAADDKVFDSIISKLQKKPNARGVVLFTRAEDARRILQAAKRANLSQP-FHWIASDGWGKQQKLLEGLE-------DIAEGAITVELQSEIIADFDRYMMQLTPETNQRNPWFAEYWEDTFNCVL--TSLSVKPDTSNSANSTDNKIGVKAKTECDDSYRLSEKVGYEQESKTQFVVDAVYAFAYALHNLHNDRCNTQSDQTTETRKHLQSESVWYRKISTDTKSQACPDMANYDGKEFYNNYLLNVSFIDLAGSEVKFDRQGDGLARYDILNYQ----RQENSSGYQYKVIGKWF-NGLQLNSETVVWNKETEQP-------TSACSLPCEVGMIKK-QQGDTCCWICDSCESFEYVYDEF---TCKDCGPGLWPYADKLSCYALDIQYMKWNSLFALIPMAIAIFGIALTSIVIVLFAKNHDTPLVRASGRELSYTLLFGILVCYCNTFALIAKPTIGSCVLQRFGIGVGFSIIYSALLTKTNRISRIFHSASKSAQRLK--YISPQSQVVITTSLIAIQVLITMIWMVVEPPGTRFYYPDRREVILKCKIQDMSFLFSQLYNMILITICTIYAIKTRKIPENFNESKFIGFTMYTTCIIWLAFVPIYFGTGNSYEVQTTTLCISISLSASVALVCLYSPKVYILVFHPDKNVRKLTMNSTVYR 893          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Fly
Match: mGluR (gene:FBgn0019985 transcript:FBtr0332858)

HSP 1 Score: 433.335 bits (1113), Expect = 2.001e-134
Identity = 289/900 (32.11%), Postives = 457/900 (50.78%), Query Frame = 3
Query:  216 PSNTRKTGFVS----GHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQVN-------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFN-------------------MPYVQDSKLGFVVKSVMTIAWGLHNIYQKVC-----------------------IVKNFTLEGCANFILRNGKLLLDE-MIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTN----LKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIR 2723
            PSNT     VS    G +++G LFP+HE+          CG      G+ R+E +L  I  +N + NILP +T+GV I D+C     AL QS+ F++ SL+  + S                 S P+ G+IG + S V++QV NLL+LF IPQ+  ++T+  LS K  +  F R VP D  Q  AL+++L  F WSY+S ++S+GSYGE GI+ L +      ++C     ++ +  +   FD++  KL KK   + ++ F + +   ++L++  + N+++  +  I +DGW  +  +L  +E       + A G+IT+ L S+ I DFD Y    T  +   NPWF E+WE  FNC +  T     P T     S  N                   + Y Q+SK  FVV +V   A+ LHN++   C                       I  +   + C +    +GK   +  ++++ F       V+FD +GD   RYDI+NYQ     + N + Y Y+ IG W  N L +    + W K  E          S CS PC+   I+  ++   CCW C  C   E     F   +C  C  G  P +D+ +C  +   ++KW+    ++ +  +I G+ +T I++ +FAK ++TP+V++  REL Y +L G+ + Y  TF L+ KPT  SC+L R   G+ FS+I+ +L+TKTNRI RI   + K   R K  +++  +Q+VI   L  ++++I  + +    P ++  Y     V L C  +      S  ++ +L+  CT YA KTR +PENFNE+KFIGFTMYTTCIIW+  V IY  T     ++  +LC ++  +A++ +V L+ PK+YI++F P++N R     +T  R
Sbjct:   28 PSNTHTQDSVSVSLPGDIILGGLFPVHEK-----GEGAPCGPKVYNRGVQRLEAMLYAIDRVNNDPNILPGITIGVHILDTCSRDTYALNQSLQFVRASLNNLDTSGYECADGSSPQLRKNASSGPVFGVIGGSYSSVSLQVANLLRLFHIPQVSPASTAKTLSDKTRFDLFARTVPPDTFQSVALVDILKNFNWSYVSTIHSEGSYGEYGIEALHKE-ATERNVCIAVAEKVPSAADDKVFDSIISKLQKKPNARGVVLFTRAEDARRILQAAKRANLSQP-FHWIASDGWGKQQKLLEGLE-------DIAEGAITVELQSEIIADFDRYMMQLTPETNQRNPWFAEYWEDTFNCVL--TSLSVKPDTSNSANSTDNKIGVKAKTECDDSYRLSEKVGYEQESKTQFVVDAVYAFAYALHNLHNDRCNTQSDQTTETRKHLQSESVWYRKISTDTKSQACPDMANYDGKEFYNNYLLNVSFIDLAGSEVKFDRQGDGLARYDILNYQ----RQENSSGYQYKVIGKWF-NGLQLNSETVVWNKETEQP-------TSACSLPCEVGMIKK-QQGDTCCWICDSCESFEYVYDEF---TCKDCGPGLWPYADKLSCYALDIQYMKWNSLFALIPMAIAIFGIALTSIVIVLFAKNHDTPLVRASGRELSYTLLFGILVCYCNTFALIAKPTIGSCVLQRFGIGVGFSIIYSALLTKTNRISRIFHSASKSAQRLK--YISPQSQVVITTSLIAIQVLITMIWMVVEPPGTRFYYPDRREVILKCKIQDMSFLFSQLYNMILITICTIYAIKTRKIPENFNESKFIGFTMYTTCIIWLAFVPIYFGTGNSYEVQTTTLCISISLSASVALVCLYSPKVYILVFHPDKNVRKLTMNSTVYR 893          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273326)

HSP 1 Score: 404.06 bits (1037), Expect = 1.892e-122
Identity = 261/840 (31.07%), Postives = 440/840 (52.38%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-----VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHL-KNTTDICTDEGLEIDNK-EEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKS---DKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTE-SQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTN----LKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAF 2702
            +    + G +++G L  +H +       S  CG I  + G+  +E +L T+ ++N+   +LP +TLG  + D C      LE ++DFIK S+S  + ++         K I G++G A+S  ++QV NLL+LF+IPQ+ Y +TS +LS+K  ++YF R +PSD  QVKA++ ++    WSY+S++  + +YG +  +EL+E L ++   I   E L  D+   E   +D +  KL  K + +  + F     V +++R++ + N T   +  IG+DGW+ R  +    E           G+++++  + P+  F++YF + T  +   NPWF EFWE  F C    + S   + Y K CT KE L       + +L FV  +VM  A+ L ++++ +C         C       G  LL  +  ++F     +  RFD  GD P RY+I++++     ++   +YH+ ++G + E  L +    +++      +R +    +S CS PC   Q + + E + CCW C +C+  +I +       C  CK G  P++ +  C  IP I+L+   A  I A+ FS  G+++T+ ++G+F ++N+TP+V++  REL Y++L G+ + Y  TF LV KPT   C + R   G  F++++ +L+TKTN           K   ++  F++  +Q+VI   L  V+I+I  V +      +   Y       L+C++       I+  +   L+  CT YA  TR +PE FNE+K IGFTMYTTC+IW+  V +Y  T     L+  S+   +  +A++ I  LF PKLYIIL +PERN R + 
Sbjct:   66 KHAAVLEGDVILGGLMMVHSRED-----SITCGPIMPQGGIQALEAMLYTLDQVNKQ-QLLPNVTLGAHLLDDCDKDTYGLEMAVDFIKGSISNIDDAEYHCNKTQVRKVISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPRARGAIIFGSDQEVRQVMRAVRRANATGS-FSWIGSDGWSARNLVSDDYE-------PEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGSTSTPYNNYTKQCTTKERLSRQNTDFEDQLQFVSDAVMAFAYALRDMHRDLC---GGGPSLCEAMKPTKGADLLKYLRKVEFEGLSGDEFRFDGNGDGPARYNIIHFK-----QSQAGQYHWVKVGEYTEGELRLNMTEVKF------KRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPD-DETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTN--RIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSM 874          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273327)

HSP 1 Score: 405.986 bits (1042), Expect = 6.199e-122
Identity = 267/853 (31.30%), Postives = 442/853 (51.82%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-----VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHL-KNTTDICTDEGLEIDNK-EEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKS---DKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTE-SQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTN----LKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSG 2741
            ++   V G +++G L  +H +       S  CG I  + G+  +E +L TI  IN    +LP +TLG  I D C      LE ++DFIK S+S  + ++         K I G++G A+S  ++QV NLL+LF+IPQ+ Y +TS +LS+K  ++YF R +PSD  QVKA++ ++    WSY+S++  + +YG +  +EL+E L ++   I   E L  D+   E   +D +  KL  K + +  + F     V +++R++ + N T   +  IG+DGW+ R  +    E           G+++++  + P+  F++YF + T  +   NPWF EFWE  F C    + S   + Y K CT KE L       + +L FV  +VM  A+ L ++++ +C         C       G  LL  +  ++F     +  RFD  GD P RY+I++++     ++   +YH+ ++G + E  L +    +++      +R +    +S CS PC   Q + + E + CCW C +C+  +I +       C  CK G  P++ +  C  IP I+L+   A  I A+ FS  G+++T+ ++G+F ++N+TP+V++  REL Y++L G+ + Y  TF LV KPT   C + R   G  F++++ +L+TKTN           K   ++  F++  +Q+VI   L  V+I+I  V +      +   Y       L+C++       I+  +   L+  CT YA  TR +PE FNE+K IGFTMYTTC+IW+  V +Y  T     L+  S+   +  +A++ I  LF PKLYIIL +PERN R +         H  +G
Sbjct:  219 KREAIVEGDVILGGLMMVHSRED-----SITCGPIMPQGGIQALEAMLFTIDRINR-EQLLPNITLGAHILDDCDKDSYGLEMAVDFIKGSISNIDDAEYHCNKTQVRKVISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPRARGAIIFGSDQEVRQVMRAVRRANATGS-FSWIGSDGWSARNLVSDDYE-------PEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGSTSTPYNNYTKQCTTKERLSRQNTDFEDQLQFVSDAVMAFAYALRDMHRDLC---GGGPSLCEAMKPTKGADLLKYLRKVEFEGLSGDEFRFDGNGDGPARYNIIHFK-----QSQAGQYHWVKVGEYTEGELRLNMTEVKF------KRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETH-CKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTN--RIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSMMPPRYGNMHRTAG 1040          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273325)

HSP 1 Score: 405.986 bits (1042), Expect = 7.264e-121
Identity = 265/840 (31.55%), Postives = 439/840 (52.26%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-----VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHL-KNTTDICTDEGLEIDNK-EEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKS---DKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTE-SQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTN----LKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAF 2702
            ++   V G +++G L  +H +       S  CG I  + G+  +E +L TI  IN    +LP +TLG  I D C      LE ++DFIK S+S  + ++         K I G++G A+S  ++QV NLL+LF+IPQ+ Y +TS +LS+K  ++YF R +PSD  QVKA++ ++    WSY+S++  + +YG +  +EL+E L ++   I   E L  D+   E   +D +  KL  K + +  + F     V +++R++ + N T   +  IG+DGW+ R  +    E           G+++++  + P+  F++YF + T  +   NPWF EFWE  F C    + S   + Y K CT KE L       + +L FV  +VM  A+ L ++++ +C         C       G  LL  +  ++F     +  RFD  GD P RY+I++++     ++   +YH+ ++G + E  L +    +++      +R +    +S CS PC   Q + + E + CCW C +C+  +I +       C  CK G  P++ +  C  IP I+L+   A  I A+ FS  G+++T+ ++G+F ++N+TP+V++  REL Y++L G+ + Y  TF LV KPT   C + R   G  F++++ +L+TKTN           K   ++  F++  +Q+VI   L  V+I+I  V +      +   Y       L+C++       I+  +   L+  CT YA  TR +PE FNE+K IGFTMYTTC+IW+  V +Y  T     L+  S+   +  +A++ I  LF PKLYIIL +PERN R + 
Sbjct:  386 KREAIVEGDVILGGLMMVHSRED-----SITCGPIMPQGGIQALEAMLFTIDRINRE-QLLPNITLGAHILDDCDKDSYGLEMAVDFIKGSISNIDDAEYHCNKTQVRKVISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTKPRARGAIIFGSDQEVRQVMRAVRRANATGS-FSWIGSDGWSARNLVSDDYE-------PEVEGTLSVQPQANPVRGFEEYFLSLTVENNQRNPWFVEFWEDHFQCRYPGSTSTPYNNYTKQCTTKERLSRQNTDFEDQLQFVSDAVMAFAYALRDMHRDLC---GGGPSLCEAMKPTKGADLLKYLRKVEFEGLSGDEFRFDGNGDGPARYNIIHFK-----QSQAGQYHWVKVGEYTEGELRLNMTEVKF------KRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETH-CKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTN--RIARIFKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILIRPERNVRQSM 1194          

HSP 2 Score: 50.8322 bits (120), Expect = 8.830e-6
Identity = 26/94 (27.66%), Postives = 48/94 (51.06%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSL 509
            +    + G +++G L  +H +       S  CG I  + G+  +E +L T+ ++N+   +LP +TLG  + D C      LE ++DFIK  + +
Sbjct:   66 KHAAVLEGDVILGGLMMVHSRED-----SITCGPIMPQGGIQALEAMLYTLDQVNKQ-QLLPNVTLGAHLLDDCDKDTYGLEMAVDFIKAHIQI 153          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Zebrafish
Match: grm5b (glutamate receptor, metabotropic 5b [Source:ZFIN;Acc:ZDB-GENE-090821-6])

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 372/879 (42.32%), Postives = 540/879 (61.43%), Query Frame = 3
Query:  168 LKLWIFISFIKTAYELPSNTRKT-GFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ---------------VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            L LW   S + TA    SN R+    + G ++IGALF +H QP  +  + R+CG +RE+YG+ RVE ++ T+  IN +  ILP +TLG +IRDSCW++ +ALEQSI+FI++SL   ++S+               +   KPIVGLIGP +S V +QVQNLLQLF IPQI YSATS+DLS K+ YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  +E +     IC     +I  N  E +    L        K +V+ CFC+G TV  +L +M + N+  + +L++G+DGWADR D+          + EAA G ITI+L S  +  FDDY+      +   NPWF EFW+ +F+C +  +  ++ KY +TC +++SL    Y QD+K+GFV+ ++ ++A GLH++ + +C      +  C      +G  LL+ ++   FS    E + FD  GD PG Y IMN++     K  +  + Y  +GSW  + L I+D  I WP  E+        IKS CS+PC   QI++ R+ +  CCWTC  C +NE     F   +C +C+ G  P  D   C  IP  +L+W D   I A++FS +GL+ T  ++ IF  Y +TPVVKS +REL Y+ILVG+ L YL TF L+ KP    C L R+  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI FLL ++++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:    9 LLLWRMTSLVSTAQ---SNERRVVAHIPGDIIIGALFSVHHQPPADKVHERKCGAVREQYGIQRVEAMMHTLDRINADPKILPNVTLGCEIRDSCWHSAVALEQSIEFIRDSLVAADESEEAGGGAKCADPGATPMKGKKPIVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMEAFKE-MAGKEGICIAHSDKIWSNAGEQNFDRLLVKLRKYLPKARVVACFCEGMTVRNILMAMRRQNLVGE-FLLVGSDGWADRYDVTDGY------VREAA-GGITIKLQSADVKWFDDYYLKLRPENNMRNPWFPEFWQHRFHCRLKGHAQENHKYNRTCGKRDSLRQQ-YAQDTKMGFVINAIYSMAHGLHSMQKSLC---PGVVGLCDAMRPIDGSKLLEFLMKTNFSGVTGEHIYFDENGDSPGSYVIMNFK-----KMGKDYFDYTNVGSWDNSGLQIDDDEI-WPSKED-------IIKSVCSEPCDKGQIKVIRKGEVSCCWTCTPCKDNEFV---FDEYTCRACELGSWPTDDLIGCDPIPVKYLRWGDPEPIAAVVFSCLGLMATFFVMSIFIIYRDTPVVKSSSRELCYIILVGICLGYLCTFCLIAKPHVIYCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFLLILLQLGIIVALFVMEPPDVIHDYPSIREVNLICNTTNLGVVAPLGYNGLLIMSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKTITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 855          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Zebrafish
Match: grm5a (glutamate receptor, metabotropic 5a [Source:ZFIN;Acc:ZDB-GENE-090821-9])

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 362/859 (42.14%), Postives = 532/859 (61.93%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-------------VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QP  +  + R+CG +RE+YG+ RVE ++ T+  IN +  ILP +TLG +IRDSCW++ +ALEQSI+FI+++L   E+ +             +   KPIVGLIGP +S V +QVQNLLQLF IPQI YSATS+DLS K+ YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  +L +M +  +  + +L++G+DGWADR D+    +       EAA G ITI+L S  +  FDDY+      +   NPWF EFW+ +F C +  +  +S KY KTCT+KESL +  Y QD+K+GFV+ ++ ++A+GLH + + +C       E        +G  LL+ ++   FS    E V FD  GD PGRY+IMN++     + +  +Y Y  +GSW    L ++D        EE   N+   I+S CSDPC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ TI +  +F ++++TPVVKS +REL ++IL G+ L YL TF L+ KP    C L R+  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L ++++ II  +     P+   DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT  +  +F+PK+YI+L KPERN RSAFTT+T +R H+G GK
Sbjct:   28 SERRVLAHIPGDIIIGALFSVHHQPPADKVHERKCGAVREQYGIQRVEAMMHTLDRINADPLILPNITLGCEIRDSCWHSAVALEQSIEFIRDTLVSAEEEEGMAKCSTEGGGTPMKGKKPIVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMEAFKD-MAAKEGICIAHSDKIYSNAGEQSFDRLLDKLRSHLPKARVVACFCEGMTVRGILMAMRRRRLVGE-FLLVGSDGWADRYDVTDGFQR------EAA-GGITIKLQSAYVTWFDDYYLNLQPDTNMRNPWFPEFWQHRFQCRLKGHPQESVKYNKTCTKKESLRHQ-YAQDTKMGFVINAIYSMAFGLHAMQKSLCPGYAGLCEAMRPI---DGGKLLEFLMRTNFSGVSGEVVLFDENGDSPGRYEIMNFK-----QMSEEDYSYIHVGSWDNRGLKMDD--------EEIWANSSAIIRSVCSDPCEKAQIKVIRKGEVSCCWTCTPCKENEFV---FDEYTCRACELGSWPTDDLTGCERIPVQYLQWGDPEPIAAVVFACLGLLATIFVTLVFVRFHDTPVVKSSSRELCFIILAGICLGYLCTFCLIAKPHVAYCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILILIQLGIIVALFIMEPPQVIYDYPSIREVHLICNTTTLGVVAPLGYNGLLIMSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATTALCCMFVPKVYIMLAKPERNVRSAFTTSTVVRMHVGDGK 857          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Zebrafish
Match: grm5a (glutamate receptor, metabotropic 5a [Source:ZFIN;Acc:ZDB-GENE-090821-9])

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 362/859 (42.14%), Postives = 532/859 (61.93%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-------------VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QP  +  + R+CG +RE+YG+ RVE ++ T+  IN +  ILP +TLG +IRDSCW++ +ALEQSI+FI+++L   E+ +             +   KPIVGLIGP +S V +QVQNLLQLF IPQI YSATS+DLS K+ YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  +L +M +  +  + +L++G+DGWADR D+    +       EAA G ITI+L S  +  FDDY+      +   NPWF EFW+ +F C +  +  +S KY KTCT+KESL +  Y QD+K+GFV+ ++ ++A+GLH + + +C       E        +G  LL+ ++   FS    E V FD  GD PGRY+IMN++     + +  +Y Y  +GSW    L ++D        EE   N+   I+S CSDPC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ TI +  +F ++++TPVVKS +REL ++IL G+ L YL TF L+ KP    C L R+  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L ++++ II  +     P+   DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT  +  +F+PK+YI+L KPERN RSAFTT+T +R H+G GK
Sbjct:   28 SERRVLAHIPGDIIIGALFSVHHQPPADKVHERKCGAVREQYGIQRVEAMMHTLDRINADPLILPNITLGCEIRDSCWHSAVALEQSIEFIRDTLVSAEEEEGMAKCSTEGGGTPMKGKKPIVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMEAFKD-MAAKEGICIAHSDKIYSNAGEQSFDRLLDKLRSHLPKARVVACFCEGMTVRGILMAMRRRRLVGE-FLLVGSDGWADRYDVTDGFQR------EAA-GGITIKLQSAYVTWFDDYYLNLQPDTNMRNPWFPEFWQHRFQCRLKGHPQESVKYNKTCTKKESLRHQ-YAQDTKMGFVINAIYSMAFGLHAMQKSLCPGYAGLCEAMRPI---DGGKLLEFLMRTNFSGVSGEVVLFDENGDSPGRYEIMNFK-----QMSEEDYSYIHVGSWDNRGLKMDD--------EEIWANSSAIIRSVCSDPCEKAQIKVIRKGEVSCCWTCTPCKENEFV---FDEYTCRACELGSWPTDDLTGCERIPVQYLQWGDPEPIAAVVFACLGLLATIFVTLVFVRFHDTPVVKSSSRELCFIILAGICLGYLCTFCLIAKPHVAYCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILILIQLGIIVALFIMEPPQVIYDYPSIREVHLICNTTTLGVVAPLGYNGLLIMSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATTALCCMFVPKVYIMLAKPERNVRSAFTTSTVVRMHVGDGK 857          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Zebrafish
Match: grm1b (glutamate receptor, metabotropic 1b [Source:ZFIN;Acc:ZDB-GENE-090821-3])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 356/861 (41.35%), Postives = 533/861 (61.90%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQEKSQ--------------VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            + +R    + G ++IGALF +H QP+      R+CGEIRE+YG+ RVE +  T+  IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL S++++ +                  KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +AL++++  + W+Y+S ++++G+YGE G++  +E L +   +C     +I  N  E H    L     +  K +V++CFC+G TV  LL +M +L +  + +L+IG+DGWADR +++   E       E A+G IT++L ++ +  F+DYF     ++   NPWF EFW+ +F C +  +  ++  Y K C+  ESL +  YVQDSK+GFV+ ++  +A GLH++++ +C      +  C      +G  LLD ++   F+    E V FD  GD PGRYDIMN QY          + Y  +GSW E  L I+D++IQ  +SE         ++S CS+PC   +I++ R+ +  CCW C  C +NE     F   +C +C+ G+ P+ +   C  +P  +L+WS    I A++FS +G+++T  +  +F  Y +TPVVKS +REL Y+IL G+ L Y+  F L+ +P+  SC L R++ GLS S+ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ+VI F+L  +++ +   +I    P+    Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+  F++  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK
Sbjct:   33 AASRSVARMDGDIIIGALFSVHHQPSAEKVAERKCGEIREQYGIQRVEAMFYTLDRINSDPYLLPNITLGCEIRDSCWHSSVALEQSIEFIRDSLISIRDEREGPKWCVEGNPSAQPPATKKPIAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARALLDIVKRYNWTYVSAVHTEGNYGESGMEAFKE-LASQEGLCIAHSDKIYSNAGEKHFDRLLRKLRERLPKARVVVCFCEGMTVRGLLMAMRRLGVAGE-FLLIGSDGWADRDEVVEGYE-------EEAVGGITVKLQTEEVTSFNDYFLKLRLATNNRNPWFAEFWQHRFQCRLAGHPQENTNYRKNCSGYESLEDN-YVQDSKMGFVINAIYAMAHGLHDMHEHLCPGH---VGLCEEMDPIDGSKLLDFLLKTSFAGVSGEDVWFDENGDSPGRYDIMNLQY-----VEPGVFDYINVGSWHEGILSIDDYMIQMNRSE--------MVRSVCSEPCSKGEIKVIRKGEVSCCWICTPCKDNEYVQDEF---TCKACELGWWPDEELQVCEPLPLRYLEWSHPESIAAVVFSCLGILVTSFVTLVFILYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPSIASCYLQRLLVGLSASMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVVIAFILISMQLTLEVTLIILEPPEPIKSYPSIREVFLICNTSNMGMVAPLGYNGLLILSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTSFSVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGK 864          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Zebrafish
Match: grm1b (glutamate receptor, metabotropic 1b [Source:ZFIN;Acc:ZDB-GENE-090821-3])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 356/861 (41.35%), Postives = 533/861 (61.90%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQEKSQ--------------VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            + +R    + G ++IGALF +H QP+      R+CGEIRE+YG+ RVE +  T+  IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL S++++ +                  KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +AL++++  + W+Y+S ++++G+YGE G++  +E L +   +C     +I  N  E H    L     +  K +V++CFC+G TV  LL +M +L +  + +L+IG+DGWADR +++   E       E A+G IT++L ++ +  F+DYF     ++   NPWF EFW+ +F C +  +  ++  Y K C+  ESL +  YVQDSK+GFV+ ++  +A GLH++++ +C      +  C      +G  LLD ++   F+    E V FD  GD PGRYDIMN QY          + Y  +GSW E  L I+D++IQ  +SE         ++S CS+PC   +I++ R+ +  CCW C  C +NE     F   +C +C+ G+ P+ +   C  +P  +L+WS    I A++FS +G+++T  +  +F  Y +TPVVKS +REL Y+IL G+ L Y+  F L+ +P+  SC L R++ GLS S+ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ+VI F+L  +++ +   +I    P+    Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+  F++  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK
Sbjct:   33 AASRSVARMDGDIIIGALFSVHHQPSAEKVAERKCGEIREQYGIQRVEAMFYTLDRINSDPYLLPNITLGCEIRDSCWHSSVALEQSIEFIRDSLISIRDEREGPKWCVEGNPSAQPPATKKPIAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARALLDIVKRYNWTYVSAVHTEGNYGESGMEAFKE-LASQEGLCIAHSDKIYSNAGEKHFDRLLRKLRERLPKARVVVCFCEGMTVRGLLMAMRRLGVAGE-FLLIGSDGWADRDEVVEGYE-------EEAVGGITVKLQTEEVTSFNDYFLKLRLATNNRNPWFAEFWQHRFQCRLAGHPQENTNYRKNCSGYESLEDN-YVQDSKMGFVINAIYAMAHGLHDMHEHLCPGH---VGLCEEMDPIDGSKLLDFLLKTSFAGVSGEDVWFDENGDSPGRYDIMNLQY-----VEPGVFDYINVGSWHEGILSIDDYMIQMNRSE--------MVRSVCSEPCSKGEIKVIRKGEVSCCWICTPCKDNEYVQDEF---TCKACELGWWPDEELQVCEPLPLRYLEWSHPESIAAVVFSCLGILVTSFVTLVFILYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPSIASCYLQRLLVGLSASMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVVIAFILISMQLTLEVTLIILEPPEPIKSYPSIREVFLICNTSNMGMVAPLGYNGLLILSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTSFSVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGK 864          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 372/856 (43.46%), Postives = 532/856 (62.15%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-----VNFS-------KPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            R   +++G ++IGALF +H QPT++  + R+CGEIRE+YG+ RVE +L  +  IN +  +LP ++LG +IRDSCW+  +ALEQSI+FI++SL   E+ +     V+ S       KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V++CFC+G TV  LL +M + N+  + +L++G+DGWADR D+    +       EAA G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY +TC  + SL +  YVQDSK+GFV+ ++  +A+GLHN+   +C        G C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     K  +  Y Y  +GSW    L ++D  I W        N    I+S CSDPC   QI++ R+ +  CCWTC  C +NEI    F   +C +C  G  P  D + C  IP  FL+WSD   I A++FS +GL+ T+ ++ IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   32 RVVSYMAGDIIIGALFSVHHQPTVDKVHERKCGEIREQYGIQRVEAMLHALDRINADQTLLPNISLGCEIRDSCWHTAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSAPSRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGERGMEAFKD-MSAKDGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVVCFCEGMTVRGLLMAMKRQNIIGE-FLLLGSDGWADRYDVTDGYQR------EAA-GGITIKLQSPDVKWFDDYYLQLRPENNLRNPWFQEFWQHRFQCKLKGYSQENQKYNRTCNSRMSLRSQ-YVQDSKMGFVINAIYAMAYGLHNMQTVLCP----GYAGLCDAMKPIDGQKLLDSIMKANFTGVSGDMITFDENGDSPGRYEIMNFK-----KMGKDYYDYINVGSWDNGELKMDDDEI-W-------SNKNLVIRSVCSDPCAKGQIKVIRKGEVSCCWTCTPCKDNEIV---FDEYTCKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVYLICNTNNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 857          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 372/856 (43.46%), Postives = 532/856 (62.15%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-----VNFS-------KPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            R   +++G ++IGALF +H QPT++  + R+CGEIRE+YG+ RVE +L  +  IN +  +LP ++LG +IRDSCW+  +ALEQSI+FI++SL   E+ +     V+ S       KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V++CFC+G TV  LL +M + N+  + +L++G+DGWADR D+    +       EAA G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY +TC  + SL +  YVQDSK+GFV+ ++  +A+GLHN+   +C        G C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     K  +  Y Y  +GSW    L ++D  I W        N    I+S CSDPC   QI++ R+ +  CCWTC  C +NEI    F   +C +C  G  P  D + C  IP  FL+WSD   I A++FS +GL+ T+ ++ IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   32 RVVSYMAGDIIIGALFSVHHQPTVDKVHERKCGEIREQYGIQRVEAMLHALDRINADQTLLPNISLGCEIRDSCWHTAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSAPSRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGERGMEAFKD-MSAKDGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVVCFCEGMTVRGLLMAMKRQNIIGE-FLLLGSDGWADRYDVTDGYQR------EAA-GGITIKLQSPDVKWFDDYYLQLRPENNLRNPWFQEFWQHRFQCKLKGYSQENQKYNRTCNSRMSLRSQ-YVQDSKMGFVINAIYAMAYGLHNMQTVLCP----GYAGLCDAMKPIDGQKLLDSIMKANFTGVSGDMITFDENGDSPGRYEIMNFK-----KMGKDYYDYINVGSWDNGELKMDDDEI-W-------SNKNLVIRSVCSDPCAKGQIKVIRKGEVSCCWTCTPCKDNEIV---FDEYTCKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVYLICNTNNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 857          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 372/856 (43.46%), Postives = 532/856 (62.15%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-----VNFS-------KPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            R   +++G ++IGALF +H QPT++  + R+CGEIRE+YG+ RVE +L  +  IN +  +LP ++LG +IRDSCW+  +ALEQSI+FI++SL   E+ +     V+ S       KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V++CFC+G TV  LL +M + N+  + +L++G+DGWADR D+    +       EAA G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY +TC  + SL +  YVQDSK+GFV+ ++  +A+GLHN+   +C        G C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     K  +  Y Y  +GSW    L ++D  I W        N    I+S CSDPC   QI++ R+ +  CCWTC  C +NEI    F   +C +C  G  P  D + C  IP  FL+WSD   I A++FS +GL+ T+ ++ IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   21 RVVSYMAGDIIIGALFSVHHQPTVDKVHERKCGEIREQYGIQRVEAMLHALDRINADQTLLPNISLGCEIRDSCWHTAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSAPSRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGERGMEAFKD-MSAKDGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVVCFCEGMTVRGLLMAMKRQNIIGE-FLLLGSDGWADRYDVTDGYQR------EAA-GGITIKLQSPDVKWFDDYYLQLRPENNLRNPWFQEFWQHRFQCKLKGYSQENQKYNRTCNSRMSLRSQ-YVQDSKMGFVINAIYAMAYGLHNMQTVLCP----GYAGLCDAMKPIDGQKLLDSIMKANFTGVSGDMITFDENGDSPGRYEIMNFK-----KMGKDYYDYINVGSWDNGELKMDDDEI-W-------SNKNLVIRSVCSDPCAKGQIKVIRKGEVSCCWTCTPCKDNEIV---FDEYTCKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVYLICNTNNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 846          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 372/856 (43.46%), Postives = 532/856 (62.15%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-----VNFS-------KPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            R   +++G ++IGALF +H QPT++  + R+CGEIRE+YG+ RVE +L  +  IN +  +LP ++LG +IRDSCW+  +ALEQSI+FI++SL   E+ +     V+ S       KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V++CFC+G TV  LL +M + N+  + +L++G+DGWADR D+    +       EAA G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY +TC  + SL +  YVQDSK+GFV+ ++  +A+GLHN+   +C        G C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     K  +  Y Y  +GSW    L ++D  I W        N    I+S CSDPC   QI++ R+ +  CCWTC  C +NEI    F   +C +C  G  P  D + C  IP  FL+WSD   I A++FS +GL+ T+ ++ IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   32 RVVSYMAGDIIIGALFSVHHQPTVDKVHERKCGEIREQYGIQRVEAMLHALDRINADQTLLPNISLGCEIRDSCWHTAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSAPSRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGERGMEAFKD-MSAKDGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVVCFCEGMTVRGLLMAMKRQNIIGE-FLLLGSDGWADRYDVTDGYQR------EAA-GGITIKLQSPDVKWFDDYYLQLRPENNLRNPWFQEFWQHRFQCKLKGYSQENQKYNRTCNSRMSLRSQ-YVQDSKMGFVINAIYAMAYGLHNMQTVLCP----GYAGLCDAMKPIDGQKLLDSIMKANFTGVSGDMITFDENGDSPGRYEIMNFK-----KMGKDYYDYINVGSWDNGELKMDDDEI-W-------SNKNLVIRSVCSDPCAKGQIKVIRKGEVSCCWTCTPCKDNEIV---FDEYTCKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVYLICNTNNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 857          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 372/856 (43.46%), Postives = 532/856 (62.15%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-----VNFS-------KPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            R   +++G ++IGALF +H QPT++  + R+CGEIRE+YG+ RVE +L  +  IN +  +LP ++LG +IRDSCW+  +ALEQSI+FI++SL   E+ +     V+ S       KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V++CFC+G TV  LL +M + N+  + +L++G+DGWADR D+    +       EAA G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY +TC  + SL +  YVQDSK+GFV+ ++  +A+GLHN+   +C        G C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     K  +  Y Y  +GSW    L ++D  I W        N    I+S CSDPC   QI++ R+ +  CCWTC  C +NEI    F   +C +C  G  P  D + C  IP  FL+WSD   I A++FS +GL+ T+ ++ IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   32 RVVSYMAGDIIIGALFSVHHQPTVDKVHERKCGEIREQYGIQRVEAMLHALDRINADQTLLPNISLGCEIRDSCWHTAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSAPSRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGERGMEAFKD-MSAKDGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVVCFCEGMTVRGLLMAMKRQNIIGE-FLLLGSDGWADRYDVTDGYQR------EAA-GGITIKLQSPDVKWFDDYYLQLRPENNLRNPWFQEFWQHRFQCKLKGYSQENQKYNRTCNSRMSLRSQ-YVQDSKMGFVINAIYAMAYGLHNMQTVLCP----GYAGLCDAMKPIDGQKLLDSIMKANFTGVSGDMITFDENGDSPGRYEIMNFK-----KMGKDYYDYINVGSWDNGELKMDDDEI-W-------SNKNLVIRSVCSDPCAKGQIKVIRKGEVSCCWTCTPCKDNEIV---FDEYTCKACDLGSWPTDDLTGCDPIPVEFLRWSDPEPIAAVVFSCLGLLATMFVMAIFILYRDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPQQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFVLICIQLGIIVALFIMEPPDVIFDYPSIREVYLICNTNNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 857          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 362/857 (42.24%), Postives = 528/857 (61.61%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK-----------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QPT++  + R+CG +RE+YG+ RVE +L T++ IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL   E+           S     KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  LL +M +L +  + +L++G+DGWADR D+    +         A+G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY KTC    +L    +VQDSK+GFV+ ++ ++A+GLHN+   +C         C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     +  +  + Y  +GSW    L ++D  + W K     +NN   I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ T+ +  IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD-MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGE-FLLLGSDGWADRYDVTDGYQ-------REAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTH-HVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGL---CDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFK-----EMGKDYFDYINVGSWDNGELKMDDDEV-WSK-----KNN--IIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV---FDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 850          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 362/857 (42.24%), Postives = 528/857 (61.61%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK-----------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QPT++  + R+CG +RE+YG+ RVE +L T++ IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL   E+           S     KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  LL +M +L +  + +L++G+DGWADR D+    +         A+G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY KTC    +L    +VQDSK+GFV+ ++ ++A+GLHN+   +C         C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     +  +  + Y  +GSW    L ++D  + W K     +NN   I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ T+ +  IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD-MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGE-FLLLGSDGWADRYDVTDGYQ-------REAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTH-HVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGL---CDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFK-----EMGKDYFDYINVGSWDNGELKMDDDEV-WSK-----KNN--IIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV---FDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 850          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 362/857 (42.24%), Postives = 528/857 (61.61%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK-----------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QPT++  + R+CG +RE+YG+ RVE +L T++ IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL   E+           S     KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  LL +M +L +  + +L++G+DGWADR D+    +         A+G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY KTC    +L    +VQDSK+GFV+ ++ ++A+GLHN+   +C         C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     +  +  + Y  +GSW    L ++D  + W K     +NN   I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ T+ +  IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD-MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGE-FLLLGSDGWADRYDVTDGYQ-------REAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTH-HVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGL---CDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFK-----EMGKDYFDYINVGSWDNGELKMDDDEV-WSK-----KNN--IIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV---FDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 850          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Mouse
Match: Grm1 (glutamate receptor, metabotropic 1 [Source:MGI Symbol;Acc:MGI:1351338])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 372/861 (43.21%), Postives = 527/861 (61.21%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQ-EKSQVN-------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S+ R    + G ++IGALF +H QP       R+CGEIRE+YG+ RVE +  T+ +IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL S++ EK  +N               KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +A+++++  + W+Y+S ++++G+YGE G+   +E L     +C     +I  N  E      L     +  K +V++CFC+G TV  LL +M +L +  + + +IG+DGWADR ++   IE   +E    A G ITI+L S  +  FDDYF      +   NPWF EFW+ +F C +  +  ++  + K CT  ESL    YVQDSK+GFV+ ++  +A GL N++  +C      +  C      +G+ LLD +I   F     E V FD KGD PGRYDIMN QY     T    Y Y  +G+W E  L I+D+ IQ         N    ++S CS+PC   QI++ R+ +  CCW C  C ENE     F   +C +C  G+ PN++ + C  I   +L+WSD   I+AI FS +G+++T+ +  IF  Y +TPVVKS +REL Y+IL G+ L Y+  F L+ KPTT SC L R++ GLS ++ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ++I  +L  V++ ++  +I    P     Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+ CFA+  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK
Sbjct:   33 SSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKE-LAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGE-FSLIGSDGWADRDEV---IEGYEVE----ANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESL-EENYVQDSKMGFVINAIYAMAHGLQNMHHALC---PGYVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQY-----TEANRYDYVHVGTWHEGVLNIDDYKIQM--------NKSGMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEF---TCRACDLGWWPNAELTGCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGK 864          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Mouse
Match: Grm1 (glutamate receptor, metabotropic 1 [Source:MGI Symbol;Acc:MGI:1351338])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 372/861 (43.21%), Postives = 527/861 (61.21%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQ-EKSQVN-------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S+ R    + G ++IGALF +H QP       R+CGEIRE+YG+ RVE +  T+ +IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL S++ EK  +N               KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +A+++++  + W+Y+S ++++G+YGE G+   +E L     +C     +I  N  E      L     +  K +V++CFC+G TV  LL +M +L +  + + +IG+DGWADR ++   IE   +E    A G ITI+L S  +  FDDYF      +   NPWF EFW+ +F C +  +  ++  + K CT  ESL    YVQDSK+GFV+ ++  +A GL N++  +C      +  C      +G+ LLD +I   F     E V FD KGD PGRYDIMN QY     T    Y Y  +G+W E  L I+D+ IQ         N    ++S CS+PC   QI++ R+ +  CCW C  C ENE     F   +C +C  G+ PN++ + C  I   +L+WSD   I+AI FS +G+++T+ +  IF  Y +TPVVKS +REL Y+IL G+ L Y+  F L+ KPTT SC L R++ GLS ++ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ++I  +L  V++ ++  +I    P     Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+ CFA+  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK
Sbjct:   33 SSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKE-LAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGE-FSLIGSDGWADRDEV---IEGYEVE----ANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESL-EENYVQDSKMGFVINAIYAMAHGLQNMHHALC---PGYVGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQY-----TEANRYDYVHVGTWHEGVLNIDDYKIQM--------NKSGMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEF---TCRACDLGWWPNAELTGCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGK 864          
BLAST of Glutamate receptor, metabotropic vs. UniProt/SwissProt
Match: sp|P31424|GRM5_RAT (Metabotropic glutamate receptor 5 OS=Rattus norvegicus OX=10116 GN=Grm5 PE=1 SV=2)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 362/857 (42.24%), Postives = 528/857 (61.61%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK-----------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QPT++  + R+CG +RE+YG+ RVE +L T++ IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL   E+           S     KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  LL +M +L +  + +L++G+DGWADR D+    +         A+G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY KTC    +L    +VQDSK+GFV+ ++ ++A+GLHN+   +C         C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     +  +  + Y  +GSW    L ++D  + W K     +NN   I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ T+ +  IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD-MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGE-FLLLGSDGWADRYDVTDGYQ-------REAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTH-HVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGL---CDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFK-----EMGKDYFDYINVGSWDNGELKMDDDEV-WSK-----KNN--IIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV---FDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 850          
BLAST of Glutamate receptor, metabotropic vs. UniProt/SwissProt
Match: sp|Q3UVX5|GRM5_MOUSE (Metabotropic glutamate receptor 5 OS=Mus musculus OX=10090 GN=Grm5 PE=1 SV=2)

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 362/857 (42.24%), Postives = 528/857 (61.61%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK-----------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QPT++  + R+CG +RE+YG+ RVE +L T++ IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL   E+           S     KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  LL +M +L +  + +L++G+DGWADR D+    +         A+G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY KTC    +L    +VQDSK+GFV+ ++ ++A+GLHN+   +C         C      +G+ LLD ++   F+    + + FD  GD PGRY+IMN++     +  +  + Y  +GSW    L ++D  + W K     +NN   I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ T+ +  IF  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD-MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGE-FLLLGSDGWADRYDVTDGYQ-------REAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTH-HVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGL---CDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFK-----EMGKDYFDYINVGSWDNGELKMDDDEV-WSK-----KNN--IIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV---FDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 850          
BLAST of Glutamate receptor, metabotropic vs. UniProt/SwissProt
Match: sp|P41594|GRM5_HUMAN (Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2)

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 360/859 (41.91%), Postives = 527/859 (61.35%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK------------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN--KTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QPT++  + R+CG +RE+YG+ RVE +L T++ IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL   E+            S     KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  LL +M +L +  + +L++G+DGWADR D+    +         A+G ITI+L S  +  FDDY+      +   NPWFQEFW+ +F C +     ++ KY KTC    +L    +VQDSK+GFV+ ++ ++A+GLHN+   +C        G C      +G+ LL+ ++   F+    +T+ FD  GD PGRY+IMN++     +  +  + Y  +GSW    L ++D  + W K           I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++F+ +GL+ T+ +  +F  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L RI  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD-MSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGE-FLLLGSDGWADRYDVTDGYQ-------REAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTL-KTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP----GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFK-----EMGKDYFDYINVGSWDNGELKMDDDEV-WSK-------KSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYV---FDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 851          
BLAST of Glutamate receptor, metabotropic vs. UniProt/SwissProt
Match: sp|P23385|GRM1_RAT (Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1)

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 373/861 (43.32%), Postives = 528/861 (61.32%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQ-EKSQVN-------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S+ R    + G ++IGALF +H QP       R+CGEIRE+YG+ RVE +  T+ +IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL S++ EK  +N               KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +A+++++  + W+Y+S ++++G+YGE G+   +E L     +C     +I  N  E      L     +  K +V++CFC+G TV  LL +M +L +  + + +IG+DGWADR ++   IE   +E    A G ITI+L S  +  FDDYF      +   NPWF EFW+ +F C +  +  ++  + K CT  ESL    YVQDSK+GFV+ ++  +A GL N++  +C      +  C      +G+ LLD +I   F     E V FD KGD PGRYDIMN QY     T    Y Y  +G+W E  L I+D+ IQ         N    ++S CS+PC   QI++ R+ +  CCW C  C ENE     F   +C +C  G+ PN++ + C  IP  +L+WSD   I+AI FS +G+++T+ +  IF  Y +TPVVKS +REL Y+IL G+ L Y+  F L+ KPTT SC L R++ GLS ++ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ++I  +L  V++ ++  +I    P     Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+ CFA+  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK
Sbjct:   33 SSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKE-LAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGE-FSLIGSDGWADRDEV---IEGYEVE----ANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEEN-YVQDSKMGFVINAIYAMAHGLQNMHHALCPGH---VGLCDAMKPIDGRKLLDFLIKSSFVGVSGEEVWFDEKGDAPGRYDIMNLQY-----TEANRYDYVHVGTWHEGVLNIDDYKIQM--------NKSGMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEF---TCRACDLGWWPNAELTGCEPIPVRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGK 864          
BLAST of Glutamate receptor, metabotropic vs. UniProt/SwissProt
Match: sp|Q13255|GRM1_HUMAN (Metabotropic glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRM1 PE=1 SV=3)

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 372/861 (43.21%), Postives = 527/861 (61.21%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQ-EKSQVN-------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S+ R    + G ++IGALF +H QP       R+CGEIRE+YG+ RVE +  T+ +IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL S++ EK  +N               KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +A+++++  + W+Y+S ++++G+YGE G+   +E L     +C     +I  N  E      L     +  K +V++CFC+G TV  LL +M +L +  + + +IG+DGWADR ++   IE   +E    A G ITI+L S  +  FDDYF      +   NPWF EFW+ +F C +  +  ++  + + CT  ESL    YVQDSK+GFV+ ++  +A GL N++  +C      +  C      +G  LLD +I   F     E V FD KGD PGRYDIMN QY     T    Y Y  +G+W E  L I+D+ IQ         N    ++S CS+PC   QI++ R+ +  CCW C  C ENE     F   +C +C  G+ PN+D + C  IP  +L+WS+   I+AI FS +G+++T+ +  IF  Y +TPVVKS +REL Y+IL G+ L Y+  F L+ KPTT SC L R++ GLS ++ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ++I  +L  V++ ++  +I    P     Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+ CFA+  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK
Sbjct:   33 SSQRSVARMDGDVIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSIEFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKE-LAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGE-FSLIGSDGWADRDEV---IEGYEVE----ANGGITIKLQSPEVRSFDDYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESL-EENYVQDSKMGFVINAIYAMAHGLQNMHHALC---PGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY-----TEANRYDYVHVGTWHEGVLNIDDYKIQM--------NKSGVVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEYVQDEF---TCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFSCLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGK 864          
BLAST of Glutamate receptor, metabotropic vs. TrEMBL
Match: A0A1S3HL97 (metabotropic glutamate receptor 1 OS=Lingula unguis OX=7574 GN=LOC106155460 PE=3 SV=1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 402/884 (45.48%), Postives = 565/884 (63.91%), Query Frame = 3
Query:  156 NIKMLKLWIF--ISFIKTAYELPSNT---RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSL-----------QEKSQVN--FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDK-YPKTCT-RKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRE-RKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            N++M  LW    I  +     +P++    RK   + G +++GALFP+H QPT   +Y+R+CGEI E+YGMHR+E  L T+  IN ++ +LP +TLG DIRDSCWY P+ALEQSIDFIKNS+S            QE+  V+    KPI GLIGP +S VTVQVQNLLQLF IPQIGY+ATS DLS K+ YKYF+RVVP D LQ KA+++++  F W+YIS + ++G+YG  G++      K    +C     ++ N  +   ++ +   L +    +V++CFC+G TV  LL + T+LN   + +L IG+DGWA R D++        +L EAA G ++IRLHS P+  FD ++   +      NPWFQ+FW++KF C+IN    DK +   CT   E   ++ YVQD+KLGFVV ++ T+A  LHNI+Q VC   N     C  F+  NG + L  +I++ F+ Y NE++ FD  GDPPGRY+IMNYQY     +      Y +IG W +  LV+ + +IQWP+++    N  + ++S CS PC   +++ F +  ++CCW C  C EN+I         C +C KG+ PN D + C  I   F++W +   +VA +F+ VG  + +  + IF KYNNTPVVK+ TREL Y+IL+G+ L+Y TTF L+ KP+  SC ++RI+PGL+FS+I+G+LVT+TNRI RIL+ SKKKI+ +K RF+ TTAQI I  ++ ++E   I   + +    S  DY     V+L+CNT    + + MGFD  L+  CT+YA KTRN+PENFNEAKFIGFTMYTTC+IW+  V IY  +  K I++C  +  +AT+ +V LF PKLYIIL KP RN RSAFTTT ++RCHIGS +
Sbjct:    3 NLRMKLLWEVWAIGAVLLCAPIPASVGQQRKLISIDGDVILGALFPVHRQPTQKTAYTRQCGEIWEQYGMHRIEAFLLTLDAINNDTTLLPNVTLGCDIRDSCWYPPVALEQSIDFIKNSISASIEPHDVENMTQEEHCVHEESPKPIAGLIGPGSSTVTVQVQNLLQLFNIPQIGYAATSKDLSDKSLYKYFLRVVPPDNLQAKAMLDVVLKFNWTYISTVYTEGNYGASGMEAFTAIAKKA-GLCIATAEKVKNNADYESYNTVIRNLKETPNARVVVCFCEGMTVKGLLNATTRLNAVGE-FLFIGSDGWAVRPDVV-------KDLEEAAAGGMSIRLHSPPLRAFDQHYFNLSPFEPSRNPWFQDFWQEKFQCYINGENRDKRFSAPCTGSGEEDLSINYVQDAKLGFVVNAIYTMAHALHNIHQLVC---NGRPGVCPGFLPVNGSIFLSHLINVSFTNYANESLYFDQNGDPPGRYEIMNYQYFQTPNSTEFNASYVQIGEWLDGILVLNESIIQWPQND----NTSSHVESACSRPCPKGKVKQFLDASERCCWACIPCKENQIL---LSESQCENCAKGWWPNDDLTVCLPIKIEFMQWQNTEAVVACVFASVGTGLALFTLVIFFKYNNTPVVKASTRELSYIILIGIVLAYFTTFALLAKPSETSCYITRILPGLAFSMIYGALVTRTNRIARILARSKKKIMTKKPRFMGTTAQIFISIIIIILECGSIIATLIYQPANSTLDYPTPTRVKLVCNTTVLGIMVPMGFDFFLIAACTFYAIKTRNVPENFNEAKFIGFTMYTTCVIWVAFVPIYFGSESKVITMCMCVSLSATVALVILFFPKLYIILLKPHRNSRSAFTTTKDVRCHIGSSQ 867          
BLAST of Glutamate receptor, metabotropic vs. TrEMBL
Match: A0A068WKL9 (Metabotropic glutamate receptor 5 OS=Echinococcus granulosus OX=6210 GN=EgrG_000591300 PE=3 SV=1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 376/893 (42.11%), Postives = 557/893 (62.37%), Query Frame = 3
Query:  168 LKLWIFISFIKTAYELPSNTRKTGF------VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK-------------------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKE-EXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTI---ENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPG-NPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLV-IEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKK-CCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSV-AATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKT 2747
            L  WI+I  + T  EL        +      + G +MIGALFPIHEQPT+  ++SR+CG +RE+YG+HR+E L++TI+ INEN NILP + LGVD RD+CWYAPIALEQ +DFI+ +   +E                    S  +   PI  LIGP +SE+T QV  +LQLF IPQIGYSAT+ +LS+   Y+YF+RVVPSD LQV+ +++LL  + W+Y++L+NS G YG+ GI  L+  + +   IC++    IDNKE E    +          K KV++CFCQG+TV  LL++M  L++  KGY++IG DGW+DR DILG +   + G    S  A GS++I++HS  + DFD+YF   T  +    +PWF EFWE+KF+C I  + SD   K CT +ESL N+P  QD+KL  +  ++  +A  LH + + VC V    +  C   +  NG LL  E++   ++  + +T+ FD  GDPPG YD+MNYQ+ +NE+     + Y ++G WK   L+ +++  IQW     N       ++S CS+PC   + +I +++ K CCW C+ C  NE       NE+C  C  GF+P+ +++ C  I   +  W+DAS + AIIF+ +G ++TI+I+ +F  Y NT VVK+ TRELM++IL  + L++  T  ++++P+  +C L R +PGL+F+ I+ +LVTKTNRI RI+  SK+ +++++  FL+T+AQ+ I  +L  VE+ +I+ M+    P ++  +S      RL CNT  +   I +GF   L+  CT YA KTRNLP NFNEAKFIGFTMYTTC++W+ ++ +YLS    E++L   +  +ATI ++ LF+PK YIIL +PE+N R +F T  +IRCH+G  +T
Sbjct:    3 LARWIWIVLLVTVSELQMAPYGVLYHKLKVRIPGDIMIGALFPIHEQPTVETAFSRQCGNVREQYGIHRIETLIRTIQMINENENILPRIRLGVDARDTCWYAPIALEQCMDFIRTAFIYREYEDCLQMTNGSNGKCLPPGVSPSSIEIPIAALIGPGSSEMTKQVHQVLQLFSIPQIGYSATAAELSNIAEYQYFLRVVPSDDLQVEVIVSLLKRYGWTYVALVNSNGFYGDRGIAALRYRM-DEIGICSETERSIDNKETEEAFLELAQDIFNPDRKAKVVVCFCQGETVAGLLKAMDTLHLQGKGYMLIGADGWSDRQDILGPLVDPKTGERAFSRLAQGSLSIKIHSPKVEDFDEYFTNLTPQTHHNISPWFTEFWEQKFDCAITPS-SDNLRKPCTGEESLKNVPMYQDNKLSLLNLAIYVVAIALHRVQEIVCGVGRPGI--CPGLLPVNGSLLRQELLKSNYTDSNGDTIFFDENGDPPGSYDLMNYQHTFNERGEEV-FDYVQVGRWKHGQLITLQEEFIQWQGDSPNA-TASGPVRSFCSEPCGAWEAKIIKDKSKTCCWICQPCKPNEWKTG---NETCQPCDLGFKPSKNKTACEPINPKYPHWNDASCLTAIIFASLGGLLTILILVVFIVYRNTAVVKASTRELMWLILAAMLLAHAFTVLVLFRPSAITCALQRTLPGLAFTAIYAALVTKTNRIARIMEGSKRILVKKQR-FLSTSAQLFITGMLIAVEVAVITTMLIIEAPGTELRFSKDLIRARLCCNTSQRGNIIPLGFPIFLIAMCTIYAIKTRNLPHNFNEAKFIGFTMYTTCVLWLSIIPVYLSGYKTEVTLTLCISISATIALMVLFVPKTYIILCRPEKNSRMSFATAKDIRCHMGVLQT 885          
BLAST of Glutamate receptor, metabotropic vs. TrEMBL
Match: A0A068Y8J0 (Metabotropic glutamate receptor 5 OS=Echinococcus multilocularis OX=6211 PE=3 SV=1)

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 375/893 (41.99%), Postives = 557/893 (62.37%), Query Frame = 3
Query:  168 LKLWIFISFIKTAYELPSNTRKTGF------VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEK-------------------SQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKE-EXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTI---ENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPG-NPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLV-IEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKK-CCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSV-AATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKT 2747
            L  W++I  + T  EL        +      + G +MIGALFPIHEQPT+  ++SR+CG +RE+YG+HR+E L++TI+ INEN NILP + LGVD RD+CWYAPIALEQ +DFI+ +   +E                    S  +   PI  LIGP +SE+T QV  +LQLF IPQIGYSAT+ +LS+   Y+YF+RVVPSD LQV+ +++LL  + W+Y++L+NS G YG+ GI  L+  + +   IC++    IDNKE E    +          K KV++CFCQG+TV  LL++M  L++  KGY++IG DGW+DR DILG +   + G    S  A GS++I++HS  + DFD+YF   T  +    +PWF EFWE+KF+C I  + SD   K CT +ESL N+P  QD+KL  +  ++  +A  LH + + VC V    +  C   +  NG LL  E++   ++  + +T+ FD  GDPPG YD+MNYQ+ +NE+     + Y ++G WK   L+ +++  IQW     N       ++S CS+PC   + +I +++ K CCW C+ C  NE       NE+C  C  GF+P+ +++ C  I   +  W+DAS + AIIF+ +G ++TI+I+ +F  Y NT VVK+ TRELM++IL  + L++  T  ++++P+  +C L R +PGL+F+ I+ +LVTKTNRI RI+  SK+ +++++  FL+T+AQ+ I  +L  VE+ +I+ M+    P ++  +S      RL CNT  +   I +GF   L+  CT YA KTRNLP NFNEAKFIGFTMYTTC++W+ ++ +YLS    E++L   +  +ATI ++ LF+PK YIIL +PE+N R +F T  +IRCH+G  +T
Sbjct:    3 LARWMWIILLVTVSELQMAPYGALYHKLKVRIPGDIMIGALFPIHEQPTVETAFSRQCGSVREQYGIHRIETLIRTIQMINENENILPRIRLGVDARDTCWYAPIALEQCMDFIRTAFIYREYEDCLQMTNGSNGKCLPPGVSPSSIEIPIAALIGPGSSEMTKQVHQVLQLFSIPQIGYSATAAELSNIAEYQYFLRVVPSDDLQVEVIVSLLERYGWTYVALVNSNGFYGDRGIAALRYRM-DEIGICSETERSIDNKETEEAFLELAQDIFNPDRKAKVVVCFCQGETVAGLLKAMDTLHLQGKGYMLIGADGWSDRQDILGPLVDSKTGERAFSRLAQGSLSIKIHSPKVEDFDEYFTNLTPQTHHNISPWFTEFWEQKFDCAITPS-SDNLRKPCTGEESLKNVPMYQDNKLSLLNLAIYVVAIALHRVQEIVCGVGRPGI--CPGLLPVNGSLLRQELLKSSYTDSNGDTIFFDENGDPPGSYDLMNYQHTFNERGEEV-FDYVQVGRWKHGQLITLQEEFIQWQGDSPNA-TASGPVRSFCSEPCGAWEAKIIKDKSKTCCWICQPCKPNEWKTG---NETCQPCDLGFKPSKNKTACEPINPKYPHWNDASCLTAIIFASLGGLLTILILVVFIVYRNTAVVKASTRELMWLILAAMLLAHAFTVLVLFRPSAITCALQRTLPGLAFTAIYAALVTKTNRIARIMEGSKRILVKKQR-FLSTSAQLFITGMLIAVEVAVITTMLITEPPGTELRFSKDLIRARLCCNTSQRGNIIPLGFPIFLIAMCTIYAIKTRNLPHNFNEAKFIGFTMYTTCVLWLSIIPVYLSGYKTEVTLTLCISISATIALMVLFVPKTYIILCRPEKNSRMSFATAKDIRCHMGVLQT 885          
BLAST of Glutamate receptor, metabotropic vs. TrEMBL
Match: A0A210QJG2 (Metabotropic glutamate receptor 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07649 PE=3 SV=1)

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 373/855 (43.63%), Postives = 540/855 (63.16%), Query Frame = 3
Query:  225 TRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLS---LQEKSQVNFS----------KPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI---NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGS 2738
             R+     G ++ GAL P+H++P     Y+R CG+I E+YG+HR+E+ L+T+ +IN + +ILP +T+G DIRDSCWY+PIALEQSIDFIK+SL+    +E  Q N +          KPIVGLIGP +S  T+QVQNLLQ+F IPQIG+SATS++LS+KN Y YF+RVVPSD  Q +A+++++  + W+YIS +++ G+YG  G+ E     +N++ +C        ++++ H FDAL  ++      +VI+CFC+G TVT L  +  ++   +  +LI+G+DGWADR D++ +IE       +AA G ++++LHS  IP FD  F+         NPWF+EFW++KF+C I      K++   KTCT +E   +  +VQDSKLGFVV ++ T+A  LHN++Q +C        G C   I   G+   + ++++    Y N+ + FD  GDPP RYDIMN+Q  + E  N T Y Y ++G W   HL + D  I W     N  + +    S CS PC    I+      +CCWTC  C ENE        E+C SC KG+ PN D + C  I   +L W D   +VAI  +  G+ +T+ I  IF +++NTPVVK+ TREL Y+I+ G+  ++   F LV KPT  SC  +RI+PGLSFSLI+G+LVTKTNRI RIL  +KK I ++   F++ +AQ++I  ++  +E  II+VM+      SK DY     VRL+CNT +  + +  GFD VL+  CT YA KTRNLPENFNEAKFIGFTMYTTC+IW+G   IY  +  + +++  ++  +A++ +V LF PK+Y+I++ PE+N RSAFTT+ ++RCHIGS
Sbjct:   31 ARRIARKEGDVIFGALLPMHKKPPETTVYTRSCGKIWEQYGIHRLEIFLETVDKINASPDILPNVTVGYDIRDSCWYSPIALEQSIDFIKDSLANLDAEEARQNNSTPKGDCKTENRKPIVGLIGPGSSHNTIQVQNLLQIFHIPQIGFSATSMELSNKNLYGYFLRVVPSDKYQAQAMLDIVIRYNWTYISTVHTDGNYGARGLAEFHNLARNSS-VCIANTESAPSRKDPHVFDALIRRMLVTKNARVIVCFCEGATVTSLYNATRRVKGAQGHFLILGSDGWADRPDVVESIE-------DAAAGGLSMKLHSPIIPAFDKKFKALNPFLNDRNPWFKEFWQEKFSCTIPGDEDAKAEFINKTCTGRE--IHQDFVQDSKLGFVVNAMYTMAKALHNMHQDIC----GDYPGLCPEMIPLEGRKYKEYLLNVSMVTYSNDDLHFDKNGDPPARYDIMNFQ-KFGEGANVT-YGYVKVGEWNTGHLDMNDSKIYW----LNRLSGEAHTMSVCSQPCSIGNIKNIEGNTRCCWTCIPCEENEFM---MDEETCKSCSKGWWPNEDLTACKMIETEYLSWFDTEAVVAISLACFGIFVTLWITVIFIRHHNTPVVKASTRELSYIIMFGIITAFCCNFVLVSKPTIVSCYFTRILPGLSFSLIYGALVTKTNRIARILEGTKKIITKKPR-FMSASAQVIITCIIVGIECAIITVMLIIEPADSKLDYPTNKRVRLVCNTTTLGIVVPFGFDLVLILMCTLYAVKTRNLPENFNEAKFIGFTMYTTCVIWLGFFAIYFGSEARVLTMSVSISLSASVSLVLLFFPKIYVIVWAPEKNTRSAFTTSKDVRCHIGS 861          
BLAST of Glutamate receptor, metabotropic vs. TrEMBL
Match: A0A0X3P5L4 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR92338 PE=3 SV=1)

HSP 1 Score: 682.559 bits (1760), Expect = 0.000e+0
Identity = 365/867 (42.10%), Postives = 545/867 (62.86%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQE-------------------KSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKE-EXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIEN---GRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKT-KSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWP----------KSEENERNNQTSIKSHCSDPCKFDQIRIFRERKK-CCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATV-RLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIG 2735
            + G +MIGA+FP+HEQPT+  ++SR CG++RE+YG+HR+EVL++ + +IN+N NILP + +GVD+RD+CW+ P+ALEQ +DFI+ +   +E                    S+    KPI  LIGP +SE++ QVQ +LQ+F IPQIGYSAT+  LS    Y+ F+RVVPSD LQVK + ++L +F+W+Y+ L+NS+G YGE+GI  L+  ++    IC +  L IDNKE                 K KV++CFCQG+TV  + ++MT L +T+KGY++IG+DGWADRTDILG + +   G    S AA G ++IR+ SK +P+F++YF   T      NPWF+ FWE+KF+C +N +  S K  K C    +L +  + QD+KLG +  S+ T+A  LH ++  VC      +  C  F+  +G +L  E++  +F   + + + FD  GDPPG Y+I+NYQ+   E      Y Y+ IG W+   + I+   +QWP           +EE   N  T   S CS+PC   +I++ ++R K CCW CK C  NE   +   ++ C  C  G++P  +R+ C++I  I+  WS    +++II + +G+++T+  + +F  Y NT +VK+ TRELMYV+L+G+  ++ + F ++WKP    CLLSR+ PGL+FS+++G+L TKTNRI RIL  SK+  ++++  FL+ TAQ+VI  L+N+VE+ ++ VM+    P  +  +  + T+ RLICNT      I +    +L+  CT YA KTRNLP NFNEAKFIGFTMYTTC++W+ ++ IYL     E +L  A+  +ATI  + LF+PK+YI+L  PE+N RSAF T  +IRCHIG
Sbjct:   41 IPGDVMIGAMFPVHEQPTVKTAFSRRCGKVREQYGIHRIEVLIQALNKINQNPNILPGVKVGVDVRDTCWFEPVALEQCMDFIRTAFMYKEYEDCMQANNYSENICTPPGSSEFYVEKPIAALIGPGSSEMSKQVQQVLQIFDIPQIGYSATAASLSDVIEYRTFIRVVPSDALQVKVIASILRFFQWTYVILVNSQGLYGEKGILALKNEMQ-LLGICAENELSIDNKETHRAFILLARQLFNPSNKAKVVVCFCQGETVGGIFKAMTDLQLTRKGYMLIGSDGWADRTDILGPVIDEISGERYSSAAAQGGLSIRIRSKSLPEFNEYFMNLTPQKNTWNPWFKAFWEQKFDCSLNASVHSSK--KQCADDLTLRSSTFEQDNKLGLLNTSIYTVALALHKVHSIVC--GEGFVGVCDGFLPIDGDMLRSEILKTRFYDSNGDLMYFDKNGDPPGSYEILNYQHITLED-GTLAYTYKVIGWWRSGEVWIDPSNVQWPVTPITKVNENDTEEEILNYNTLATSRCSEPCALGEIKVVKQRSKACCWICKTCLPNE---RVIASDQCEKCPLGYKPTENRTECTKIEPIYPHWSRPLPLLSIILASLGVLLTMFGLSVFLIYRNTSIVKASTRELMYVMLLGMLFAHASNFVVIWKPVVIGCLLSRVFPGLAFSMLYGALATKTNRIARILEGSKRIYLKKQR-FLSLTAQMVITALINLVEVTVVVVMLLLEPPGPELRFFNSFTMARLICNTTRNGTVIPLAIGMILIVVCTCYAIKTRNLPHNFNEAKFIGFTMYTTCVLWLAILPIYLGGYETEFALSMAVSLSATIAFLILFIPKIYIMLLHPEKNSRSAFVTAKDIRCHIG 897          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Cavefish
Match: grm5b (metabotropic glutamate receptor 5 [Source:NCBI gene;Acc:103045948])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 367/884 (41.52%), Postives = 538/884 (60.86%), Query Frame = 3
Query:  165 MLKLWIFISFIKTAYELPSNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQVNFS-----------------KPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANF--ILR--NGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSG 2741
            +L L   + F  T     +  R    +SG ++IGALF +H QP  +  + R+CG +RE+YG+ RVE ++ T+  IN + NILP +TLG +IRDSCW++ +ALEQSI+FI++SL   + S+V                    KPIVGLIGP +S V +QVQNLLQLF IPQI YSATS+DLS K+ YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G+   +E +     IC     +I  N  E +    L        K +V+ CFC+G TV  +L +M + N+  + ++++G+DGWADR D+          + EAA G ITI+L S  +  FDDY+      +   NPWF EFW+ +F+C +  +  ++ KY +TC++++SL    Y QD+K+GFV+ ++ ++A+GLH ++Q +C        G A     +R  +G  LLD ++   F+    E ++FD  GD PG Y IMN++     K  +  + Y  +GSW  + L I+D  I W        +  T IKS CS+PC   QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  P  D + C  IP  +L+W D   I A++FS +GL+ T  +  +F  Y +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L R+  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+ I F+L ++++ II  +     P    DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K +++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G G
Sbjct:    4 LLPLTFALLFPLTRAAQSNERRVVAHISGDIIIGALFSVHHQPQADKVHERKCGAVREQYGIQRVEAMMLTLDRINADPNILPNVTLGCEIRDSCWHSAVALEQSIEFIRDSLVAADDSEVGGGGASARCADPAATPMKGKKPIVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMAAFKE-MAGKEGICIAHSDKIWSNAGEQNFDRLLMKLRSHLPKARVVACFCEGMTVRGILMAMRRQNLVGE-FVLVGSDGWADRYDVTDGY------VREAA-GGITIKLQSADVKWFDDYYLKLRPDNNLRNPWFPEFWQHRFHCRLKGHPQENPKYNRTCSKRDSLRQQ-YAQDTKMGFVINAIYSMAFGLHQMHQSLC-------RGAAGLCDAMRPIDGAKLLDFLMKTNFTGVSGENIQFDENGDSPGSYVIMNFK-----KMGKDYFDYTNVGSWDNSGLQIDDDEI-W-------SSKDTIIKSVCSEPCDKGQIKVIRKGEVSCCWTCTPCKENEFV---FDEYTCRACELGSWPTHDLTGCDPIPVEYLRWGDPEPIAAVVFSCLGLMATFFVTAVFVVYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPHVVHCYLQRLGVGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQVAIAFILILMQLSIIVALFVLEPPDVIFDYPSIREVNLICNTTNLGVVAPLGYNGLLIMSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIVTMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDG 854          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Cavefish
Match: grm5a (metabotropic glutamate receptor 5-like [Source:NCBI gene;Acc:103040533])

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 357/856 (41.71%), Postives = 530/856 (61.92%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-------------VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            R    + G ++IGALF +H QP  +  + R+CG +RE+YG+ RVE ++ T+  IN ++NILP +TLG +IRDSCW++ +ALEQSI+FI+++L   E+ +             +   KPIVGLIGP +S V +QVQNLLQLF IPQI YSATS+DLS K+ YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  +L +M +  +  + +L++G+DGWADR D+    +         A G ITI+L S  +  FDDY+      +   NPWF EFW+ +F C +  +  ++ KY +TCT+KESL +  Y QD+K+GFV+ ++ ++A+GLH + + +C       E        +G+ LL+ ++   F+    E V FD  GD PGRY+IMN++     + +  +Y Y  +GSW  + L + D        EE   NN   I+S CS+PC+  QI++ R+ +  CCWTC  C +NE     F   +C +C+ G  P  D + C  IP  +L W D   I A++F+ +GL+ TI ++ IF ++++TPVVKS +REL ++IL G+ L YL TF L+ KP    C L R+  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P+   DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT  +  +F PK+YI+L KPERN RSAFTT+T +R H+G GK
Sbjct:   34 RVLAHIPGDIIIGALFSVHHQPPADKVHERKCGAVREQYGIQRVEAMMHTLDRINADTNILPNITLGCEIRDSCWHSAVALEQSIEFIRDTLVSAEEEESMSKCAADGGGMPMKGKKPIVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMEAFKD-MAAKEGICIAHSDKIYSNAGEQSFDRLLEKLRSHLPKARVVACFCEGMTVRGILMAMRRRRLVGE-FLLVGSDGWADRYDVTDGYQ-------REAEGGITIKLQSAYVTWFDDYYLKLQPDTNQRNPWFVEFWQHRFQCRLKGHPQENTKYNRTCTKKESLGHH-YAQDTKMGFVINAIYSMAYGLHAMQKTLCPGYKGLCEAMRPI---DGRKLLEFLMRTNFTGVSGEVVLFDENGDSPGRYEIMNFK-----QMSEEDYSYIHVGSWDNSGLKMND--------EEIWANNSAIIRSVCSEPCEKAQIKVIRKGEVSCCWTCTPCKDNEYV---FDEYTCRACELGSWPTDDLTGCEPIPVQYLLWGDPEPIAAVVFACLGLLATIFVMLIFVRFHDTPVVKSSSRELCFIILAGICLGYLCTFCLIAKPHVVYCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILIFLQLAIIVALFIMEPPQVIYDYPSIREVHLICNTTTLGVVAPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATTALCCMFAPKVYIMLAKPERNVRSAFTTSTVVRMHVGDGK 860          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Cavefish
Match: grm1b (glutamate receptor, metabotropic 1b [Source:ZFIN;Acc:ZDB-GENE-090821-3])

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 359/861 (41.70%), Postives = 530/861 (61.56%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQEKSQVN--------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            + +R    + G ++IGALF +H QP+      R CGE+RE+YG+ RVE +  T+  IN + N+LP +TLG +IRDSCW++ +ALEQSI+FI++SL S++++ +                  KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +AL++++  + W+Y+S ++++G+YGE G++  +E L     +C     +I  N  E H    L     +  K +V++CFC+G TV  LL +M +L +  + +L+IG+DGWADR +++   E       + A+G IT++L ++ +  FDDYF      +   NPWF EFW+ +F C +  +  ++  Y K C+  ESL +  YVQDSK+GFV+ ++  +A GLH+++Q +C      L  C      +G  LLD ++   F+    E V FD  GD PGRYDIMN Q+          Y Y  +GSW E  L I+D++IQ  +SE         ++S CS+PC   +I++ R+ +  CCW C  C +NE     F   +C +C+ G+ P+ +   C  IP  +L+W     I A++FS +G+++T  +  +F  Y +TPVVKS +REL Y+IL G+ L Y+  F L+ +P+  SC L R++ GLS S+ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ+VI F+L  V++ +   +I    P+    Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+  F++  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK
Sbjct:   36 AASRSVARMDGDIIIGALFSVHHQPSTENVAERTCGEVREQYGIQRVEAMFHTLDRINSDPNLLPNITLGCEIRDSCWHSSVALEQSIEFIRDSLISIRDEKEGTKWCIDGTPYSQPPATKKPIAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARALLDIVKRYNWTYVSAVHTEGNYGESGMEAFKE-LAAQEGLCIAHSDKIYSNAGEKHFDRLLRKLRERLPKARVVVCFCEGMTVRSLLMAMRRLGVAGE-FLLIGSDGWADRDEVVEGYE-------QEAVGGITMKLQTEEVTSFDDYFLKLRLDTNTRNPWFAEFWQHRFQCRLPGHPQENTNYRKNCSGYESLEDN-YVQDSKMGFVINAIYAMAHGLHDMHQHLC---PGYLGLCEAMDPIDGSKLLDFLLRTSFAGVSGEDVWFDENGDSPGRYDIMNLQF-----VEPGVYDYINVGSWHEGVLSIDDYMIQMNRSE--------MVRSVCSEPCSKGEIKVIRKGEVSCCWICTACKDNEYVQDEF---TCKACELGWWPDEELHGCEPIPLRYLEWGHPESIAAVVFSCLGILVTSFVTFVFILYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPSLASCYLQRLLVGLSASMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVVIAFILISVQLTLEITLIILEPPEPIKSYPSIREVFLICNTSNMGMVAPLGYNGLLILSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTSFSVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGK 867          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Cavefish
Match: grm5a (metabotropic glutamate receptor 5-like [Source:NCBI gene;Acc:103040533])

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 353/856 (41.24%), Postives = 525/856 (61.33%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ-------------VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            R    + G ++IGALF +H QP  +  + R+CG +RE+YG+ RVE ++ T+  IN ++NILP +TLG +IRDSCW++ +ALEQSI+FI+++L   E+ +             +   KPIVGLIGP +S V +QVQNLLQLF IPQI YSATS+DLS K+ YKYFMRVVPSD  Q +A+++++  + W+Y+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  +L +M +  +  + +L++G+DGWADR D+    +         A G ITI+L S  +  FDDY+      +   NPWF EFW+ +F C +  +  ++ KY +TCT+        Y QD+K+GFV+ ++ ++A+GLH + + +C       E        +G+ LL+ ++   F+    E V FD  GD PGRY+IMN++     + +  +Y Y  +GSW  + L + D        EE   NN   I+S CS+PC+  QI++ R+ +  CCWTC  C +NE     F   +C +C+ G  P  D + C  IP  +L W D   I A++F+ +GL+ TI ++ IF ++++TPVVKS +REL ++IL G+ L YL TF L+ KP    C L R+  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI F+L  +++ II  +     P+   DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT  +  +F PK+YI+L KPERN RSAFTT+T +R H+G GK
Sbjct:   19 RVLAHIPGDIIIGALFSVHHQPPADKVHERKCGAVREQYGIQRVEAMMHTLDRINADTNILPNITLGCEIRDSCWHSAVALEQSIEFIRDTLVSAEEEESMSKCAADGGGMPMKGKKPIVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMEAFKD-MAAKEGICIAHSDKIYSNAGEQSFDRLLEKLRSHLPKARVVACFCEGMTVRGILMAMRRRRLVGE-FLLVGSDGWADRYDVTDGYQ-------REAEGGITIKLQSAYVTWFDDYYLKLQPDTNQRNPWFVEFWQHRFQCRLKGHPQENTKYNRTCTKS---LGHHYAQDTKMGFVINAIYSMAYGLHAMQKTLCPGYKGLCEAMRPI---DGRKLLEFLMRTNFTGVSGEVVLFDENGDSPGRYEIMNFK-----QMSEEDYSYIHVGSWDNSGLKMND--------EEIWANNSAIIRSVCSEPCEKAQIKVIRKGEVSCCWTCTPCKDNEYV---FDEYTCRACELGSWPTDDLTGCEPIPVQYLLWGDPEPIAAVVFACLGLLATIFVMLIFVRFHDTPVVKSSSRELCFIILAGICLGYLCTFCLIAKPHVVYCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILIFLQLAIIVALFIMEPPQVIYDYPSIREVHLICNTTTLGVVAPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATTALCCMFAPKVYIMLAKPERNVRSAFTTSTVVRMHVGDGK 843          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Cavefish
Match: grm1a (glutamate receptor, metabotropic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7893])

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 348/864 (40.28%), Postives = 527/864 (61.00%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQEKSQVNFS---------------KPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKT 2747
            +  R    + G ++IGALF +H QP+      R+CG++RE+YG+ RVE +  T+  IN + ++LP ++LG +IRDSCW++ +ALEQSI+FI++SL S+++ S+                   KPI G+IGP +S V +Q            I YSATSIDLS K  +KYF+RVVPSD LQ +A+++++ ++ W+Y+S ++++G+YGE G++  +E L     +C     +I  N  E H    L     +  K +V++CFC+G TV  LL +M +  ++ + +L+IG+DGWADR +++   E       + A G IT++L ++ +  F+DYF      +   NPWF EFW+ +F C I  +  ++  Y K CT  ESL +  YVQDSK+GFV+ ++  +A GLH++++++C       EG C      +G  LLD ++   FS    E V FD  GD PGRYDIMN QY   E+  R  Y Y  +GSW E  L+IED+ +   +SE         ++S CSDPC   QI++ R+ +  CCW C  C +NE     F   +C +C  G+ P+ + + C  +P  +L+WS    IVA++FS +G+++T+ +  +F +Y +TPVVKS +REL Y+IL G+ + Y+  F L+ +PT  SC L R++ GLS ++ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ+VI F+L  +++ +   +I    P+    Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+  F++  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK 
Sbjct:   37 AAARSVARMDGDVIIGALFSVHHQPSAERVAERKCGDVREQYGIQRVEAMFHTLDRINADPHLLPNISLGCEIRDSCWHSSVALEQSIEFIRDSLISIRDDSKEGAKWCVDGTPSSHPPPSKKPIAGVIGPGSSSVAIQ------------IAYSATSIDLSDKTLFKYFLRVVPSDTLQARAMLDIVKHYNWTYVSAVHTEGNYGESGMEAFKE-LAAEEGLCIAHSDKIYSNAGEKHFDRLLRKLRERLPKARVVICFCEGMTVRSLLMAMRRRGVSGE-FLLIGSDGWADRDEVVEGYE-------QEADGGITMKLQTEEVKSFNDYFLKLHLDTNTRNPWFAEFWQYRFQCRIPGHPQENTNYQKVCTGNESLKDN-YVQDSKMGFVINAIYAMAHGLHDMHREMCP----NHEGLCEAMDPIDGSKLLDYLLKTSFSGISGEEVYFDENGDSPGRYDIMNLQY--VEELGR--YDYINVGSWHEGLLMIEDYKLMTNRSE--------MVRSVCSDPCSKGQIKVIRKGEVSCCWICTTCKDNEYVQDEF---TCKACDLGWWPDDELAGCQPLPLKYLEWSSVESIVAVVFSCLGILVTLFVTFVFIQYRDTPVVKSSSRELCYIILAGIFMGYICPFTLIARPTVISCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVVIAFILISMQLTLEVTLIVLEPPEPIKSYPSIREVYLICNTSNVGMIAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTSFSVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKA 859          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Sea Lamprey
Match: grm3 (glutamate receptor, metabotropic 3 [Source:ZFIN;Acc:ZDB-GENE-061009-13])

HSP 1 Score: 443.351 bits (1139), Expect = 5.938e-140
Identity = 285/850 (33.53%), Postives = 469/850 (55.18%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKS-----------QVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMI-DLKFSAY---DNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIK-SHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVA---ATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTN----LKEISLCFAMHFTATICIVFLFLPKLYIILFKPERN-ERSAFTTTTEI 2720
            + G L++G LFP+HE+    GS   +CG+I E+ G+ R+E +L  + +IN +S++LP + LG  I D+C     ALEQS++F+++SL   +++           Q      I G+IG + S V++QV NLL+LF+IPQI Y++TS  LS K+ Y +F R VP D  Q KA+  +L +FKW+Y+S + S   YGE G++   EH   + +IC     ++        +D +   L +K   KV++ F + D   +LL +   L+ +   +  + +DGW       G +E+      + A G++TI L+S+ + +FDDYF++   +    NPWF EFW+++F C +  ++  ++   C    SL    Y Q++K+ FV+ +V  +A  LHN+++++C     T + CA F   NG  L  E I ++ F A     +  V+FDS GD   +Y+I  +Q     K+N  +Y Y ++G W +  LV++ + I W KS         SI  S CSDPC  ++++  +    CCW C  C   E     F   +C  C  G  P++D  +C ++P  ++KW DA  +V I  S +GLI T+ ++  F  + NTP+VK+  REL Y +L GV++ Y TTF  V K T   C L R++   SF + + +L+TKTN     +  S ++    + +F++  AQ+VI   L ++++ ++++ +    P  +  +++      V L C+ +  ++ IS+  +  LV  CT YAFK R   ++FNEAKFI FTMYTTCIIW+  V I+  T+    ++  ++C ++  + ++ +  LF PK+ IILF+P +N ER    TT  +
Sbjct:   32 MDGDLVLGGLFPVHEK----GSGPEDCGKINEDRGIQRLEAMLFALGQINRDSSLLPGIKLGAHILDTCSRDTYALEQSLEFVRSSLLKVDETEYMCPDGSYAIQNQGPTAIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDFFARTVPPDFYQAKAMAEILRFFKWTYVSTVASDDDYGEAGMEAF-EHEVRSRNICIAVSEKVGRSANKKTYDGVIKALMQKPNAKVVVLFTRSDDAKELLAAARMLHAS---FYWVASDGW-------GALESVIKGQEDVADGALTIELNSQRVKEFDDYFQSLLPAKNKRNPWFTEFWQQRFQCTL--SRGHRHGNVCNASMSLRRGSYKQETKIMFVIDAVFALAHALHNMHKELC---PNTTKLCAAFTPINGVKLYKEFILNVSFQAPFGDHDRIVKFDSSGDGLAKYNIFIFQ-----KSN-GKYSYTKVGHWSQG-LVLQANEIHWAKS---------SIPVSQCSDPCAPNEMKSTQRGDSCCWVCISCQPYEYLYDEF---TCMDCGPGRWPSADLRDCYDLPEEYIKWEDAWALVPIAISCIGLICTVTVLITFIVHGNTPIVKASGRELCYALLAGVSMCYSTTFAFVAKATVLVCALRRLVLAASFVVCYSALLTKTN-RISRMFNSAREGGSSRPKFVSPLAQMVICLTLILIQLSVVAIWLIVENPGLRR-FTIPDKREVVILKCSVQDSNMLISLVCNVCLVMVCTVYAFKNRKCHDSFNEAKFIAFTMYTTCIIWLAFVPIFYVTSGDYRVQTTTICVSVSLSGSVVLGCLFAPKVNIILFQPHKNVERPPKPTTISL 840          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007590.1 (pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 gene:ENSPMAG00000006812.1 transcript:ENSPMAT00000007590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 414.846 bits (1065), Expect = 6.060e-130
Identity = 266/804 (33.08%), Postives = 415/804 (51.62%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKN-------SLSLQEKSQVNFSKP--IVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNT----TDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINK--TKSDKYPKTCTRKESLF-NMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWH---------NFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLST 2576
            + G + +GALFP+H +    G     CG ++ E G+HR+E +L  +  IN +  ILP +TLG  + D+C     ALEQS+ F++         +     +Q  F+KP  +VG+IG A S V++ V N+L+LFKIPQI Y++T+ +LS    Y YF RVVP D  Q +A++ +++   W+Y+S + +  +YGE GI+      ++T      +C  + L+I ++ +   FD +  +L +    + I+ F   D + +LL +  + N T   +L + +D W  +   +  I N   E    A G+ITI      + +FD YF ++T  +   N WF EFWE+ F C +++   +   + K CT +E +  +  Y Q+ K+ FV+ +V  +A  LHN+YQK C      L G C +      K LL+E+  + F+      V F+  GD PGRYDI  Y        N +   Y  IG W  NHL +    +QW       R    SI   CS PC   + +   +   CCW C+ C         F+   C  C    RPN +R+ C  IP + L+W     +V +  +I+GL+ T  ++  F +YN+TP+V++  REL YV+L G+ L Y TTF ++ +P+   C   RI  GL   + + +L+TKTN         + K      R ++  +Q+VI F L  V+  ++ V IW          ++ + +S  +  A   L C+     L  S+G+  +L+  CT YA KTR +PENFNEAK IGFTMYTTCI+W+  + I+  T
Sbjct:   41 LDGDITLGALFPVHAR----GDRGAMCGALKMEKGIHRLEAMLYALDTINADPRILPNVTLGARVLDTCSRDTYALEQSLTFVQALIEKDTADVRCTNNAQPIFAKPEKVVGVIGAAGSSVSIMVANILRLFKIPQISYASTAPELSDNTRYDYFSRVVPPDSYQAQAMVEIVSALGWNYVSTVAANDNYGESGIEYFSRFARDTGKPPGGVCIAQSLKIPHEPKPSDFDKIIHRLLETPSARAIILFANEDDIKRLLEATRRANQTGH-FLWVASDSWGSK---IAPIRNQEDE----AEGAITILPKRASVAEFDKYFTSRTLENNRRNVWFAEFWEENFKCRLSRHGARQTVHAKKCTGQERVGRDSQYEQEGKVQFVIDAVYAMAHALHNLYQKRCP----RLSGLCVDMEPVPTKDLLEEIRSVSFNGSAGTPVMFNKDGDAPGRYDIFQYHL-----HNTSTPGYNVIGEWV-NHLQLNISALQW---TAGRRELPYSI---CSMPCASGERKKKVKGVPCCWNCERCEGYYFQLDEFN---CHLCPYNMRPNVNRTGCDAIPIVKLEWHSPFAVVPVFLAILGLLTTAFVIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYATTFLMIAEPSLAVCSFRRIFLGLGMCVSYAALLTKTN--RIYRIFEQGKRSVTAPRLISPASQLVITFSLIAVQ--LLGVCIWFGLTPPHTVIDYEEQRSQEAELARGMLKCDISDLALICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIFFGT 809          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005888.1 (pep scaffold:Pmarinus_7.0:GL487952:898:2919:-1 gene:ENSPMAG00000005329.1 transcript:ENSPMAT00000005888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 250.366 bits (638), Expect = 1.097e-73
Identity = 138/402 (34.33%), Postives = 226/402 (56.22%), Query Frame = 3
Query:  228 RKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQVNF-------------SKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVC 1394
            RK       L++G LFP+HE+    G  S++CG I E  G+ R+E +L  +  INE+  +LP + LG  + D+C     ALEQ+++F+++SL  Q+    +F             ++PI G+IG + S V++QV NLL+LF+IPQI Y++TS  LS K+ Y YF R VP D  Q KA+ ++L +F W+Y+S + S+G YGE GI+  +   + + +IC     ++        +  +   L +K   +V++ F + D    LL + T  N +   +L + +DGW       G +EN      +AALG+ITI L S P+ +F +YF++   ++   NPWF+E+W+ KF C + +         C+++ SL +  + Q+SK+ FVV +V  +A  LHN+ + +C
Sbjct:    1 RKEAEKEQELLVGGLFPVHEK----GDGSKDCGPINEARGIQRMEAMLFALDRINEDPRLLPGVRLGARVLDTCLKDTYALEQALEFVRSSL--QKVDGTDFMCPDGTYAIHGGNAQPIAGVIGGSDSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMADILRFFNWTYVSTVASEGDYGETGIEAFENEAR-SRNICIATSEKVGRLTGPDSYKGIVHNLMQKPNARVVVLFMRSDDAKNLLAAATSNNTS---FLWVASDGW-------GALENVVKGNEKAALGAITIELSSFPVQEFSEYFKSLRPTANERNPWFREYWQHKFQCTLPELP--HVENECSQQRSLNDKNFEQESKIMFVVNAVYAMAHALHNMQRSLC 383          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Sea Lamprey
Match: casr (calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE-050119-8])

HSP 1 Score: 251.136 bits (640), Expect = 4.283e-70
Identity = 240/889 (27.00%), Postives = 394/889 (44.32%), Query Frame = 3
Query:  249 GHLMIGALFPIHEQPTLNGSYSR-ECGEIREEY---------GMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFI-KNSLSLQEKSQVNFSKPI-----VGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTD--EGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHIN------------------------KTKSDKYPKTCTRKE--SLFNMPYVQDSKLGF---VVKSVMTIAWGLHNIYQKVCIVKNFTLEG--CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPK--SEENERNNQTSIKSHCSDPCKFDQIR-IFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATV-RLICNTESQ-DLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLK-----EISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGS 2738
            G L +G LFPIH      G  SR +   +R E          G+  +  +   ++EIN ++ +LP L LG  + D+C     ALE ++ F+ +N L       V    P      V ++G  +S V+  V NLL LF+IPQ+ Y+++S  LS+K  Y+ FMR + SD  Q  AL  L+  F W+++ L+ S   YG  GI+  +E  +    IC +  E + + +  E          +      +VI+ F  G  +  L+R + + N+T + +  IG++ W   + I       R E+      ++        IP F +Y +       P N + ++ WE  FNC +                         K  ++     CT +E  S    P++  + L     V  +V  IA  LH++    C       EG  C N        LL  +  ++F     E V+FD KGDP G Y ++N+Q    +           +GS+       +  L    K  S+   R   TS+   C+ PC     + I    + CC+ C  C+E E  N++  N SC  C +   P+++ + C      +L W +   +       +G ++T+ +  +F K+  T +VK+   EL Y++   +   +L++   + KP+T +C L +   G+SF L    ++ KT+R+ ++           +   L    Q+++VFL  +V+++I +V ++   P  + D +    V  L C+  SQ  L   +G+  +L   C  +AF+ R LPENFNEAKFI F+M    I+W+  +  Y+S+  K     E+       F    CI   F  K YIIL KPERN      T  E+RC   +
Sbjct:    5 GDLNLGGLFPIH-----FGVLSRADSLTVRPEAVECVRFNFRGLRWMLAMAFAVEEINADNLLLPGLRLGYKMADTCNTVSKALEATLGFVARNKLGALGMGGVCNCTPAPRANTVSVVGATSSGVSTAVANLLSLFRIPQVSYASSSRVLSNKQQYRSFMRTILSDEQQATALAELVREFGWTWVGLIASDDDYGRPGIERFREENEEEV-ICVEFSETVSLYDPPE---RIHELADMIANATARVIVVFASGTDLDPLMREVARRNLTGRTW--IGSEAWVSSSLI------ARPEIFHVVGSTLGFVQRPGHIPGFREYLQKVHPQRHPNNVFVRQLWEATFNCTLKAEAASSDNCTQSVQSHEQGINECVKGAANAPRPFCTGRENISAVKTPFLDYTDLRITYNVYLAVYAIAHALHDMLFG-CREGAGLFEGGKCTNIQQLEPWQLLRYLQVVRFRNNKGEEVQFDEKGDPRGGYSLVNWQ----QSPKDGSVQLVEVGSYDGRKPSGQRLLCNGSKQISKGYSREIPTSV---CTQPCAPGTRKGILEGEQVCCFECISCAEGEYNNESDAN-SCLGCPEDSWPSANHTMCVPKREEYLSWREPFGVCLAFVGCLGAVLTLSVAAVFVKHRGTAIVKATNVELSYLLFFSLFCCFLSSLFFIGKPSTVACKLRQPTFGISFVLCVSCVLVKTHRVLQVFESQIPGRGGVRKL-LGLDHQLLLVFLFTLVQVVICAVWLYTAPPTFEEDDTFKNDVIYLSCDEGSQLALGFVIGYTCLLAGVCFLFAFRARKLPENFNEAKFITFSMLVFFIVWLSFIPAYVSSQGKFVAAVEVIAILVSSFGLLSCI---FFHKCYIILLKPERN------TPEEVRCSTAA 857          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008333.1 (pep scaffold:Pmarinus_7.0:GL477638:94752:105207:1 gene:ENSPMAG00000007531.1 transcript:ENSPMAT00000008333.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.557 bits (571), Expect = 2.606e-61
Identity = 227/866 (26.21%), Postives = 385/866 (44.46%), Query Frame = 3
Query:  246 SGHLMIGALFPIHEQ-----------PTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKT---KSDKYPKTCTRKESL-------FN-----MPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANF-------ILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSW----------KENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRE-RKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYS----VAATVRLICNTESQ-DLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISL-CFAMHFTATICIVFLFLPKLYIILFKPERNER 2693
             G +++G +FP+H             PT     S +C  + E   + R+  +L TI+EIN  S++LP + LG  + DSC     A+E S +F     SL   +Q    KP + +IG A S +T+     L L  IP I YSA++  LS K  +  FMR +PSD  Q KAL  L+ +F W++I +L S   YG +G+ + Q    +   +CTD  + +  K+ A K     + + +    KVI+ F     +  +++ M +  +  K +  I ++ W     I       + + ++   G+I   + S  +    D+ R   S  T  NP+  E W++ F+C    +    + + P  C+  ESL       FN     +PY        V  +V  +A  LH +         F    CAN        ++R  K      +D K + Y+   +RFD+ GDP   Y +  +Q   +E           +GS+           + HL+I D L+ W   +    +      S C   C     + +   +  CC+ C  CS+ E + KT    +C  C          ++C   P  +LKW     ++  I +I+G+ +TI ++ IF KY  TP+VK+   ++  ++L+ +  ++L  +  V  P  + C+  +   G+SFS     ++ KT      + I+ K  + R   F     +  I  +  V+ I +   ++W+ F  S S +      A T+ L C+  S  +    + +  VL   C   +F  R LP NFNE KF+ F+  T  I+WI  +  Y+ +N   + +   ++  +    ++FLF  K YIILF+P++N +
Sbjct:   33 GGDVILGGMFPLHNSVINLPLEFNAVPT-----SADCVMLNER-ALTRLYTMLYTIEEINNRSDLLPNMKLGYRVIDSCTDVMKAVEASYEF-----SLSGSTQ----KPPLVVIGDAYSFLTIPAAYTLGLKHIPMISYSASAPSLSDKTRFPTFMRTIPSDTFQSKALAELVGHFGWTWIGILGSDDDYGRQGLGKFQSD-AHEYGVCTDFQIWVP-KKIAIKDINSIVNVIQNSTVKVIIAFVIDAELEPIIKEMARRQIVGKTF--IASESWISSPVI------HKPQYADVLEGTIGFDMISADMNKLSDFLR--NSKPTTDNPFMTELWQETFHCTPYPSGLVDAARLP-ACSGDESLGSVTSSFFNPSEMTVPYA-------VYLAVYAVAHALHELTACTTWTSVFAGGHCANLSDIQPWQVMRYLK-----KVDFKDNGYN---IRFDANGDPVAYYILKQWQRKDDENMKMVA-----VGSYTNLNNNTNSTNKGHLIINDELLLWMGKQLKAPD------SLCVAACPEGSKKEYEAGQPSCCYRCVQCSDGEFS-KTKDANNCMRCPPDSWSTGTHTDCFVKPVQYLKWDSVEGLILHIAAIIGIFLTIDVLFIFYKYRETPIVKASNFKISLMLLICLFCNFLCIYVFVGIPKPWMCITRQPFFGVSFSSCLSCILVKT----ISMIITFKPSLTRNNTFHRQMTRAEIPIVAVVIVIEVALCVVWY-FLASPSVFRNENIKADTIFLQCDEGSPLNFAFIIAYLYVLALICLMLSFMVRKLPNNFNEGKFVMFSALTFFIVWISFIPAYILSNEHRVVVEVISIILSGYGILIFLFFHKCYIILFQPQKNTK 838          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Nematostella
Match: EDO35253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM25])

HSP 1 Score: 439.499 bits (1129), Expect = 3.206e-139
Identity = 276/834 (33.09%), Postives = 459/834 (55.04%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLS-----LQEKSQV--NFSKPIV-GLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSS-TPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILR--NGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTE--YHYERIGSWKENHLVIEDHLIQWPKSE---ENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKE---ISLCFAMHFTATICIVFLFLPKLYIILFKPERN 2687
            ++  +++G LFP+H +  L  +  + CGE+  E G+ R+E ++  IKE+N+N+ +LP LTLG  I D+C    I LE++++FI +SLS      Q+ S V  NF+K ++ G+IG A+S V++QV NLL+LFK+PQI Y++TS DLS+K+ Y +FMR VPSD  Q + + +++    WS +  +NSKG+YGE GI+E    L    +IC  E + I++   A  FD +  +  ++   + ++ FC  + + KLL +  ++    + +  I +D W  R  ++     GR  L++   G+ITI L S P  ++ +YF + T ++ +  NPWF+EFWEK F C +    S     TC    SL    Y+ D+K+ FV+ +V   A GL  +Y+  C       +G    ++R  NG+ L+  + ++ F     E V+FDS+GD  G YD+  +        N+TE  Y+Y ++ +W +  L   D  +Q    +   E    N + ++S C +PC     R  R  K CCWTC  C ++E          C  C +  RP+  R+ C  +P  +L  SD+  I+   F+ VG+I  + +  IF  ++ TP+VK+  REL   +L+G+ L Y+    L+ +P+ F C L R   G +  + + +L+ KTN        +K +   +   F+   +Q++I+  +  VE+++  V + +  PK    +   + +   CN +  DL ++M ++ +L+  CT YAF+TR  P NFNEA++IGF MYTTC+IW+  + + +  N K+   ++L   +   AT  ++ +F PK+YI+LF+P RN
Sbjct:    2 ITADIVLGGLFPVHSR--LETAVGQTCGELSSERGVQRLEAMIFAIKEVNKNTTLLPNLTLGALIHDTCGTDTIGLEETLEFIMDSLSRQNLPTQQCSGVDENFNKTLLAGVIGAASSSVSIQVANLLRLFKMPQISYASTSPDLSNKHRYDFFMRTVPSDAFQARVIRDVIRALNWSAVFTVNSKGNYGERGIEEFH-MLAKEANICVVEAVTIEHSFTAEAFDDVIRRFMRETGMRGVVLFCTDNDIRKLLNAAERVQAEGR-FSWIASDYWGTRHGLV----KGRESLAK---GAITITLRSIPHTEYREYFTSLTPTNYSKANPWFEEFWEKNFKCKLTGNSS-----TCPANTSLSKEMYI-DNKVPFVIDAVRAFATGLDVLYRNKCP----NTDGLCEDLMRQNNGEELMSILQNISFQGVSGE-VKFDSQGDATGMYDVFTF--------NQTESGYNYIKVATW-DGGLHFVDPALQAGGLDLGGEGVLLNPSGVQSSCGEPCARGYYRKLRRDKACCWTCLPCGKDEYVKDL---TGCGRCTELERPDPTRTGCVLLPLRYL--SDSWSIMVTCFATVGIICVLGVSVIFIMFSETPLVKASGRELTATLLIGLFLCYVEGIMLILRPSVFVCGLQRFGVGFAPCVCYAALLIKTN--RIARIFAKSERSTKPPDFINPASQLLILAAVVGVEVVLAGVGLGYWSPKQTEKFPTKSDILSTCNIQDYDLVVAMSYNVLLILLCTIYAFRTRKTPANFNEARYIGFAMYTTCVIWLAFLPVQIGVNDKDYKTLTLSINVTLNATTLLLCVFGPKVYIVLFRPTRN 797          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Nematostella
Match: EDO31767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ2])

HSP 1 Score: 434.491 bits (1116), Expect = 1.788e-136
Identity = 257/837 (30.70%), Postives = 460/837 (54.96%), Query Frame = 3
Query:  234 TGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIK-----NSLSLQEKSQVNFSKPI-VGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHS--KPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKES-LFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKL--LLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIE-DHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLK--WSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLST--NLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERS 2696
            +G VSG ++IG LF +H      G     CG + E+ G+HR+E +L  I  +N +  +LP ++LG DIRD C      LEQS++ ++     N+ +   +  +    PI  G++GP+ S +  QV +LL+LFK+PQI Y+ATS +LS  + + YFMR VP D+ Q  A+++++    WS +  +NS+GSYGE GI+  Q+ +    ++C  +  ++D+K    ++  +  +  K+ + +V++ FC  + +  +L S ++LN+T+  ++ + +D W  + + L  +E       + A G++TI L +  + +  F DYF+     +   NPWF+E+WE  F C +       + ++C+  +S   ++ Y  D K+ FVV +V++ A  LHN++  +C     + E    + +R      L+  + ++ F+      ++FDS GD  G+YD++ Y+     +    +  Y R+GSW E  L +    + +W  S+ N      +I+SHC  PCK   IR    + KCCW+C+ CS         +N +C  CK+G++P++   +C+ +P  +L   W      V    + VG+++T+ ++G+F K+ +TP++ +  RE+  ++  G+ + Y   F +V  P T  C + R   G+SF L++ SL+ KTN       I++     +   F++  +Q+ I  L+ +  ++ I+++ ++  P       +     L C+ +   +   + ++ +L+  CT+YAF+TR  P NFNEAKFIGF MYTTC+IWI  + +Y       + +++CF+  F+AT  +VF+F PK+YI++FKPE+N +S
Sbjct:   52 SGQVSGDVIIGGLFSVHSA----GGDKFRCGPLNEQVGIHRLEAMLYAIDLVNADHTLLPNISLGADIRDDCENINRGLEQSLNLLQGMLGNNNRNCPARDWIKERGPITAGVVGPSYSSLATQVASLLRLFKVPQISYAATSTELSDTHRFDYFMRTVPPDLFQALAIVDIIRAMNWSAVFAINSRGSYGEGGIQSFQK-MARKANVCIVDVAQVDDKMNPVEYTEILERFTKESRTRVVVLFCNTEDIHSILASASRLNLTRY-FMWLASDFWGSKNEPLFGVE-------DVANGAMTIELQTNQRELNKFYDYFKQLRPETNSRNPWFREYWEWHFKCKLENNSLSVFNRSCSDNQSGTHHLHY--DGKVMFVVNAVLSFAHALHNLHSDIC-----SGEPGMCYAMRQATRDSLISYLRNVTFNGTTGR-IQFDSNGDTSGKYDVLQYR-----RDGEDDGRYVRVGSWIEGELKLNTSEITEWYVSDSN------AIESHCGKPCKPGYIRRM-TKAKCCWSCEWCSLGSFV----YNNTCIRCKEGYQPDTSYQDCTLLPVKYLDTPWK----AVVATAAGVGVVVTMFVIGVFIKFKDTPLIMAAGREVSTLLFTGMIMCYALAFVMVVPPNTTLCGIRRFGTGISFCLLYTSLLVKTN------RIARIFSGTKSPSFISPKSQLFITLLI-ISPVLTITLLEFYFHPPKIKYTHLEKYNLLSCSNKEIAVITKLCYNVLLILLCTYYAFRTRKTPLNFNEAKFIGFCMYTTCVIWIAFLPLYFGAGGGFEGLAVCFSAVFSATTILVFIFAPKVYIVIFKPEKNLKS 840          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Nematostella
Match: EDO41315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N3])

HSP 1 Score: 359.762 bits (922), Expect = 2.791e-109
Identity = 253/836 (30.26%), Postives = 436/836 (52.15%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINE-NSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTC--TRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENE-ITNKTFHNESCSSCKKGFRPN--SDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYL---STNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIR 2723
            + G +++G L P+H +     +   +CGE++E  G+ R+E LL  + +IN  NS +L  +TLG+ + D+C    +AL++S++FI + L    KS+   S+ +VG+IG A S V++Q+  L +LF+IPQI Y +TS +LS K  + +F R VP D  Q KAL+++L YF W+Y+S++ S  SYG  G+  L+        IC     ++ +      +  +   +  +   + ++ F Q   +  LL ++   N   +    +G+D W +   +         +L   AL +IT+   S  +  F++YF + +  +   NPWFQE+WE  FNC +N+T   KYP  C  + K SL N     D ++   + +V   A  L  ++  +C    +T+  C      +G  LL  + +  F     E V FD+ GD  G YD+M +     EK++ T Y    IG+WK+   +  +H  +  KS  ++  +   +            +   R ++ CCW+C+ C  N  + N+T    +C +C  G  PN  +DR  C +I   +   +    + A+ F+  G+ ITI +V + AK++ TP+VK+C REL Y++LV + L +  TF +V +PT   C+    +  L F++ + ++  KTN   RI  I  ++ + ++   +  ++Q+V+V  +  V+ + + ++     P ++  Y    TV L C+T   D  +S  ++ +L+  CT YAFKTR +P NFNEAK I F MY++C+IW+  + +Y    S   + + L  ++   A + +  L+ PK+YI++F+P RN+     T TE R
Sbjct:    1 MKGDILLGGLVPVHSK-----NVDLQCGELQERLGIQRLEALLYALDKINAANSTLLNGITLGLQLYDTCSSETMALDKSLNFIYSQL----KSESTSSR-VVGIIGAAYSSVSIQIARLSRLFEIPQISYDSTSFELSDKKRFGFFSRTVPHDNFQAKALVDVLKYFNWTYVSVVYSDDSYGILGVDALRSA-ATRAGICMASSHKVRSSGHESTYLLVVDSILSEPLARTVIVFAQVHQIRGLLHAVQVRNAADQ-LQFVGSDAWGNVVWL--------KDLQSVALNTITVSPKSVRLKGFEEYFTSLSPINNSRNPWFQEYWEHHFNCSLNETLG-KYPTKCNDSLKLSLGNSDI--DMRIASAIDAVYAFAHALEAMHADLC---RYTVGVCPAMENISGSELLGYIRNASFVGATGEKVHFDANGDVEGIYDVMRF-----EKSSGT-YRNVIIGTWKDKLRMRNEHKFEIVKSSCSDECSSDEV------------MLPVRGKEACCWSCEPCKGNSYVINRT----TCLTCPLGSWPNHSADRKQCLQIELQYFGKNLMYAVPAMGFAGTGIFITIFVVYLLAKHDKTPIVKACGRELAYLLLVSILLCFSDTFIVVLRPTRIICIARFFLSSLGFTISYAAIFIKTN---RISRIFNRRNVAKRPILVLPSSQLVLVLGVVCVQALFLVLLTLLRTPTARHFYPTVDTVYLSCSTSDLDFGLSQVYNFILIIMCTVYAFKTRKIPSNFNEAKLIAFAMYSSCVIWLAFLAVYFMQRSLVERPLILSISISLIAYVLLGSLYGPKVYILIFRPHRNK-----TKTETR 780          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Nematostella
Match: EDO48665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA2])

HSP 1 Score: 334.724 bits (857), Expect = 4.828e-99
Identity = 241/825 (29.21%), Postives = 407/825 (49.33%), Query Frame = 3
Query:  243 VSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEID--NKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKF-SAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSW---------KENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIR-IFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTN--LKEISLCFAMHFT-ATICIVFLFLPKLYIIL 2669
            + G ++IG LFP+H +   N      CG I  + G   +  +L  ++ IN +S +L  +TLG  I D+C    I  + + D IK SL       +  +K + G++GP  S+V++    LL++F +PQ+ + +TS DLS+K+ Y  F R VP D  Q +AL+++L +  W+YI  +NS G+YGE G+  + + +    DIC      +   + +  ++     +   +     +I+ F        LL +  +L  T+  +L  G++GW++R  +  TI N        A GSIT+      +  F+++F +    +    PW  EFWE  F C +   K   Y K CT  E L  +P ++ + +  V+ +V   A  L ++ + +C  K    E  A     +GK L+D + ++ F  A     VRF+   +  G Y IMN+QY         ++ YE +GSW         +  HL++E   I W K + +  +      S CS PC+F QIR       KCCW C  C E++I      N+SC SC  G RP ++ S C ++P +     +A  I   ++S +G+++T+ I   F K     VVK+  REL  +IL+G+ L Y + F  + +P   +C + R    + ++  +  L+ KTN        S+ +    +    + T+Q+++   L  V++++ +V    +       Y       + C +    L +++ ++ +L+  CT +AFKTRN P NFNEAK+IG  MY TC  WI  +  YL+T+    ++ L   +  T ATI +  +F PK+++I+
Sbjct:   97 IPGDVIIGGLFPVHLK---NQKSENSCGPISTQPGFQYLAAMLFALELINNSSTLLRNITLGASIYDTCQSQTIGADHAKDIIKESL-------LTNNKLLKGVVGPLVSDVSIATVQLLRVFGLPQVSFGSTSPDLSNKDLYGSFFRTVPPDSFQAEALVDILEHHGWNYIITINSAGNYGENGMSAIIK-ITEKRDICIAATFTVPPLSTDAHYERIIREIAQARFDAVNIIVVFTTQTDSAGLLSAAARLGATRFTWL--GSNGWSNRMTV--TIGN-----EMVANGSITVNHMDGQVAGFEEFFSSMNPINNQNIPWIDEFWENWFKCDLPGGKPTFY-KNCT--EDLV-LPKMEVAPVRVVINAVYAFAHALDDMQRALCPGKVGLCE--AMIADSSGKTLIDFLRNVTFPDASYGWPVRFNKNQEMDGNYSIMNFQY------QNGKWIYENVGSWSWGDESDNVRMEHLILESQKISWGKGKLSPPH------SICSAPCQFPQIRNQLPVNPKCCWECSFCDEHQIV----VNDSCQSCLPGHRPYTNHSMCVKLPVVHPSLGEAMGITFAVWSCLGMLVTLAICVFFVKSREHEVVKAAGRELCAIILLGIMLCYASIFTNLVEPDAITCTVERFFSSVCYTTCYAPLLMKTN--RIYRIFSRARKAASRPHLTSPTSQVLVTAGLIAVQLLLTTVWTISSPSHIHITYERLTRTVISCESHGGMLALNLSYNILLMLICTLFAFKTRNFPRNFNEAKYIGVMMYLTCAAWIIYLPSYLNTHDVWAQVYLNCGVSVTIATITLAGIFAPKVHVII 877          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Nematostella
Match: EDO47627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLL8])

HSP 1 Score: 312.768 bits (800), Expect = 4.653e-91
Identity = 235/839 (28.01%), Postives = 392/839 (46.72%), Query Frame = 3
Query:  222 NTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQE-HLKNTTDICTDEGLEIDNKE---EXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFV---VKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKF-SAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWK---------ENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFR-ERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKW--SDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTN---LKEISLCFAMHFTATICIVFLFLPKLYIIL 2669
            + R    + G +++G LF +H + T   +    CG I    G       +  I EIN+N NILP + LG  I D+C    I  + +++ IK +L      + N + P+ G+IGP  S+V V V NLL +F IPQ+ + AT+  LS+K  YKYF R VP +  Q +AL++++ YFKWSY+  ++S G YGE G+ E++    K+   I  D  L    KE   EA     L L         V++ FC     T L+R+  KL      ++ + ++ W +R  +    E       E   G++T+      +  F D+  + T      + WF EFW+   NC ++  K     +  T KE   N    +D  +  V   + +V   A  LHN+Y  +C  ++   +   N    N    L  + ++ F  A  N TVRF+  G+  G Y I+N+      +    +Y Y ++GSW          E    I++  I W K   N      +  S+CS PC   QI         CCW C DC   +  +    N++C SC  G  P+++ ++C ++P ++      + + IV  +  ++G I TI     F K  +  V+K+  REL  ++ +     YL+    + +PT F C + R    +S +  +  ++ +TN        +  +    +  F +  +Q++    +  V+++I  V    + P++   Y    T+ L C      + +++ ++  L+   T YAFKTRN P NFNEAK+IG TMY +C +WI  +  YL+      K      A+   AT+ ++ L +P++Y+++
Sbjct:   67 DNRGPIVLEGDVILGGLFNVHSRST---TTENGCGSIDLNPGFQYYAAAVFAIDEINKNPNILPGVKLGARIYDTCRSQTIGGDDAMEIIKYTL----LDRTNSTPPLAGVIGPFRSDVAVAVANLLGVFNIPQVSFGATTTKLSNKQIYKYFFRTVPPNSFQGRALVDVVRYFKWSYVMTVHSHGDYGEPGMDEVKSAAAKHGVCIAGDYKLPPFPKEEDFEATIKSLLDLSKKHSDTVHVVVMFCIQRDNTGLVRAAKKLLNENNRFIFVASNSWGERHPVTNNNE-------EGGEGALTLNFIDGNVKRFKDHLLSLTPLDD-NSTWFHEFWQISMNCKLSFAKW----QFNTTKECRLNEMLPRDFGIAPVRVSINAVYAAAHALHNMYTNLCPKQSGMCDEFRNLKREN---YLKFLRNVTFPDAASNVTVRFNRNGEVDGNYSIVNF------RKVDGKYTYLKVGSWGGVLKPDDSIEGDATIDESRISW-KPRWN-----IAPDSYCSSPCSIRQITAPAIANPTCCWQCVDCKHKQYIS----NDTCLSCPDGHTPDANLTSCYKLPVVYATPFNGNTAQIVTFVVVLLGSISTICTGVFFLKNKDNRVIKASGRELSAILFIATLCCYLSAISYMTRPTDFLCGMRRFSGSVSLTACYAPVLLRTN--RIHRIFTAAQKSVTRPSFTSPMSQVMFCLGIIAVQVLITCVWFLSDPPRAVMSYYDERTL-LECGMSDTSVAMNLCYNIFLMLVATVYAFKTRNFPRNFNEAKYIGITMYISCAVWIIFLPCYLNAANSIWKSTMKAVALVAIATVTLLGLLVPRMYLVI 864          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Medaka
Match: grm5b (glutamate metabotropic receptor 5 [Source:NCBI gene;Acc:101164491])

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 366/855 (42.81%), Postives = 533/855 (62.34%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQEKSQ--------VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QP  +  + R+CG +RE+YG+ RVE ++ T+  IN + +ILP ++LG +IRDSCW + +ALEQSI+FI++SL   ++++        +   KPIVGLIGP +S V +QVQNLLQLF IPQI YSATS+DLS K+ YKYFMRVVPSD  Q +A+++++  + WSY+S ++S+G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  +L +M +  +  + +L+IG+DGWADR D+          + EAA G ITI+L S  +  FD+Y+      +   NPWF EFW+ +FNC +  +  +S+KY +TC R     N  Y QD+K+GFV+ ++ ++A+GLHN+ Q +C       +G C      +G  LLD ++   F+    E + FD  GD PGRY+IMN++     K  +  + Y  IGSW  + L I+D  I W   +       T IKS CS+PC   QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  PN+D + C  IP  +L+W D   I A++F+ +GL+ T  +  +F ++ +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L R+  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ++I FLL ++++ II  +     P+   DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   23 SERRVVAHIPGDVIIGALFSVHHQPPADKVHERKCGAVREQYGIQRVEAMMHTLDRINADQHILPNISLGCEIRDSCWNSAVALEQSIEFIRDSLVSSDEAEEWDPAATPMRGKKPIVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWSYVSAIHSEGNYGESGMEAFKD-MAAKEGICIAHSGKIWSNAGEQSFDRLLERLRAHLPKARVVACFCEGMTVRNILMAMRRQGLVGE-FLLIGSDGWADRYDVTDGF------VREAA-GGITIKLQSADVKWFDEYYLKLRPENNQRNPWFPEFWQHRFNCRLKGHPQESNKYNQTCERDSLRHN--YAQDTKMGFVINAIYSMAYGLHNMQQALCP----GYQGLCDAMRPIDGATLLDFLMKTNFTGVSGEGILFDENGDSPGRYEIMNFK-----KMGKDYFDYVHIGSWDNSGLKIDDDEI-WSSKD-------TIIKSVCSEPCDKGQIKVIRKGEVSCCWTCTPCKENEFV---FDEYTCQACELGSWPNNDLTGCDPIPVEYLRWGDPEPIAAVVFACLGLMATFFVTAVFIRFRDTPVVKSSSRELCYIILAGICLGYLCTFTLIAKPHVIHCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLIIAFLLILLQLGIIVALFIMETPEVIHDYPSIRQVNLICNTTNLGVVAPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALCCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 846          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Medaka
Match: grm5b (glutamate metabotropic receptor 5 [Source:NCBI gene;Acc:101164491])

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 366/875 (41.83%), Postives = 535/875 (61.14%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLSLQE----------------------------KSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            S  R    + G ++IGALF +H QP  +  + R+CG +RE+YG+ RVE ++ T+  IN + +ILP ++LG +IRDSCW + +ALEQSI+FI++SL   +                             + +   KPIVGLIGP +S V +QVQNLLQLF IPQI YSATS+DLS K+ YKYFMRVVPSD  Q +A+++++  + WSY+S ++S+G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  +L +M +  +  + +L+IG+DGWADR D+          + EAA G ITI+L S  +  FD+Y+      +   NPWF EFW+ +FNC +  +  +S+KY +TC +++SL +  Y QD+K+GFV+ ++ ++A+GLHN+ Q +C       +G C      +G  LLD ++   F+    E + FD  GD PGRY+IMN++     K  +  + Y  IGSW  + L I+D  I W        +  T IKS CS+PC   QI++ R+ +  CCWTC  C ENE     F   +C +C+ G  PN+D + C  IP  +L+W D   I A++F+ +GL+ T  +  +F ++ +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L R+  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ++I FLL ++++ II  +     P+   DY     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YIIL KPERN RSAFTT+T +R H+G GK
Sbjct:   24 SERRVVAHIPGDVIIGALFSVHHQPPADKVHERKCGAVREQYGIQRVEAMMHTLDRINADQHILPNISLGCEIRDSCWNSAVALEQSIEFIRDSLVSSDEAEEWGAGGAWGGGGGGGTTTMKCTDPAATPMRGKKPIVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWSYVSAIHSEGNYGESGMEAFKD-MAAKEGICIAHSGKIWSNAGEQSFDRLLERLRAHLPKARVVACFCEGMTVRNILMAMRRQGLVGE-FLLIGSDGWADRYDVTDGF------VREAA-GGITIKLQSADVKWFDEYYLKLRPENNQRNPWFPEFWQHRFNCRLKGHPQESNKYNQTCGKRDSLRHN-YAQDTKMGFVINAIYSMAYGLHNMQQALCP----GYQGLCDAMRPIDGATLLDFLMKTNFTGVSGEGILFDENGDSPGRYEIMNFK-----KMGKDYFDYVHIGSWDNSGLKIDDDEI-W-------SSKDTIIKSVCSEPCDKGQIKVIRKGEVSCCWTCTPCKENEFV---FDEYTCQACELGSWPNNDLTGCDPIPVEYLRWGDPEPIAAVVFACLGLMATFFVTAVFIRFRDTPVVKSSSRELCYIILAGICLGYLCTFTLIAKPHVIHCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLIIAFLLILLQLGIIVALFIMETPEVIHDYPSIRQVNLICNTTNLGVVAPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALCCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGK 868          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Medaka
Match: grm5a (metabotropic glutamate receptor 5 [Source:NCBI gene;Acc:101173805])

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 367/862 (42.58%), Postives = 539/862 (62.53%), Query Frame = 3
Query:  219 SNTRKT-GFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL--SLQEKSQVNFS-----------KPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEG-CANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNY-QYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            SN R+    + G ++IGALF +H QP  +  + R+CG +RE+YG+ RVE ++ T+  IN +S ILP +TLG +IRDSCW++ +ALEQSI+FI+++L  S  E+SQ   S           KPIVGLIGP +S V +QVQNLLQLF IPQI YSATS+DLS K+ +KYFMRVVPSD+ Q +A+++++  + WSY+S ++++G+YGE G++  ++ +     IC     +I  N  E      L        K +V+ CFC+G TV  +L +M +  +  + +L++G+DGWADR D+    E       EAA G ITI+L S  +  FDDY+      + P NPWF EFW+ +F C +  +  ++  + +TC   +SL +  Y QD+K+GFV+ ++ ++A+GL+ + Q +C       +G C N    +G+ LLD ++   F+    ET+ FD  GD PGRY+IMN+ Q G NE      Y Y  +GSW +  L + D  I W  S E        I+S CS+PC+  QI++ R+ +  CCWTC  C ENE     F   +C +C  G  P  D + C  IP  +++W D   I A++F+ +GL+ T+ +  +F K+ +TPVVKS +REL Y+IL G+ L YL TF L+ KP    C L R+  GLS ++ + +LVTKTNRI RIL+ SKKKI  +K RF++  AQ+VI FLL ++++ II  ++    P+   DY     V LICN  +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I++CF++  +AT+ +  +F+PK+YI+L KPE+N RSAFTT+T +R H+G+ K
Sbjct:   29 SNERRVLAHIPGDIIIGALFSVHHQPPADKVHERKCGAVREQYGIQRVEAMMHTLDRINADSTILPNITLGCEIRDSCWHSAVALEQSIEFIRDTLVSSDDEESQGRCSTEGGSVLLQGKKPIVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLFKYFMRVVPSDMQQARAMVDIVRRYGWSYVSAIHTEGNYGESGMEAFKD-MAAKEGICIAHSDKIYSNAGEQSFDKLLEKLRGHLPKARVVACFCEGMTVRGILMAMRRRRLVGE-FLLVGSDGWADRYDVTDGYER------EAA-GGITIKLKSAYVTWFDDYYLNLKPDANPRNPWFPEFWQHRFQCRLRGHPQENTMFNRTC---KSLRHQ-YAQDTKMGFVINAIYSMAYGLNAMQQSLCP----GYKGLCENMRPIDGRKLLDFLMKTNFTGVSGETILFDQNGDSPGRYEIMNFKQIGENE------YSYIHVGSWDQGGLKMNDEEI-WSNSSE-------VIQSVCSEPCQKAQIKVIRKGEVSCCWTCTPCKENEFV---FDEYTCRACTLGSWPTDDLTGCEPIPVQYVRWGDPEPIAAVVFACLGLMATLFVTSVFIKFWDTPVVKSSSRELCYIILAGICLGYLCTFSLIAKPHIIYCYLQRLGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFLLILLQLGIIVALLIIEPPQVIYDYPSIREVHLICNLTTLGVVAPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALCCMFVPKVYIMLAKPEKNVRSAFTTSTVVRMHVGNAK 856          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Medaka
Match: grm1a (glutamate metabotropic receptor 1 [Source:NCBI gene;Acc:101165118])

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 352/866 (40.65%), Postives = 534/866 (61.66%), Query Frame = 3
Query:  219 SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQEKSQVN--------------FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKTEYEC 2759
            + +R    + G ++IGALF +H QP+      R+CG++RE+YG+ RVE +  T+  IN + N+LP ++LG +IRDSCW++ +ALEQSI+FI++SL S+++    +                KPI G+IGP +S V +QVQNLLQLF IPQI YSATSIDLS K  YKYF+RVVPSD LQ +A+++++  + W+Y+S ++++G+YGE G++  +E L +   +C     +I  N  E H    L     +  K +V++CFC+G TV  LL +M +L +  + +L++G+DGWADR ++   +E   +E    A G IT++L S  +  F+DY+      +   NPWF EFW+ +F C +  +  ++  Y   C+  ESL    Y+QDSK+GFV+ ++  +A GLH++++++C  +    E        +G  LLD ++   F     E + FD  GD PGRYDIMN Q   +E  +R  Y Y ++GSW E  L I+D  + W        N+   ++S CS+PC   QI++ R+ +  CCW C  C +NE     F   +C +C+ G+ P+ +  +C  +P  ++ W+D   +VA+ FS VG++IT  +  +F +Y +TPVVKS +REL Y+IL G+ L Y+  F L+ +PT  SC L R++ GLS ++ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ+VI F+L  V++ +   +I    P+    Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  ++ K I+  F++  + T+ +  +F PK+YII+ KPERN RSAFTT+  +R H+G GK   +C
Sbjct:   39 AASRSVARMDGDVIIGALFSVHHQPSAEKVAERKCGDVREQYGIQRVEAMFHTLDRINADPNLLPNISLGCEIRDSCWHSSVALEQSIEFIRDSLISIRDDKDGSKWCIDGTPSNHPPPSKKPIAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMEAFKE-LASQEGLCIAHSDKIYSNAGEKHFDRLLRKLRERLPKARVVVCFCEGMTVRGLLMAMRRLGVHGE-FLLVGSDGWADRYEV---VEGYELE----AEGGITMKLQSAVVKSFNDYYLKLRLDTNTRNPWFAEFWQHRFQCRLAHHPQENKNYENVCSGNESL-QENYIQDSKMGFVINAIYAMAHGLHDMHKELCPGQPGLCEAMDPI---DGSKLLDYLLKTSFRGVSGEEIYFDQNGDTPGRYDIMNLQ---SEGEDR--YDYLKVGSWHEGILSIDDSKL-W-------INSSDMVRSVCSEPCSKGQIKVIRKGEVSCCWICTTCKDNEYVQDEF---TCKACELGWWPDEELEDCQPLPLKYVDWADVESVVAVAFSCVGILITSFVTFVFIQYRDTPVVKSSSRELCYIILAGIFLGYICPFTLIARPTVASCYLQRLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVVIAFMLISVQLTLEITLIILEPPEPIKSYPSIREVYLICNTSNVGMVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSDYKIITTSFSVSLSVTVALSCMFTPKMYIIIAKPERNVRSAFTTSDVVRMHVGDGKAAAQC 875          
BLAST of Glutamate receptor, metabotropic vs. Ensembl Medaka
Match: stxbp5b (syntaxin-binding protein 5 [Source:NCBI gene;Acc:101172714])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 365/884 (41.29%), Postives = 540/884 (61.09%), Query Frame = 3
Query:  168 LKLWIFISFI--KTAYE---LP-SNTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL-SLQEKSQ--------------VNFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEI-DNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHI--NKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERK-KCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGK 2744
            L + +F +F+  K  YE   +P S +R    + G ++IGALF +H QP+      R+CGE+RE+YG+ RVE +   +  IN +  +LP +TLG +IRDSCW++ +ALEQSI+FI++SL S+++ S+               +  KPIVG+IGP +S V +QVQNLLQLF IPQI YSATS+DLS K  +KYF+RVVPSD LQ +AL++++    W+Y+S ++++G+YGE G++  +E L     +C     +I  N  E H    L     +  K +V++CFC+G TV  LL +M +L ++ +  L+IG+DGWADR +++   E         A+G IT++L S  +  FDDYF     S+   NPWF EFW+ +F C +  +  ++  Y + CT  ESL +  YVQDSK+GFV+ ++  +A GLH+++  +C   +  L  C +    +G  LLD ++   F+    E + FD  GD PGRY+IMN+Q     +     Y Y  IGSW E  L +E+ LI          N+   ++S CS+PC   +I++ R+ +  CCW C  C ENE     F   +C +C+ G+ P+ +   C  IP  +L+WS+   I+ ++FS +G+++T  +  IF  Y +TPVVKS +REL Y+IL G+ L YL  F L+ +PT  SC L R++ G S ++ + +LVTKTNRI RIL+ SKKKI  RK RF++  AQ+VI  +L  V++ +   +I    P+    Y     V LICNT +  +   +G++ +L+  CT+YAFKTRN+P NFNEAK+I FTMYTTCIIW+  V IY  +N K I+  F++  + T+ +  +F PK+YIIL KPERN RSAFTT+  +R H+G GK
Sbjct:   15 LPVLLFQAFVWSKGKYERSVVPISASRLVARMDGDIIIGALFSVHHQPSAEKVAERKCGEVREQYGIQRVEAMFHALDRINSDPTLLPNITLGCEIRDSCWHSSVALEQSIEFIRDSLISIRDDSEGSKWCIEGTPSSQPPSTKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSVDLSDKTLFKYFLRVVPSDTLQARALLDIVKRHNWTYVSAVHTEGNYGESGMEVFKE-LAAQEGLCIAHSDKIYSNAGEKHYDRLLRKLRERLPKARVVVCFCEGMTVRGLLMAMRRLGVSGE-LLLIGSDGWADRVEVVEGFE-------PEAVGGITVKLQSADVSSFDDYFLKLKLSTNTRNPWFPEFWQYRFQCRLPGHPQENLNYARNCTGYESLEDN-YVQDSKMGFVINAIYAMAHGLHDMHSHLC-PDHVGL--CDDMEPVDGSHLLDFLLKTSFAGVSGEDIWFDENGDSPGRYEIMNFQ-----RVEPGVYDYINIGSWHEGLLSLEEELI--------PMNSSDMVRSVCSEPCSKGEIKVIRKGEVSCCWICTACKENEYVQDEF---TCKACELGWWPDEELEGCQPIPLHYLEWSNPESIIQVVFSCLGILVTSFVAFIFVLYRDTPVVKSSSRELCYIILAGIFLGYLCPFTLLARPTVASCYLQRLLVGFSAAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVVIASVLISVQLTLEVTLIIMEPPEPIKSYPSIREVFLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTSFSVSLSVTVALGCMFTPKMYIILAKPERNVRSAFTTSDAVRMHVGDGK 869          
BLAST of Glutamate receptor, metabotropic vs. Planmine SMEST
Match: SMESG000064049.1 (SMESG000064049.1)

HSP 1 Score: 1330.08 bits (3441), Expect = 0.000e+0
Identity = 724/725 (99.86%), Postives = 725/725 (100.00%), Query Frame = 3
Query:  681 MRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKTEYECXXXXXXXXXXXXXXXFRYLSDERKSSMFRSQT 2855
            MRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEAHKFDALALKLFKKGKPKVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDASVIVAIIFSIVGLIIT+IIVGIFAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNRICRILSISKKKIIRRKGRFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKTEYECSKNKSDKRKSNSNANFRYLSDERKSSMFRSQT
Sbjct:    1 MRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEAHKFDALALKLFKKGKPKVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDASVIVAIIFSIVGLIITVIIVGIFAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNRICRILSISKKKIIRRKGRFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSGKTEYECSKNKSDKRKSNSNANFRYLSDERKSSMFRSQT 725          

HSP 2 Score: 312.768 bits (800), Expect = 5.082e-91
Identity = 166/167 (99.40%), Postives = 167/167 (100.00%), Query Frame = 1
Query: 2857 ICLIEQISSRENGLLTSPTNRESKFIQTEFSLVMEFLLNLCRSLHCNNEELTISQIALLQFLKDNWNKDHIPQLQKLNFCDRHSGELTGSDVKFMDEDQILDNFLDETDVDNSSLKHPLNRQCNSVLTCSPXXXXXXXXXXXXXXLFLEYLQMHGKQFKNINDKRSV 3357
            ICLIEQISSRENGLLTSPTNRESKFIQTEFSLVMEFLLNLCRSLHCNNEELTISQIALLQFLKDNWNKDHIPQLQKLNFCDRHSGELTGSDVKFMDEDQILDNFLDETD+DNSSLKHPLNRQCNSVLTCSPISNASTNASSTITSLFLEYLQMHGKQFKNINDKRSV
Sbjct:  727 ICLIEQISSRENGLLTSPTNRESKFIQTEFSLVMEFLLNLCRSLHCNNEELTISQIALLQFLKDNWNKDHIPQLQKLNFCDRHSGELTGSDVKFMDEDQILDNFLDETDIDNSSLKHPLNRQCNSVLTCSPISNASTNASSTITSLFLEYLQMHGKQFKNINDKRSV 893          
BLAST of Glutamate receptor, metabotropic vs. Planmine SMEST
Match: SMESG000064053.1 (SMESG000064053.1)

HSP 1 Score: 496.893 bits (1278), Expect = 5.625e-165
Identity = 251/464 (54.09%), Postives = 330/464 (71.12%), Query Frame = 3
Query:  222 NTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSL---------SLQEKSQVN---FSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTI---ENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTKSDKYPKTCTRKESLFNM-PYVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQY 1565
            N RK GFV+G ++IG L PIHEQP   G  S  CG+IR++YGM RVE +LKTI EIN N  IL  + LGV+IRD+CW  PIALEQ +D IKN +         +L  +S VN   + K I  L+GPA+S++T+ VQNL+QLFKIPQ+GYSAT+I+LS K +YKYF+RVVPSD LQVKAL++L+ +FKW+YISLLNS   YG +GIKEL + +K+   IC    LE+D+K++      +   L    K KVI+CFCQG+TVTKLL+++  LN T++GYLIIGTDGWADRT+ILG +   +  + ELS AA+G+IT+RLHS P+ DFD+YF +K  ++T GNPWFQEFWE KF C I  ++  +Y + C+ +ESL++   YVQDSKLGFVVKSV+T+A GLH + +K       T  G   FI  NG LL++EM++L F  YDNE V+FD+ GDPPGRY +  + Y
Sbjct:   21 NVRKYGFVNGDIIIGVLLPIHEQPA-KGINSVTCGDIRDQYGMQRVEAILKTINEINNNPKILRGIKLGVEIRDTCWDIPIALEQCLDVIKNIVDQRKFDNNQTLNTQSVVNNNLYKKGISALLGPASSDITIDVQNLMQLFKIPQVGYSATTIELSDKEAYKYFLRVVPSDKLQVKALVDLIRHFKWTYISLLNSVDVYGSKGIKELTDQIKSIDSICIANQLEVDDKDDIQVLQNITNLLLSDPKAKVIICFCQGNTVTKLLQAIINLNKTREGYLIIGTDGWADRTEILGPVIDKKEKKRELSSAAVGAITLRLHSSPLLDFDNYFLSKGYNNTDGNPWFQEFWEHKFKCSIQVSEDSRYKEKCSGRESLYDQTDYVQDSKLGFVVKSVITVAMGLHQLMRKDLPFLQNTKSG---FIFINGSLLMNEMLNLSFVGYDNEVVKFDANGDPPGRYPLSFFDY 480          
BLAST of Glutamate receptor, metabotropic vs. Planmine SMEST
Match: SMESG000064054.1 (SMESG000064054.1)

HSP 1 Score: 422.165 bits (1084), Expect = 2.533e-136
Identity = 247/347 (71.18%), Postives = 276/347 (79.54%), Query Frame = 3
Query: 1704 IKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITNKTFH-NESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIRCHIGSG 2741
            IKS CS  C  DQIRIF + K+CCW+C+ CS+ +  NK+   +E C  C KGF   S ++ C EI   F  W D   I+AIIFS +GLIITI I+ I AK++NTPVVKS TRELMY ILVG+ALSYLT FPL+ KPT  SC L+RIMPGLSFSLIFGSLVTKTNRI RIL+ISKKKII RKGRFLTTTAQIVIVFLLNV+EI IIS MIW   P     Y     V LICNT S  L ISMGFDAVL+ FCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLST+L+ ISLCFA+  TATICI+ LFLPK+YIILF+PE+NERSAFTTTTEI+CHIGSG
Sbjct:    7 IKSICSRLCNLDQIRIFNQNKRCCWSCRSCSKTQYINKSAGFDEKCVKCPKGFLATSKKTECKEIDPSFTHWEDVGSIMAIIFSCIGLIITIAILAILAKFHNTPVVKSSTRELMYAILVGIALSYLTIFPLLHKPTVLSCYLTRIMPGLSFSLIFGSLVTKTNRIFRILAISKKKIIYRKGRFLTTTAQIVIVFLLNVIEIAIISAMIWQQPPNPIKLYISTDKVYLICNTPSSSLMISMGFDAVLIAFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLSTDLQVISLCFAIDLTATICIILLFLPKVYIILFRPEKNERSAFTTTTEIQCHIGSG 353          
BLAST of Glutamate receptor, metabotropic vs. Planmine SMEST
Match: SMESG000033752.1 (SMESG000033752.1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.767e-132
Identity = 292/893 (32.70%), Postives = 472/893 (52.86%), Query Frame = 3
Query:  168 LKLWIFISFIKTAYELPS---NTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLS---------LQEKSQV----NFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNC---------HINKTKSDKYPKTCTRKE-----SLFNMP-----YVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILR-NGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENE-ITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLST----NLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIR 2723
            L + I+ SF  T   + S   N  ++   +G +++G LFP+H+  T        C +I  + G+ R+E +L TI+EIN   +ILP + +G  I D+C     AL+QS+DFIK+SLS          ++KS+V      ++ I  ++G + S V++ V NLL+LF IPQI Y++TS  LS K ++  F R +PSD  Q KA+  L+  F W+Y+S + S G YG+ GI    +  K        + +   N   +     +     +  K +V++ F + D  TKLL +  K+      +L I +DGW       G + N     S  A G+IT  + +  I +F  YF   T +    NPWF E+WE+ F+C           +  K  ++P++ + K      ++FN       + Q+SK+  V  +V  +A+ L     K+C  K F LE C   +   +G +   ++I+  F+      V FDS GD  G+Y+I  Y Y  N+KT +  Y+Y+ IG ++ + L +    + WP  EE E       +S CS+ C   QIRI+ +  KCCW C  C  NE + N T     C  C +G  P  +R+ C  +   ++K S    I+ +I S +G   T  ++G+F  Y NTP+V++  REL ++IL G  + YL +F  + KPT +SC + RI+ GL F++++ SL+TKTNRI RI   ++K   R     ++  +Q++I  +L  V+++  ++ ++ + P  + D        L C  E++   +S+ ++ +L+  CT+YA KTR +PENFNE+KFIGFTMYTTC+IW+  + IY  T     ++  +L  ++  +A + ++ LF PKL+II  +PE+N R    ++T  R
Sbjct:   11 LPIVIYYSFFVTVNLIASEIDNKYQSAIYNGDIILGGLFPVHDSET------ELCKKINPDRGIQRLEAMLFTIQEINNRPDILPNINIGARILDTCSKDTYALQQSLDFIKSSLSDNNDASDYYCKDKSEVLRHTKATQKIRTVVGGSYSSVSILVANLLRLFSIPQISYASTSALLSEKKNHPIFARTLPSDQQQAKAMAELVASFNWTYVSTVRSSGDYGDSGIDAFWKESKKLGVCIAAKEMIKPNPLHSDLLAIVKTLYQEFSKTRVVVLFTRLDH-TKLLLNAVKIMNYSNYFLWIASDGWGQEN---GPVTNN----SNVANGAITFEVKTVEIKNFTTYFHQLTYNRNSNNPWFDEYWEELFDCIPIKQKMRVSRSSVKDYRFPRSNSVKSRKQLCTMFNFSSKLKNFKQESKIQSVYDAVYAVAYTLDRFQAKLC--KPFVLEKCVKALNNIDGMVFYKDLINNSFTDSYGNLVSFDSNGDSVGQYNI--YNYIRNKKTGK--YYYKNIGEFRHDGLFLNSE-VTWP-GEEKEIP-----RSICSEDCPVGQIRIYSKESKCCWGCSLCKSNEFVVNMT----KCEMCAEGEWPYQNRTGCYLLTVHYMKLSGWLAIIPMILSFLGTATTTSVMGVFYYYKNTPIVRASGRELSFLILSGCLVCYLVSFIFLLKPTPYSCAIQRILLGLGFAVMYASLLTKTNRIARIFESAQKTAKRPPC--ISPKSQLMICAVLISVQLLSNAIWLFFSPPGIRYDRKKPEFPVLKCKIETKTFLVSLVYNMLLISVCTYYAIKTRKIPENFNESKFIGFTMYTTCVIWLAFITIYFGTLHSFEVQISTLGISVSLSAWVTLICLFFPKLHIIFLQPEKNVRKLTMSSTTYR 870          
BLAST of Glutamate receptor, metabotropic vs. Planmine SMEST
Match: SMESG000033752.1 (SMESG000033752.1)

HSP 1 Score: 418.698 bits (1075), Expect = 7.047e-130
Identity = 294/908 (32.38%), Postives = 472/908 (51.98%), Query Frame = 3
Query:  168 LKLWIFISFIKTAYELPS---NTRKTGFVSGHLMIGALFPIHEQPTLNGSYSRECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPIALEQSIDFIKNSLS---------LQEKSQV----NFSKPIVGLIGPAASEVTVQVQNLLQLFKIPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISLLNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEXXXXXXXXXXXXXXXXXXVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILGTIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEFWEKKFNCHINKTK------------------------SDKYPKTCTRKE-----SLFNMP-----YVQDSKLGFVVKSVMTIAWGLHNIYQKVCIVKNFTLEGCANFILR-NGKLLLDEMIDLKFSAYDNETVRFDSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQWPKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENE-ITNKTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDXXXXXXXXXXXXXXXXXXXXXXXXAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTTFSCLLSRIMPGLSFSLIFGSLVTKTNXXXXXXXXXXXXXXXXXXXFLTTTAQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLFISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVIYLST----NLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTTEIR 2723
            L + I+ SF  T   + S   N  ++   +G +++G LFP+H+  T        C +I  + G+ R+E +L TI+EIN   +ILP + +G  I D+C     AL+QS+DFIK+SLS          ++KS+V      ++ I  ++G + S V++ V NLL+LF IPQI Y++TS  LS K ++  F R +PSD  Q KA+  L+  F W+Y+S + S G YG+ GI    +  K        + +   N   +     +     +  K +V++ F + D  TKLL +  K+      +L I +DGW       G + N     S  A G+IT  + +  I +F  YF   T +    NPWF E+WE+ F+C   K K                        S  +P++ + K      ++FN       + Q+SK+  V  +V  +A+ L     K+C  K F LE C   +   +G +   ++I+  F+      V FDS GD  G+Y+I  Y Y  N+KT +  Y+Y+ IG ++ + L +    + WP  EE E       +S CS+ C   QIRI+ +  KCCW C  C  NE + N T     C  C +G  P  +R+ C  +   ++K S    I+ +I S +G   T  ++G+F  Y NTP+V++  REL ++IL G  + YL +F  + KPT +SC + RI+ GL F++++ SL+TKTNRI RI   ++K   R     ++  +Q++I  +L  V+++  ++ ++ + P  + D        L C  E++   +S+ ++ +L+  CT+YA KTR +PENFNE+KFIGFTMYTTC+IW+  + IY  T     ++  +L  ++  +A + ++ LF PKL+II  +PE+N R    ++T  R
Sbjct:   11 LPIVIYYSFFVTVNLIASEIDNKYQSAIYNGDIILGGLFPVHDSET------ELCKKINPDRGIQRLEAMLFTIQEINNRPDILPNINIGARILDTCSKDTYALQQSLDFIKSSLSDNNDASDYYCKDKSEVLRHTKATQKIRTVVGGSYSSVSILVANLLRLFSIPQISYASTSALLSEKKNHPIFARTLPSDQQQAKAMAELVASFNWTYVSTVRSSGDYGDSGIDAFWKESKKLGVCIAAKEMIKPNPLHSDLLAIVKTLYQEFSKTRVVVLFTRLDH-TKLLLNAVKIMNYSNYFLWIASDGWGQEN---GPVTNN----SNVANGAITFEVKTVEIKNFTTYFHQLTYNRNSNNPWFDEYWEELFDCIPIKQKMRVSRSSVKSLMSEKKAITTFTQISPIFPRSNSVKSRKQLCTMFNFSSKLKNFKQESKIQSVYDAVYAVAYTLDRFQAKLC--KPFVLEKCVKALNNIDGMVFYKDLINNSFTDSYGNLVSFDSNGDSVGQYNI--YNYIRNKKTGK--YYYKNIGEFRHDGLFLNSE-VTWP-GEEKEIP-----RSICSEDCPVGQIRIYSKESKCCWGCSLCKSNEFVVNMT----KCEMCAEGEWPYQNRTGCYLLTVHYMKLSGWLAIIPMILSFLGTATTTSVMGVFYYYKNTPIVRASGRELSFLILSGCLVCYLVSFIFLLKPTPYSCAIQRILLGLGFAVMYASLLTKTNRIARIFESAQKTAKRPPC--ISPKSQLMICAVLISVQLLSNAIWLFFSPPGIRYDRKKPEFPVLKCKIETKTFLVSLVYNMLLISVCTYYAIKTRKIPENFNESKFIGFTMYTTCVIWLAFITIYFGTLHSFEVQISTLGISVSLSAWVTLICLFFPKLHIIFLQPEKNVRKLTMSSTTYR 885          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor, metabotropic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRM50.000e+041.91glutamate metabotropic receptor 5 [Source:HGNC Sym... [more]
GRM50.000e+041.91glutamate metabotropic receptor 5 [Source:HGNC Sym... [more]
GRM50.000e+041.91glutamate metabotropic receptor 5 [Source:HGNC Sym... [more]
GRM10.000e+043.21glutamate metabotropic receptor 1 [Source:HGNC Sym... [more]
GRM10.000e+043.21glutamate metabotropic receptor 1 [Source:HGNC Sym... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgl-20.000e+039.01Metabotropic GLutamate receptor family [Source:Un... [more]
mgl-20.000e+039.01Metabotropic GLutamate receptor family [Source:Un... [more]
mgl-20.000e+039.01Metabotropic GLutamate receptor family [Source:Un... [more]
mgl-12.088e-11830.30Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-13.375e-11830.30Probable metabotropic glutamate receptor mgl-1 [S... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mGluR2.001e-13432.11gene:FBgn0019985 transcript:FBtr0089184[more]
mGluR2.001e-13432.11gene:FBgn0019985 transcript:FBtr0332858[more]
mtt1.892e-12231.07gene:FBgn0050361 transcript:FBtr0273326[more]
mtt6.199e-12231.30gene:FBgn0050361 transcript:FBtr0273327[more]
mtt7.264e-12131.55gene:FBgn0050361 transcript:FBtr0273325[more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm5b0.000e+042.32glutamate receptor, metabotropic 5b [Source:ZFIN;A... [more]
grm5a0.000e+042.14glutamate receptor, metabotropic 5a [Source:ZFIN;A... [more]
grm5a0.000e+042.14glutamate receptor, metabotropic 5a [Source:ZFIN;A... [more]
grm1b0.000e+041.35glutamate receptor, metabotropic 1b [Source:ZFIN;A... [more]
grm1b0.000e+041.35glutamate receptor, metabotropic 1b [Source:ZFIN;A... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRM50.000e+043.46glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM50.000e+043.46glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM50.000e+043.46glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM50.000e+043.46glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM50.000e+043.46glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grm50.000e+042.24glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
Grm50.000e+042.24glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
Grm50.000e+042.24glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
Grm10.000e+043.21glutamate receptor, metabotropic 1 [Source:MGI Sym... [more]
Grm10.000e+043.21glutamate receptor, metabotropic 1 [Source:MGI Sym... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P31424|GRM5_RAT0.000e+042.24Metabotropic glutamate receptor 5 OS=Rattus norveg... [more]
sp|Q3UVX5|GRM5_MOUSE0.000e+042.24Metabotropic glutamate receptor 5 OS=Mus musculus ... [more]
sp|P41594|GRM5_HUMAN0.000e+041.91Metabotropic glutamate receptor 5 OS=Homo sapiens ... [more]
sp|P23385|GRM1_RAT0.000e+043.32Metabotropic glutamate receptor 1 OS=Rattus norveg... [more]
sp|Q13255|GRM1_HUMAN0.000e+043.21Metabotropic glutamate receptor 1 OS=Homo sapiens ... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HL970.000e+045.48metabotropic glutamate receptor 1 OS=Lingula ungui... [more]
A0A068WKL90.000e+042.11Metabotropic glutamate receptor 5 OS=Echinococcus ... [more]
A0A068Y8J00.000e+041.99Metabotropic glutamate receptor 5 OS=Echinococcus ... [more]
A0A210QJG20.000e+043.63Metabotropic glutamate receptor 1 OS=Mizuhopecten ... [more]
A0A0X3P5L40.000e+042.10G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm5b0.000e+041.52metabotropic glutamate receptor 5 [Source:NCBI gen... [more]
grm5a0.000e+041.71metabotropic glutamate receptor 5-like [Source:NCB... [more]
grm1b0.000e+041.70glutamate receptor, metabotropic 1b [Source:ZFIN;A... [more]
grm5a0.000e+041.24metabotropic glutamate receptor 5-like [Source:NCB... [more]
grm1a0.000e+040.28glutamate receptor, metabotropic 1a [Source:ZFIN;A... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm35.938e-14033.53glutamate receptor, metabotropic 3 [Source:ZFIN;Ac... [more]
ENSPMAT00000007590.16.060e-13033.08pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 g... [more]
ENSPMAT00000005888.11.097e-7334.33pep scaffold:Pmarinus_7.0:GL487952:898:2919:-1 gen... [more]
casr4.283e-7027.00calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000008333.12.606e-6126.21pep scaffold:Pmarinus_7.0:GL477638:94752:105207:1 ... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352533.206e-13933.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317671.788e-13630.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413152.791e-10930.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486654.828e-9929.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476274.653e-9128.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm5b0.000e+042.81glutamate metabotropic receptor 5 [Source:NCBI gen... [more]
grm5b0.000e+041.83glutamate metabotropic receptor 5 [Source:NCBI gen... [more]
grm5a0.000e+042.58metabotropic glutamate receptor 5 [Source:NCBI gen... [more]
grm1a0.000e+040.65glutamate metabotropic receptor 1 [Source:NCBI gen... [more]
stxbp5b0.000e+041.29syntaxin-binding protein 5 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Glutamate receptor, metabotropic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064049.15.082e-9199.86SMESG000064049.1[more]
SMESG000064053.15.625e-16554.09SMESG000064053.1[more]
SMESG000064054.12.533e-13671.18SMESG000064054.1[more]
SMESG000033752.11.767e-13232.70SMESG000033752.1[more]
SMESG000033752.17.047e-13032.38SMESG000033752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000203 ID=SMED30000203|Name=Glutamate receptor, metabotropic|organism=Schmidtea mediterranea sexual|type=transcript|length=3357bp
TCTTCCGATCTGAATAATCGATGAAAGTGGGCAATAAAAATTGAATTAGA
TTTGCCATTGGCTGCTTTGATAATATCCAATAATTGGCCTTCATAATGCA
TTTCATGTCGCAACATCATTTTTATCATCATCATCAGCATCATTAGCATC
ATTCGAATATTAAAATGCTCAAATTATGGATTTTTATTTCTTTCATCAAA
ACCGCTTATGAATTGCCGTCAAATACGAGAAAAACTGGATTTGTGAGTGG
CCATTTGATGATTGGAGCGTTATTTCCGATCCACGAACAGCCAACATTGA
ATGGGAGCTACTCGAGAGAATGTGGCGAAATTCGAGAGGAATACGGAATG
CATCGAGTTGAAGTTCTGTTGAAAACCATCAAGGAAATTAATGAGAATTC
AAATATCTTGCCAACCCTGACGTTAGGAGTTGACATTCGTGACAGTTGCT
GGTATGCTCCAATAGCGTTAGAACAAAGTATTGATTTCATTAAGAATTCT
CTTTCTTTACAAGAAAAGTCGCAAGTCAATTTTTCTAAGCCAATAGTAGG
TCTGATCGGACCGGCAGCGAGTGAAGTGACTGTCCAAGTTCAGAATCTTT
TACAATTGTTTAAAATTCCTCAGATCGGCTATTCGGCAACGTCAATTGAC
TTGAGTAGCAAGAATTCTTACAAATACTTCATGAGAGTCGTTCCTTCAGA
TATTTTGCAAGTTAAAGCTCTAATCAATCTATTAACTTATTTTAAATGGA
GTTACATATCTCTTTTAAATTCTAAAGGCAGCTATGGTGAAGAAGGAATC
AAGGAGTTACAAGAACATTTAAAAAATACAACCGATATATGCACCGATGA
GGGACTTGAGATTGACAATAAGGAGGAGGCCCATAAATTTGATGCGCTTG
CCTTAAAATTGTTTAAGAAAGGTAAACCAAAAGTCATTTTATGTTTTTGT
CAAGGTGATACAGTCACAAAATTACTTCGGTCAATGACAAAATTGAACAT
GACGAAAAAAGGATATTTGATTATTGGAACGGATGGTTGGGCTGACAGAA
CAGACATTCTAGGAACAATAGAAAATGGTCGAATGGAATTGAGTGAAGCG
GCTCTGGGTTCTATTACAATTCGCTTGCATTCGAAACCAATACCGGATTT
TGATGATTATTTCCGAACAAAAACATCATCAAGCACGCCTGGAAATCCTT
GGTTTCAGGAATTCTGGGAAAAGAAATTTAATTGCCATATTAATAAAACA
AAATCAGATAAATATCCAAAAACATGTACCAGAAAAGAGTCACTATTCAA
CATGCCTTACGTGCAAGACTCAAAACTCGGATTCGTTGTCAAATCGGTAA
TGACGATAGCGTGGGGTTTACACAACATTTACCAGAAGGTCTGCATAGTA
AAAAACTTTACCTTAGAAGGCTGTGCAAATTTCATACTTCGAAATGGGAA
ATTGTTGCTGGATGAGATGATTGATCTTAAATTTTCTGCATATGATAACG
AAACTGTAAGATTTGATTCGAAAGGAGATCCACCTGGGAGATATGACATC
ATGAATTATCAATACGGATACAATGAGAAAACAAACAGAACTGAATATCA
CTATGAAAGAATTGGTTCGTGGAAAGAAAACCATTTGGTGATTGAAGACC
ATCTTATTCAGTGGCCGAAATCTGAGGAAAATGAACGAAATAATCAAACT
TCCATCAAATCGCATTGCAGTGATCCATGTAAATTTGATCAAATTAGGAT
TTTCAGAGAAAGGAAGAAATGTTGTTGGACATGCAAGGATTGTTCGGAAA
ATGAAATAACCAACAAAACCTTCCATAATGAATCGTGTAGTTCTTGTAAA
AAAGGGTTTCGGCCGAATAGTGACAGATCAAATTGCAGTGAAATTCCAGC
TATTTTCCTTAAATGGTCAGATGCTTCGGTGATAGTTGCAATAATATTCT
CCATTGTTGGTCTAATAATAACTATCATAATAGTTGGAATATTTGCCAAA
TACAACAATACTCCCGTTGTAAAATCTTGCACCAGAGAACTCATGTATGT
TATCTTAGTAGGAGTCGCATTATCATATTTGACAACCTTTCCTTTGGTCT
GGAAACCAACAACTTTCAGTTGTTTGTTATCAAGAATAATGCCAGGACTT
TCTTTCTCTTTAATATTCGGATCCCTTGTAACCAAAACCAATCGTATCTG
TCGAATTCTCTCGATTTCTAAAAAGAAAATCATTCGACGGAAAGGAAGAT
TTCTCACTACGACTGCTCAAATTGTAATTGTTTTTCTATTGAATGTTGTG
GAGATTATCATCATATCCGTTATGATTTGGCATAACTTTCCGAAATCAAA
GAGTGACTATTCAGTTGCAGCTACGGTCCGGTTAATATGTAATACTGAGT
CACAAGATTTATTCATTTCAATGGGATTCGATGCAGTTCTCGTATGCTTT
TGTACTTGGTACGCATTTAAAACTCGTAACTTACCAGAAAATTTTAATGA
GGCAAAATTTATTGGATTCACAATGTACACGACCTGTATTATTTGGATTG
GCTTGGTAGTCATATATTTGAGTACGAATTTAAAGGAGATATCTTTGTGC
TTTGCAATGCATTTCACTGCAACAATATGCATTGTTTTTCTTTTCTTGCC
AAAATTATATATAATTTTATTTAAACCAGAGAGAAATGAGAGATCAGCTT
TTACTACAACTACAGAGATAAGATGTCACATCGGATCGGGTAAAACTGAA
TATGAGTGTTCAAAGAATAAGTCGGACAAACGAAAATCTAATTCAAATGC
AAATTTTCGATATCTTAGTGATGAAAGAAAGTCTTCAATGTTCAGAAGTC
AAACATATCTGCTTGATAGAACAAATTTCATCTAGAGAAAATGGTTTACT
TACATCTCCAACAAATAGAGAGTCCAAGTTCATACAAACTGAGTTTTCAT
TAGTTATGGAATTCTTGTTGAATCTTTGTCGCAGTCTCCATTGCAATAAT
GAAGAGCTAACCATTTCTCAAATTGCTTTGCTACAATTTTTAAAAGATAA
CTGGAATAAAGATCACATTCCACAATTGCAGAAACTGAATTTCTGCGACA
GACATTCTGGTGAATTAACAGGATCAGATGTAAAGTTCATGGACGAAGAT
CAAATTCTAGACAATTTTCTAGATGAAACAGATGTAGACAACAGTTCTCT
CAAACATCCTTTGAACCGGCAATGCAATTCTGTATTGACATGCAGTCCAA
TTTCGAATGCATCAACAAATGCTTCCTCAACAATTACATCTTTATTTCTT
GAATATCTTCAAATGCATGGGAAACAATTTAAGAATATTAATGACAAAAG
ATCCGTA
back to top

protein sequence of SMED30000203-orf-1

>SMED30000203-orf-1 ID=SMED30000203-orf-1|Name=SMED30000203-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=165bp
MIFFLEIERIRQIRLVLVTRDPNIKEKESPGIILDNKQLKVVGFQTKGKV
VKYDNATPTKITYMSSLVQDFTTGVLLYLANIPTIMIVIIRPTMENIIAT
ITEASDHLRKIAGISLQFDLSLFGRNPFLQELHDSLWKVLLVISFSEQSL
HVQQHFFLSLKILI*
back to top

protein sequence of SMED30000203-orf-2

>SMED30000203-orf-2 ID=SMED30000203-orf-2|Name=SMED30000203-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MSVQRISRTNENLIQMQIFDILVMKESLQCSEVKHICLIEQISSRENGLL
TSPTNRESKFIQTEFSLVMEFLLNLCRSLHCNNEELTISQIALLQFLKDN
WNKDHIPQLQKLNFCDRHSGELTGSDVKFMDEDQILDNFLDETDVDNSSL
KHPLNRQCNSVLTCSPISNASTNASSTITSLFLEYLQMHGKQFKNINDKR
SV
back to top

protein sequence of SMED30000203-orf-3

>SMED30000203-orf-3 ID=SMED30000203-orf-3|Name=SMED30000203-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=907bp
MLKLWIFISFIKTAYELPSNTRKTGFVSGHLMIGALFPIHEQPTLNGSYS
RECGEIREEYGMHRVEVLLKTIKEINENSNILPTLTLGVDIRDSCWYAPI
ALEQSIDFIKNSLSLQEKSQVNFSKPIVGLIGPAASEVTVQVQNLLQLFK
IPQIGYSATSIDLSSKNSYKYFMRVVPSDILQVKALINLLTYFKWSYISL
LNSKGSYGEEGIKELQEHLKNTTDICTDEGLEIDNKEEAHKFDALALKLF
KKGKPKVILCFCQGDTVTKLLRSMTKLNMTKKGYLIIGTDGWADRTDILG
TIENGRMELSEAALGSITIRLHSKPIPDFDDYFRTKTSSSTPGNPWFQEF
WEKKFNCHINKTKSDKYPKTCTRKESLFNMPYVQDSKLGFVVKSVMTIAW
GLHNIYQKVCIVKNFTLEGCANFILRNGKLLLDEMIDLKFSAYDNETVRF
DSKGDPPGRYDIMNYQYGYNEKTNRTEYHYERIGSWKENHLVIEDHLIQW
PKSEENERNNQTSIKSHCSDPCKFDQIRIFRERKKCCWTCKDCSENEITN
KTFHNESCSSCKKGFRPNSDRSNCSEIPAIFLKWSDASVIVAIIFSIVGL
IITIIIVGIFAKYNNTPVVKSCTRELMYVILVGVALSYLTTFPLVWKPTT
FSCLLSRIMPGLSFSLIFGSLVTKTNRICRILSISKKKIIRRKGRFLTTT
AQIVIVFLLNVVEIIIISVMIWHNFPKSKSDYSVAATVRLICNTESQDLF
ISMGFDAVLVCFCTWYAFKTRNLPENFNEAKFIGFTMYTTCIIWIGLVVI
YLSTNLKEISLCFAMHFTATICIVFLFLPKLYIILFKPERNERSAFTTTT
EIRCHIGSGKTEYECSKNKSDKRKSNSNANFRYLSDERKSSMFRSQTYLL
DRTNFI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0060078regulation of postsynaptic membrane potential
GO:0099566regulation of postsynaptic cytosolic calcium ion concentration
GO:0007186G-protein coupled receptor signaling pathway
GO:0000185activation of MAPKKK activity
GO:0002029desensitization of G-protein coupled receptor protein signaling pathway
GO:0006355regulation of transcription, DNA-templated
GO:0006468protein phosphorylation
GO:0007165signal transduction
GO:0007196adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway
GO:0007205protein kinase C-activating G-protein coupled receptor signaling pathway
GO:0007206phospholipase C-activating G-protein coupled glutamate receptor signaling pathway
GO:0007216G-protein coupled glutamate receptor signaling pathway
GO:0007268chemical synaptic transmission
GO:0040013negative regulation of locomotion
GO:0048015phosphatidylinositol-mediated signaling
GO:0048170positive regulation of long-term neuronal synaptic plasticity
GO:0051482positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
GO:0051966regulation of synaptic transmission, glutamatergic
GO:0099553trans-synaptic signaling by endocannabinoid, modulating synaptic transmission
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR038550GPCR_3_9-Cys_sf
IPR000337GPCR_3
IPR000162GPCR_3_mtglu_rcpt
IPR001828ANF_lig-bd_rcpt
IPR017978GPCR_3_C
IPR011500GPCR_3_9-Cys_dom
IPR017979GPCR_3_CS
IPR028082Peripla_BP_I
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005622intracellular
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0014069postsynaptic density
GO:0016020membrane
GO:0042734presynaptic membrane
GO:0043197dendritic spine
GO:0043198dendritic shaft
GO:0045211postsynaptic membrane
GO:0097449astrocyte projection
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0001639PLC activating G-protein coupled glutamate receptor activity
GO:0004871signal transducer activity
GO:0005515protein binding
GO:0005516calmodulin binding
GO:0008066glutamate receptor activity
GO:0030165PDZ domain binding
GO:0031687A2A adenosine receptor binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000337GPCR, family 3PRINTSPR00248GPCRMGRcoord: 778..799
score: 62.78
coord: 130..156
score: 50.23
coord: 163..182
score: 53.12
coord: 755..778
score: 50.65
coord: 616..638
score: 48.37
coord: 661..682
score: 44.89
coord: 702..725
score: 22.92
coord: 28..40
score: 48.56
coord: 61..76
score: 38.28
coord: 198..215
score: 36.11
coord: 182..198
score: 32.72
coord: 76..95
score: 50.0
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 71..466
e-value: 5.5E-68
score: 229.7
IPR017978GPCR family 3, C-terminalPFAMPF000037tm_3coord: 600..833
e-value: 4.8E-52
score: 177.0
IPR017978GPCR family 3, C-terminalPROSITEPS50259G_PROTEIN_RECEP_F3_4coord: 588..850
score: 53.407
IPR038550GPCR, family 3, nine cysteines domain superfamilyGENE3DG3DSA:2.10.50.30coord: 513..591
e-value: 2.0E-17
score: 64.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 180..472
e-value: 4.5E-125
score: 419.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 29..459
e-value: 4.5E-125
score: 419.5
NoneNo IPR availablePANTHERPTHR24060:SF30METABOTROPIC GLUTAMATE RECEPTOR 5coord: 18..882
NoneNo IPR availablePANTHERPTHR24060METABOTROPIC GLUTAMATE RECEPTORcoord: 18..882
NoneNo IPR availableCDDcd152857tmC_mGluR_group1coord: 590..836
e-value: 7.31953E-116
score: 351.939
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.487
NoneNo IPR availableTMHMMTMhelixcoord: 813..835
NoneNo IPR availableTMHMMTMhelixcoord: 624..646
NoneNo IPR availableTMHMMTMhelixcoord: 781..803
NoneNo IPR availableTMHMMTMhelixcoord: 661..683
NoneNo IPR availableTMHMMTMhelixcoord: 589..611
NoneNo IPR availableTMHMMTMhelixcoord: 703..725
NoneNo IPR availableTMHMMTMhelixcoord: 749..768
IPR011500GPCR, family 3, nine cysteines domainPFAMPF07562NCD3Gcoord: 515..567
e-value: 1.9E-10
score: 40.5
IPR017979GPCR, family 3, conserved sitePROSITEPS00981G_PROTEIN_RECEP_F3_3coord: 777..787
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 28..501