HTH CENPB-type domain-containing protein

Overview
NameHTH CENPB-type domain-containing protein
Smed IDSMED30000201
Length (bp)3202
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HTH CENPB-type domain-containing protein (SMED30000201) t-SNE clustered cells

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30000201) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HTH CENPB-type domain-containing protein (SMED30000201) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HTH CENPB-type domain-containing protein (SMED30000201) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000201

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30000201SMESG000073620.1 dd_Smed_v4_6327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000201SMESG000073620.1 dd_Smed_v4_6327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 108.612 bits (270), Expect = 2.291e-40
Identity = 73/209 (34.93%), Postives = 109/209 (52.15%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKR--VKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            +KR+  + K+KL  + +L++G    QLA   GI E+T+R  + N+ KI +  +   D   L  KR  +K +    LD A+ +WF Q R +G PISGPI   + E F   + G D  F  S GWL RF +RH+  +I +  E  + D+ A   +    + F+E      +Q+YN DE GL +K LP+R    K       G+K   +RVT
Sbjct:    5 RKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASS-SDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL-GMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIK-GKCTVPGHKSIEERVT 210          

HSP 2 Score: 79.337 bits (194), Expect = 2.291e-40
Identity = 51/144 (35.42%), Postives = 83/144 (57.64%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKIL----SVVIAR*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNN 2718
            ++ C N +G +KL+  ++GK+K PR F   + ++LP  Y +   AW + ++F  WF K FV  VR +LR   L+EKA+LL+DN P H    +L      + A  K+      ++ IQP +QGVI+  K+NYR  +++  + + N
Sbjct:  211 IMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFA--KYLPPNVASL-IQPSDQGVIATMKRNYRAGLLQNNLEEGN 351          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 103.99 bits (258), Expect = 3.497e-37
Identity = 66/207 (31.88%), Postives = 112/207 (54.11%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGL-QVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRV 2297
            +KR+  + K+KL  + +L+ G    +L+   GI EST+R  K N+ +I +  N  +   G+ + K +KS++   LD  + +WF Q + +G+P+SG I   Q + F   + G +  F AS+GWL RF +RH   +    G     D+ AA  +    + F+E+     +Q+Y  D+ GL +K LP+RTL  +T +    G +  R+R+
Sbjct:    5 RKRVVLTIKDKLDIIKKLEEGISFKKLSVVYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSMKSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQAKFFFDAL-GMEGDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLET-DQSTSGCRSSRERI 209          

HSP 2 Score: 73.1738 bits (178), Expect = 3.497e-37
Identity = 50/142 (35.21%), Postives = 81/142 (57.04%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR--*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNN 2718
            ++ C N +G +KL   ++GK+K PR F   ++ +LP  Y +   AW   +VF  WF K FV  V+ HL+   L EKA+LL+D  PA    ++LS    R   K+     T++ IQP++QGV++  K+ YR  +++  + + N
Sbjct:  211 IMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSL-IQPMSQGVLATVKRYYRAGLLQKYMDEGN 351          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD2 (tigger transposable element derived 2 [Source:HGNC Symbol;Acc:HGNC:18333])

HSP 1 Score: 103.99 bits (258), Expect = 3.497e-37
Identity = 66/207 (31.88%), Postives = 112/207 (54.11%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGL-QVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRV 2297
            +KR+  + K+KL  + +L+ G    +L+   GI EST+R  K N+ +I +  N  +   G+ + K +KS++   LD  + +WF Q + +G+P+SG I   Q + F   + G +  F AS+GWL RF +RH   +    G     D+ AA  +    + F+E+     +Q+Y  D+ GL +K LP+RTL  +T +    G +  R+R+
Sbjct:    5 RKRVVLTIKDKLDIIKKLEEGISFKKLSVVYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSMKSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQAKFFFDAL-GMEGDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLET-DQSTSGCRSSRERI 209          

HSP 2 Score: 73.1738 bits (178), Expect = 3.497e-37
Identity = 50/142 (35.21%), Postives = 81/142 (57.04%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR--*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNN 2718
            ++ C N +G +KL   ++GK+K PR F   ++ +LP  Y +   AW   +VF  WF K FV  V+ HL+   L EKA+LL+D  PA    ++LS    R   K+     T++ IQP++QGV++  K+ YR  +++  + + N
Sbjct:  211 IMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSL-IQPMSQGVLATVKRYYRAGLLQKYMDEGN 351          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD5 (tigger transposable element derived 5 [Source:HGNC Symbol;Acc:HGNC:18336])

HSP 1 Score: 124.02 bits (310), Expect = 2.256e-36
Identity = 76/224 (33.93%), Postives = 113/224 (50.45%), Query Frame = 3
Query: 1686 RMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDK--------KAANSYP---------FWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKK--RRDRVT 2300
            R ++S K+KL A++++K G+RQ  + RD G+   TLRGW  +E K+R     L   +G Q K+++ A++  +D A+Y WF+  R  GVP+SGP+++AQ E F R I G +  FKAS+GW  R+ KRH  S     GE              K   + P                 EG Y  +Q+Y+    GL +K+LP +       +    G  +  R DRVT
Sbjct:   53 RKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLEQLGGEVGTQRKKMRLANEEEIDRAVYAWFLALRQHGVPLSGPLIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRFYGEAGPPAPSPAPGPPVKEEPALPSGAGPLPDRAPAPPPPAEGGYGDEQIYSASVTGLYWKLLPEQAAPPGAGDPGAGGCGRRWRGDRVT 276          

HSP 2 Score: 50.447 bits (119), Expect = 2.256e-36
Identity = 25/70 (35.71%), Postives = 36/70 (51.43%), Query Frame = 1
Query: 2281 RGETG*LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDV 2490
            RG+   +L   N +GS+KL+PL+IG+   P    H N    P  Y  S +AW +  +   WF + FV  V
Sbjct:  271 RGDRVTVLLAANLTGSHKLKPLVIGRLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEFVPGV 340          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Match: TIGD5 (tigger transposable element derived 5 [Source:HGNC Symbol;Acc:HGNC:18336])

HSP 1 Score: 124.02 bits (310), Expect = 2.256e-36
Identity = 76/224 (33.93%), Postives = 113/224 (50.45%), Query Frame = 3
Query: 1686 RMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDK--------KAANSYP---------FWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKK--RRDRVT 2300
            R ++S K+KL A++++K G+RQ  + RD G+   TLRGW  +E K+R     L   +G Q K+++ A++  +D A+Y WF+  R  GVP+SGP+++AQ E F R I G +  FKAS+GW  R+ KRH  S     GE              K   + P                 EG Y  +Q+Y+    GL +K+LP +       +    G  +  R DRVT
Sbjct:   53 RKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLEQLGGEVGTQRKKMRLANEEEIDRAVYAWFLALRQHGVPLSGPLIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRFYGEAGPPAPSPAPGPPVKEEPALPSGAGPLPDRAPAPPPPAEGGYGDEQIYSASVTGLYWKLLPEQAAPPGAGDPGAGGCGRRWRGDRVT 276          

HSP 2 Score: 50.447 bits (119), Expect = 2.256e-36
Identity = 25/70 (35.71%), Postives = 36/70 (51.43%), Query Frame = 1
Query: 2281 RGETG*LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDV 2490
            RG+   +L   N +GS+KL+PL+IG+   P    H N    P  Y  S +AW +  +   WF + FV  V
Sbjct:  271 RGDRVTVLLAANLTGSHKLKPLVIGRLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEFVPGV 340          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Match: adpr-1 (ADiPose (Drosophila obesity gene) Related [Source:UniProtKB/TrEMBL;Acc:Q4W5Q8])

HSP 1 Score: 56.6102 bits (135), Expect = 7.327e-8
Identity = 49/192 (25.52%), Postives = 87/192 (45.31%), Query Frame = 1
Query:   73 TENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVN-STNKELNVFYKHSGPTLNIATFE-DEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSL---SAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN 630
             ++L+ F  LEGH GCVNT+ W+K+G  + SG DD  ++I      W        ++ +   +  N+ + +F+    +Q +V+ +    + L D+  ST K+    ++  G    I T E D    +A    D     FD R  N    ++           ++A+       I +G  ++ VR++D+R LN
Sbjct:   28 VDSLESFHMLEGHSGCVNTLRWNKTGALLASGSDDRNVKI------WKS---GREIHNLVTGHEGNVFAVEFLQNSGDQKLVTGAADRVVALHDIEASTCKK----WELDGRVKRICTVEHDPTLFWAAVECDNGVQQFDTRTENPEVIIRHTADREFHDAKSVAVSEARPNLIVVGFDETAVRLYDRRNLN 206          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Match: eif-3.I (Eukaryotic translation initiation factor 3 subunit I [Source:UniProtKB/Swiss-Prot;Acc:Q965S8])

HSP 1 Score: 48.1358 bits (113), Expect = 7.466e-7
Identity = 19/41 (46.34%), Postives = 28/41 (68.29%), Query Frame = 1
Query:   91 FEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDW 213
            F + +GH G +NT+AW  SGT I +GG+D  +RI +F  D+
Sbjct:   26 FARFKGHFGPINTMAWHPSGTIIATGGEDGYIRIQEFDEDY 66          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Match: adp (gene:FBgn0000057 transcript:FBtr0340288)

HSP 1 Score: 82.8037 bits (203), Expect = 8.246e-16
Identity = 64/212 (30.19%), Postives = 95/212 (44.81%), Query Frame = 1
Query:   61 SASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGS-IFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESN------NIPFLKMNLPCSLS-----AIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFILC 660
            S +Y + L+    L GH GCVN + W   G  + SG DD  + I      WD P+ K  V+ I   +  N+ S KF+P  NN IV+       I++ D+N  N+ L     H      +AT +D    F +A  D      DIRE +       I    +NL   L       +AI+P  +  +A+G +D   RV+D+R L  +  +    C
Sbjct:   50 SPAYVDRLEQEAVLVGHEGCVNCLEWTTDGMWLASGSDDYRVMI------WD-PFRKKLVHVIRTKHLGNVFSVKFLPKTNNSIVATCAADKFIYVYDINDPNETLFSCICHFSRAKRLATAQDSPHVFWSAGEDGCILQLDIREPHRCRPEEGIGVRLLNLHDQLENTEAKCLAINPRRTEYLAVGTNDPFARVYDRRKLPSTNGNGLSAC 254          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Match: adp (gene:FBgn0000057 transcript:FBtr0086744)

HSP 1 Score: 82.8037 bits (203), Expect = 8.246e-16
Identity = 64/212 (30.19%), Postives = 95/212 (44.81%), Query Frame = 1
Query:   61 SASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGS-IFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESN------NIPFLKMNLPCSLS-----AIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFILC 660
            S +Y + L+    L GH GCVN + W   G  + SG DD  + I      WD P+ K  V+ I   +  N+ S KF+P  NN IV+       I++ D+N  N+ L     H      +AT +D    F +A  D      DIRE +       I    +NL   L       +AI+P  +  +A+G +D   RV+D+R L  +  +    C
Sbjct:   50 SPAYVDRLEQEAVLVGHEGCVNCLEWTTDGMWLASGSDDYRVMI------WD-PFRKKLVHVIRTKHLGNVFSVKFLPKTNNSIVATCAADKFIYVYDINDPNETLFSCICHFSRAKRLATAQDSPHVFWSAGEDGCILQLDIREPHRCRPEEGIGVRLLNLHDQLENTEAKCLAINPRRTEYLAVGTNDPFARVYDRRKLPSTNGNGLSAC 254          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Match: CG8001 (gene:FBgn0035268 transcript:FBtr0072774)

HSP 1 Score: 61.2326 bits (147), Expect = 5.099e-9
Identity = 61/227 (26.87%), Postives = 97/227 (42.73%), Query Frame = 1
Query:   16 WRFMNSRSKSSF---YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKD-HVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNSTNKELNV--FYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPC-----------SLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 642
            WR  ++ S SSF   Y+ S    E + +   L  H GCVN++ ++++G  I SG DD  + +      WD  W K+  ++     ++ NI   KF+       IVS+S+ G +    +  +   +     Y HS     I           +A  D     FD+R SN    +   + C            L +IA HP    +  + GSD  +RV+DKR L K+ +
Sbjct:  292 WRGGHT-SASSFGQGYYGSRQVVEQMTLLSSLNVHHGCVNSLNFNRAGDLICSGSDDLTIVV------WD--WAKEKQLHRFRSGHNMNIFQTKFIDSAGCLDIVSSSRDGQVRRSVIPPSGGVIKPIRLYTHSESVHKIIVVPHSRHELMSAGEDAAVKHFDLRASNAATTM---MRCVYNDENERGRVRLFSIAHHPYAP-EFCVSGSDDILRVYDKRNLAKAIH 505          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Match: CG8001 (gene:FBgn0035268 transcript:FBtr0334073)

HSP 1 Score: 61.2326 bits (147), Expect = 5.099e-9
Identity = 61/227 (26.87%), Postives = 97/227 (42.73%), Query Frame = 1
Query:   16 WRFMNSRSKSSF---YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKD-HVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNSTNKELNV--FYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPC-----------SLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 642
            WR  ++ S SSF   Y+ S    E + +   L  H GCVN++ ++++G  I SG DD  + +      WD  W K+  ++     ++ NI   KF+       IVS+S+ G +    +  +   +     Y HS     I           +A  D     FD+R SN    +   + C            L +IA HP    +  + GSD  +RV+DKR L K+ +
Sbjct:  292 WRGGHT-SASSFGQGYYGSRQVVEQMTLLSSLNVHHGCVNSLNFNRAGDLICSGSDDLTIVV------WD--WAKEKQLHRFRSGHNMNIFQTKFIDSAGCLDIVSSSRDGQVRRSVIPPSGGVIKPIRLYTHSESVHKIIVVPHSRHELMSAGEDAAVKHFDLRASNAATTM---MRCVYNDENERGRVRLFSIAHHPYAP-EFCVSGSDDILRVYDKRNLAKAIH 505          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Match: CG8001 (gene:FBgn0035268 transcript:FBtr0334074)

HSP 1 Score: 60.8474 bits (146), Expect = 5.535e-9
Identity = 61/227 (26.87%), Postives = 97/227 (42.73%), Query Frame = 1
Query:   16 WRFMNSRSKSSF---YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKD-HVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNSTNKELNV--FYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPC-----------SLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 642
            WR  ++ S SSF   Y+ S    E + +   L  H GCVN++ ++++G  I SG DD  + +      WD  W K+  ++     ++ NI   KF+       IVS+S+ G +    +  +   +     Y HS     I           +A  D     FD+R SN    +   + C            L +IA HP    +  + GSD  +RV+DKR L K+ +
Sbjct:  287 WRGGHT-SASSFGQGYYGSRQVVEQMTLLSSLNVHHGCVNSLNFNRAGDLICSGSDDLTIVV------WD--WAKEKQLHRFRSGHNMNIFQTKFIDSAGCLDIVSSSRDGQVRRSVIPPSGGVIKPIRLYTHSESVHKIIVVPHSRHELMSAGEDAAVKHFDLRASNAATTM---MRCVYNDENERGRVRLFSIAHHPYAP-EFCVSGSDDILRVYDKRNLAKAIH 500          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: dcaf6 (ddb1 and cul4 associated factor 6 [Source:ZFIN;Acc:ZDB-GENE-090206-2])

HSP 1 Score: 91.2781 bits (225), Expect = 4.122e-18
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 1
Query:   70 YTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNSTNKELN---VFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFI 654
            + + LK+   L  H GCVNT++W+ +G  ILSG DD  L I         P+ +     I   +  NI SAKFMP  N+ QIVS S  G IF      + +E+N    F  H G    I T  ++ + F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L       ++
Sbjct:   34 FVQRLKLEAVLNVHDGCVNTISWNDTGEYILSGSDDTNLVI-------TNPYNRKVKTTIRSGHRANIFSAKFMPHTNDQQIVSCSGDGIIFYTHTEKS-QEINRQCQFTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISICPLVPYYLAVGCSDSSVRIYDRRMLGTRATGNYM 230          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: dcaf8 (DDB1 and CUL4 associated factor 8 [Source:ZFIN;Acc:ZDB-GENE-070912-578])

HSP 1 Score: 77.411 bits (189), Expect = 5.191e-14
Identity = 59/230 (25.65%), Postives = 108/230 (46.96%), Query Frame = 1
Query:   16 WRFMNSRSKSSFYHDSASYT----------ENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVS-ASKCGSIFLVDVNSTNKELNV--FYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDI---RESNNIPFLKMN-LPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFI 654
            WR + S        DS  +           + L++  +LE H GCVNT+ ++ SGT++ SG DD  LR+   + DW +   +    E    +  N+  AKF+P   +  ++  ++ G I + ++++T +  N     +H G    +A   D   +F +A  D      D+   R +N +  +K       L  I ++P  ++  A+GG D  VR++D+R +N+  N+  +
Sbjct:  163 WRAIPSLRAREIGRDSQQFVRKVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDD--LRV--VIWDWAR---RKAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKRVAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDLRLDRPANKLVVVKEGEKKVGLYTIYVNPANTHHFAVGGRDQYVRIYDQRKINEHDNNGVL 385          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: dcaf8 (DDB1 and CUL4 associated factor 8 [Source:ZFIN;Acc:ZDB-GENE-070912-578])

HSP 1 Score: 77.411 bits (189), Expect = 5.191e-14
Identity = 59/230 (25.65%), Postives = 108/230 (46.96%), Query Frame = 1
Query:   16 WRFMNSRSKSSFYHDSASYT----------ENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVS-ASKCGSIFLVDVNSTNKELNV--FYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDI---RESNNIPFLKMN-LPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFI 654
            WR + S        DS  +           + L++  +LE H GCVNT+ ++ SGT++ SG DD  LR+   + DW +   +    E    +  N+  AKF+P   +  ++  ++ G I + ++++T +  N     +H G    +A   D   +F +A  D      D+   R +N +  +K       L  I ++P  ++  A+GG D  VR++D+R +N+  N+  +
Sbjct:  163 WRAIPSLRAREIGRDSQQFVRKVCGARGLVQRLELQGRLERHTGCVNTLHFNPSGTRLASGSDD--LRV--VIWDWAR---RKAELEFDSGHKSNVFQAKFLPHSGDSTLAMCARDGQIRVAELSATQRCKNTKRVAQHKGAAHKLALEPDSPCSFLSAGEDAVVFGIDLRLDRPANKLVVVKEGEKKVGLYTIYVNPANTHHFAVGGRDQYVRIYDQRKINEHDNNGVL 385          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Match: wdtc1 (WD and tetratricopeptide repeats 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3224])

HSP 1 Score: 69.707 bits (169), Expect = 1.272e-11
Identity = 49/199 (24.62%), Postives = 95/199 (47.74%), Query Frame = 1
Query:   52 YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLP------CSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN 630
            YH +  + + L +  +L+GH GCVN + W++ G  + SG DD      Q    WD P+    +  +   ++ NI S KF+P  +++I+      +   V   +  + +++F  H+     IAT       F +A+ D     +D+RES+    + ++L            +A++P  +  +A+G +   VR++D R ++
Sbjct:   33 YHVTDPFIKRLGLEAELQGHSGCVNCLEWNEKGDLLASGSDD------QHAIIWD-PFRHSKLITMHTGHAANIFSVKFLPHSDDRILITGAADTKVHVHDVTAKETIHMFSDHTNRVKRIATAPMWPNTFWSAAEDGLIRQYDLRESSKRSDVLIDLTEYCGQLVEAKCLAVNPRDNNYLAVGANGPFVRLYDIRMIH 224          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: apmapl (adipocyte plasma membrane associated protein LIKE [Source:Xenbase;Acc:XB-GENE-5754317])

HSP 1 Score: 126.716 bits (317), Expect = 8.273e-43
Identity = 60/154 (38.96%), Postives = 99/154 (64.29%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSG--EIRSTDKKAANSYP 2135
            K+ +++S K+KL A++++KNG+RQ  ++RD G+   TLRGW  +E K+R   + L   +G   K+++ A++  +D A+Y WF+  R +G+P+SGPI++AQ E F + I G++  FKAS+GW  R+ KRH  S   + G  E+R T+      +P
Sbjct:    7 KQILTYSIKDKLEAIERVKNGERQASVSRDFGVPGGTLRGWLKDEQKLRWFLDQLGGDVGTHRKKMRLANEEEIDRAVYSWFISLRQQGIPLSGPIIQAQAEAFAKQIYGDECTFKASHGWFWRWQKRHGISSQRIYGESEVRQTEMDPVIIFP 160          

HSP 2 Score: 69.707 bits (169), Expect = 8.273e-43
Identity = 55/168 (32.74%), Postives = 87/168 (51.79%), Query Frame = 1
Query: 2230 IAPSQLRLPIINEKVIRRGETG*LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR*K-FRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNNGSVD 2730
            I P Q   P+ +      G+   +L   N +GS+KL+PL++GK + P    H N    P  Y  S NAW    +  +WF + FV  V+ +L++  L++KA+LL++  P     + L       +    S+ T  +I  ++QGVIS FKQ YRR ++K MV  ++   D
Sbjct:  158 IFPEQPNTPVADSGY---GDEVTVLLAANLTGSHKLKPLVVGKLRDPPSLRHHNQDKFPAVYHYSRNAWVTQELLREWFLEEFVPAVKRYLKRCCLQQKAVLLVNQCPGKPPEEDLQTADGNIRVLFLSKTTRSKIPSMDQGVISSFKQLYRRELLKLMVSCDSSPSD 322          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:Xenbase;Acc:XB-GENE-1014042])

HSP 1 Score: 83.5741 bits (205), Expect = 2.068e-27
Identity = 60/213 (28.17%), Postives = 107/213 (50.23%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSL------PNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            +KR+S S K+K+  L  L+NG     L    GI  ST+   K  + K+ +       P+++ D      K +  A +  +D  L +W  Q R E  P+S  ++ AQ +KF+ L+N   +  + S+GW  +F KR+  S + ++GE  S +   A+++   L   + +   +A+QVYN  +  L ++ LP + +AT        G +  ++R+T
Sbjct:  182 RKRVSLSIKDKVTLLQDLENGASVKSLCDKYGIGTSTIYDLKKQKDKLLTFYSNSDAPDLMADR-----KTLHQAKNVSVDKVLMEWIRQRRRENFPLSRSLIMAQAKKFHVLLNI-STPCEYSSGWYGKFKKRNGLSILSINGEKASEEYNVADNFVKKLNKLVSDEHLSAEQVYNAAKASLFWRHLPQKLVAT-AQKPPSSGLEDPKERLT 387          

HSP 2 Score: 60.8474 bits (146), Expect = 2.068e-27
Identity = 46/148 (31.08%), Postives = 74/148 (50.00%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXX--XXXXXXXXXXXXXXMDNYPAHHQRKIL------SVVIAR*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNN 2718
            +L C N +G++K R L+IGKS+ PR F  V +   P  Y  +  A     +F DWF   FV + RA      L  + K +L++D+ P H   + L      +V +           T  IQP++QG++ +FK NY+   ++ M+ + N
Sbjct:  388 VLACSNAAGTHKARLLVIGKSRNPRAFKGVRV--FPVTYTANKQAGITREIFQDWFENHFVPEARAHCMSVGLSQDAKVMLILDHCPTHPSAEFLVKDNVFAVCLP-------PDCTSFIQPLDQGILRLFKSNYKSEFLQRMLTECN 526          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000046714.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460367.1:582927:585046:-1 gene:ENSXETG00000018570.1 transcript:ENSXETT00000046714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 3.672e-25
Identity = 69/199 (34.67%), Postives = 96/199 (48.24%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLK--NGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDN---VLDSALYQWFVQARFEGVPISGPILKAQGEKF-NRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAA-----NSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLA 2243
            KKR S S +EK+  LD+    +G R   LA++LGI  STL       +K R+      D  G Q K+ K  + +    ++  L +WF       VPISG +L+ +      RL  G D+ F ASNGW+DRF KR+      V GE +S D         N  P +L     EG Y    ++N DE GL + +LP +T  
Sbjct:    6 KKRKSLSLEEKIAILDRADSYHGTR-VALAKELGIPVSTLGTI----IKQRASTEGSADKCGPQAKKRKYVTQSKYEQMEKLLQEWFAGLHASNVPISGIMLREKAVHIATRL--GIDN-FTASNGWIDRFKKRYNVVYKAVCGESKSVDIDTVTNWKTNQLPCYL-----EG-YELKNIFNTDETGLFFNVLPGKTFC 190          

HSP 2 Score: 58.151 bits (139), Expect = 3.672e-25
Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFH 2469
            +LF  N  GS KL+PL+IGKS  PRCF +VN  +LP +Y  +  AW  T +F +  H
Sbjct:  208 VLFTTNADGSEKLKPLVIGKSVKPRCFKNVN--TLPTNYTANTKAWMTTKLFEEQMH 262          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:733780])

HSP 1 Score: 99.7525 bits (247), Expect = 1.745e-21
Identity = 68/205 (33.17%), Postives = 100/205 (48.78%), Query Frame = 1
Query:   46 SFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNS---TNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN 630
            S Y     + + LK+   L  H GCVN+++W  +G  ILSG DD  L I         P+ K  +  I   +  NI SAKF+P+ N+ QI+S S  G IF  D+     TN++   F  H G    I T  ++ + F +   D T   FD R   +         + +N   + ++IAI P   Y +A+G SDS VR++D+R L 
Sbjct:   27 SNYLGRREFVQRLKLEATLNIHDGCVNSISWGSTGEYILSGSDDTTLVITN-------PYNKKVLTRIRSGHRANIFSAKFLPLTNDKQIISCSGDGVIFFTDIEKDADTNRQCQ-FTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDTRTKTSCTKEDCKDDILINCRRAATSIAICPTAPYYLAVGCSDSSVRIYDRRMLG 223          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:733780])

HSP 1 Score: 99.7525 bits (247), Expect = 1.193e-20
Identity = 66/196 (33.67%), Postives = 98/196 (50.00%), Query Frame = 1
Query:   70 YTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNS---TNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYL 627
            + + LK+   L  H GCVN+++W  +G  ILSG DD  L I         P+ K  +  I   +  NI SAKF+P+ N+ QI+S S  G IF  D+     TN++   F  H G    I T  ++ + F +   D T   FD R   +         + +N   + ++IAI P   Y +A+G SDS VR++D+R L
Sbjct:   30 FVQRLKLEATLNIHDGCVNSISWGSTGEYILSGSDDTTLVI-------TNPYNKKVLTRIRSGHRANIFSAKFLPLTNDKQIISCSGDGVIFFTDIEKDADTNRQCQ-FTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDTRTKTSCTKEDCKDDILINCRRAATSIAICPTAPYYLAVGCSDSSVRIYDRRML 217          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Tigd5 (tigger transposable element derived 5 [Source:MGI Symbol;Acc:MGI:2145902])

HSP 1 Score: 142.895 bits (359), Expect = 8.103e-42
Identity = 81/224 (36.16%), Postives = 121/224 (54.02%), Query Frame = 3
Query: 1686 RMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAA----------------NSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRR---DRVT 2300
            R ++S K+KL A++++K G+RQ  + RD G+   TLRGW  +E K+R   + L   +G Q K+++ A++  +D A+Y WF+  R  GVP+SGP+++AQ E F R I G +  FKAS+GW  R+ KRH  S   + GE  S     A                +  P  L     EG Y  +Q+YN +  GL +++LP +     T ++K  G   RR   DRVT
Sbjct:   63 RKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLDQLGGEVGTQRKKMRLANEEEIDRAVYSWFLTLRQHGVPLSGPVIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAESPVAGPAPVKEEPAQSPGAVLVPDGAPATLPH--SEGGYGDEQIYNANVTGLYWRLLPEQASTPGTGDSKEPGGCSRRWRSDRVT 284          

HSP 2 Score: 49.2914 bits (116), Expect = 8.103e-42
Identity = 23/64 (35.94%), Postives = 33/64 (51.56%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDV 2490
            +L   N +GS+KL+PL+IG+   P    H N    P  Y  S +AW +  +   WF + FV  V
Sbjct:  285 VLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEFVPGV 348          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 109.383 bits (272), Expect = 1.992e-40
Identity = 69/192 (35.94%), Postives = 104/192 (54.17%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKR--VKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATK 2249
            +KR+  + K+KL  + +L++G    QLA   GI E+T+R  + N+ KI +  +   D   L  KR  +K +    LD A+ +WF Q R +G PISGPI   + E F   + G D  F  S GWL RF +RH+  +I +  E  + D+ A   +    + F+E+     +Q+YN DE GL +K LP+RT   K
Sbjct:    5 RKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASS-SDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL-GMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIK 194          

HSP 2 Score: 78.1814 bits (191), Expect = 1.992e-40
Identity = 49/132 (37.12%), Postives = 77/132 (58.33%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKIL----SVVIAR*KFRTSRKTTIEIQPINQGVISVFKQNYR 2682
            ++ C N +G +KL+  ++GK++ PR F   + ++LP  Y +   AW + ++F  WF K FV  VR +LR   L+EKA+LL+DN P H    +L      + A  K+      ++ IQP+ QGVI+  K+NYR
Sbjct:  211 VMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFA--KYLPPNVASL-IQPLGQGVIAAMKRNYR 339          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Tigd2 (tigger transposable element derived 2 [Source:MGI Symbol;Acc:MGI:1915390])

HSP 1 Score: 105.531 bits (262), Expect = 2.308e-38
Identity = 68/207 (32.85%), Postives = 111/207 (53.62%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGL-QVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRV 2297
            +KR+  + K+KL  + +L+ G    +L+   GI EST+R  K N+ +I +  N  +   G+ + K +KS++   LD  + +WF Q + +G+P+SG I   Q   F   + G +  F AS+GWL RF +RH   +    G     D+ AA+ +    + F+E      +Q+Y  D+ GL +K LP RTLA  T  +  E Y+  R+R+
Sbjct:    5 RKRVVLTIKDKLDIIKKLEEGNSFKKLSVLYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSMKSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQARFFFDAL-GMEGDFNASSGWLTRFKQRHGIPKAAGKGTKLKGDETAASEFCGNFQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCE-YRTSRERI 209          

HSP 2 Score: 75.485 bits (184), Expect = 2.308e-38
Identity = 51/142 (35.92%), Postives = 82/142 (57.75%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR--*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNN 2718
            ++ C N +GS+KL   ++GK+K PR F   ++ +LP  Y +  +AW   +V   WF K FV  V+ HL+   L EKA+LL+D   AH   ++LS    R   K+     T++ IQP++QGV++  K+ YR  +I+  + + N
Sbjct:  211 IMCCANATGSHKLNLCVVGKAKRPRAFKGTDLSNLPVTYFSQKSAWIEPSVLKQWFEKCFVPQVQKHLKSKGLREKAVLLLDFPAAHPAEELLSSDDGRIIVKYLPPNVTSL-IQPMSQGVLTTVKRYYRAGLIQKYMDEGN 351          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 92.4337 bits (228), Expect = 8.347e-32
Identity = 60/209 (28.71%), Postives = 107/209 (51.20%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKR-VKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLIN-GEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            +KR+  + KEK+    +L+ G+ +  L ++  +  STL   K ++ ++       +    L+ +R + +     LD  LY+WF+  R EG+P+SGP+L  + + F + +   E   F  S GWL RF  RH   ++  S E ++ D +AA  +  + +    E   + +QVY+ DE GL ++ LPN      T  +    +K+ +DR+T
Sbjct:   15 RKRVVLTLKEKIDICTRLERGESRKALMQEYNVGMSTLYDIKAHKAQLLRFFASSDSRQALEQRRTLHTPKLEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFYKQMRLTEPCVF--SGGWLWRFKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLVWRCLPNSAPDDGTVPH----FKQGKDRLT 217          

HSP 2 Score: 66.2402 bits (160), Expect = 8.347e-32
Identity = 46/125 (36.80%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXX--XXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR*KFRTSRKTTIEIQPINQGVISVF 2667
            +L C N +GS++++PL IGK   PR F    +  LP  Y    NAW +  +F DWFH  FV  VR       L  + KA+LL+D+  AH Q   L        F  S  T++ +QP  QG+   F
Sbjct:  218 VLMCANATGSHRIKPLAIGKGGGPRAFR--GIQHLPIAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDHSRAHSQESELVSENVFTIFLPSSVTSL-LQPTEQGIRRAF 339          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Match: Tigd4 (tigger transposable element derived 4 [Source:MGI Symbol;Acc:MGI:2685264])

HSP 1 Score: 88.9669 bits (219), Expect = 1.443e-28
Identity = 62/196 (31.63%), Postives = 100/196 (51.02%), Query Frame = 3
Query: 1677 VKKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRH--AFSQILVSGEIRSTDKKAA---NSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATK 2249
            VKK+ S S +EK+  ++ +++GK++ ++A + GI +++L     N+ K+      L      + KR+++A    L+ AL +W+  A+   VP++GP+L+ +   F + +   D  FK SNGWLDRF  R+   F    V     S D       N  P++L        Y    V+N  E GL Y+MLP  T A K
Sbjct:   15 VKKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLR--FDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQKLGHND--FKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPSTVWYQNVLPYYLND------YHPKNVFNVKETGLLYRMLPTNTFAFK 200          

HSP 2 Score: 58.5362 bits (140), Expect = 1.443e-28
Identity = 48/159 (30.19%), Postives = 73/159 (45.91%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKIL-SVVIAR*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNNGSVDQSLVLLTLKEVCHF 2772
            L    N  GS KL  L+IGK++APRCF  +   SLP +Y  +  AW    +F  W  K          +    + + ++ +D+ PAH + K L S+ +A   F  S  ++     +NQGVI   K  YR  +IK  +     S + +  LL   +  H 
Sbjct:  216 LALGTNMDGSEKLPLLIIGKNRAPRCFKGIK--SLPVYYEANRTAWMTAAIFEQWMQK-------LDEKFQAQKRRVVIFVDSCPAHPEVKNLKSIELA---FFPSCLSS-GFAAMNQGVIKSLKIKYRHCLIKKFLSSVESSKEFTFSLLDAVDTLHL 361          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|B1WC39|TIGD5_RAT (Tigger transposable element derived 5 OS=Rattus norvegicus OX=10116 GN=Tigd5 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.537e-41
Identity = 79/222 (35.59%), Postives = 122/222 (54.95%), Query Frame = 3
Query: 1686 RMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAA-----NSYPFWLKMFLE---------EGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRR---DRVT 2300
            R ++S K+KL A++++K G+RQ  + RD G+   TLRGW  +E K+R   + L   +G Q K+++ A++  +D A+Y WF+  R  GVP+SGP+++AQ E F R I G +  FKAS+GW  R+ KRH  S   + GE        A      + P    + L+         EG Y  +Q+YN +  GL +++LP +     T +++  G   RR   DRVT
Sbjct:   62 RKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLDQLGGEVGTQRKKMRLANEEEIDRAVYSWFLTLRQHGVPLSGPVIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAEPPVAGPAPVKEEPAQPSSAGLLLDGTPATLPHSEGGYGDEQIYNANVTGLYWRLLPEQNATPGTGDSREPGECSRRWCSDRVT 283          

HSP 2 Score: 49.2914 bits (116), Expect = 4.537e-41
Identity = 23/64 (35.94%), Postives = 33/64 (51.56%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDV 2490
            +L   N +GS+KL+PL+IG+   P    H N    P  Y  S +AW +  +   WF + FV  V
Sbjct:  284 VLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEFVPGV 347          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q499M4|TIGD5_MOUSE (Tigger transposable element derived 5 OS=Mus musculus OX=10090 GN=Tigd5 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.969e-41
Identity = 81/224 (36.16%), Postives = 121/224 (54.02%), Query Frame = 3
Query: 1686 RMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAA----------------NSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRR---DRVT 2300
            R ++S K+KL A++++K G+RQ  + RD G+   TLRGW  +E K+R   + L   +G Q K+++ A++  +D A+Y WF+  R  GVP+SGP+++AQ E F R I G +  FKAS+GW  R+ KRH  S   + GE  S     A                +  P  L     EG Y  +Q+YN +  GL +++LP +     T ++K  G   RR   DRVT
Sbjct:   63 RKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLDQLGGEVGTQRKKMRLANEEEIDRAVYSWFLTLRQHGVPLSGPVIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAESPVAGPAPVKEEPAQSPGAVLVPDGAPATLPH--SEGGYGDEQIYNANVTGLYWRLLPEQASTPGTGDSKEPGGCSRRWRSDRVT 284          

HSP 2 Score: 49.2914 bits (116), Expect = 4.969e-41
Identity = 23/64 (35.94%), Postives = 33/64 (51.56%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDV 2490
            +L   N +GS+KL+PL+IG+   P    H N    P  Y  S +AW +  +   WF + FV  V
Sbjct:  285 VLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEFVPGV 348          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y4A0|JERKL_HUMAN (Jerky protein homolog-like OS=Homo sapiens OX=9606 GN=JRKL PE=2 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.018e-39
Identity = 73/209 (34.93%), Postives = 109/209 (52.15%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKR--VKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            +KR+  + K+KL  + +L++G    QLA   GI E+T+R  + N+ KI +  +   D   L  KR  +K +    LD A+ +WF Q R +G PISGPI   + E F   + G D  F  S GWL RF +RH+  +I +  E  + D+ A   +    + F+E      +Q+YN DE GL +K LP+R    K       G+K   +RVT
Sbjct:    5 RKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASS-SDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL-GMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIK-GKCTVPGHKSIEERVT 210          

HSP 2 Score: 79.337 bits (194), Expect = 1.018e-39
Identity = 51/144 (35.42%), Postives = 83/144 (57.64%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKIL----SVVIAR*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNN 2718
            ++ C N +G +KL+  ++GK+K PR F   + ++LP  Y +   AW + ++F  WF K FV  VR +LR   L+EKA+LL+DN P H    +L      + A  K+      ++ IQP +QGVI+  K+NYR  +++  + + N
Sbjct:  211 IMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFA--KYLPPNVASL-IQPSDQGVIATMKRNYRAGLLQNNLEEGN 351          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|B2RRL2|JERKL_MOUSE (Jerky protein homolog-like OS=Mus musculus OX=10090 GN=Jrkl PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.222e-39
Identity = 69/192 (35.94%), Postives = 104/192 (54.17%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKR--VKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATK 2249
            +KR+  + K+KL  + +L++G    QLA   GI E+T+R  + N+ KI +  +   D   L  KR  +K +    LD A+ +WF Q R +G PISGPI   + E F   + G D  F  S GWL RF +RH+  +I +  E  + D+ A   +    + F+E+     +Q+YN DE GL +K LP+RT   K
Sbjct:    5 RKRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASS-SDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRAEFFFYAL-GMDGDFNPSAGWLTRFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIK 194          

HSP 2 Score: 78.1814 bits (191), Expect = 1.222e-39
Identity = 49/132 (37.12%), Postives = 77/132 (58.33%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKIL----SVVIAR*KFRTSRKTTIEIQPINQGVISVFKQNYR 2682
            ++ C N +G +KL+  ++GK++ PR F   + ++LP  Y +   AW + ++F  WF K FV  VR +LR   L+EKA+LL+DN P H    +L      + A  K+      ++ IQP+ QGVI+  K+NYR
Sbjct:  211 VMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWFDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFA--KYLPPNVASL-IQPLGQGVIAAMKRNYR 339          
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|G3MY25|TIGD5_BOVIN (Tigger transposable element-derived protein 5 OS=Bos taurus OX=9913 GN=TIGD5 PE=3 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 2.001e-39
Identity = 77/222 (34.68%), Postives = 114/222 (51.35%), Query Frame = 3
Query: 1686 RMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLK-----------------MFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            R ++S K+KL A++++K G+RQ  + RD G+   TLRGW  +E K+R     L   +G Q K+++ A++  +D A+Y WF+  R  GVP+SGP+++AQ E F R I G +  FKAS+GW  R+ KRH  S   + GE        A   P   +                     EG Y  +Q+YN +  GL +K+LP +            G + R DRVT
Sbjct:   58 RKAYSIKDKLQAIERVKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLEQLGGEVGTQRKKMRLANEEEIDRAVYSWFLALRQHGVPLSGPLIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRIYGEAEPVAAGPAPGPPVKQEPAQPTRAGPLPDRAASTPAPAEGGYGDEQIYNANVTGLYWKLLPEQAAPVGAGGC---GRRWRGDRVT 276          

HSP 2 Score: 51.2174 bits (121), Expect = 2.001e-39
Identity = 52/191 (27.23%), Postives = 88/191 (46.07%), Query Frame = 1
Query: 2281 RGETG*LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYP-AHHQRKILSVVIAR*KFRTSRKTTI----EIQ----------------------PINQGVISVFKQNYRR*MIKGMVLDNNGSVDQSLVLLTLKEVCHF 2772
            RG+   +L   N +GS+KL+PL+IG+   P    H N    P  Y  S +AW +  +   WF + FV  VR +LR+  L++KA+LL+ + P    + ++ ++  +    R  R        E+Q                      P+ QGV++ FKQ Y+R +++  V    GS    +    LK++ + 
Sbjct:  271 RGDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEFVPGVRRYLRRSCLQQKAVLLVAHPPCPSSEARMPALEESEETRRRCRPEPTGPPEELQTPDGAVRVLFLCRGSGRAHIPAPLEQGVVAAFKQLYKRELLRLAVSCAGGSPLDFMRSFMLKDMLYL 461          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A452ICN3 (HTH CENPB-type domain-containing protein OS=Gopherus agassizii OX=38772 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 4.297e-102
Identity = 117/178 (65.73%), Postives = 133/178 (74.72%), Query Frame = 3
Query: 1677 VKKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGL 2210
            ++KR SFS +EKL ALDQLK GK+Q QLAR+LGI E           K+ SLP+ILE+  GLQ K+VK  +D  LDSALYQWFVQA  E VPISGPILKAQ EKF+ LING +SK KAS+ WLDRF KRH  SQ+LVS EI S DKKAA+SYP  LK  LEEGC TADQVY+CDE GL
Sbjct:    9 LRKRKSFSAQEKLYALDQLKKGKQQIQLARELGIKE-----------KLCSLPSILEEETGLQSKKVKFPNDKSLDSALYQWFVQAHSERVPISGPILKAQAEKFDHLINGNESKSKASDSWLDRFKKRHTISQVLVSEEIHSADKKAADSYPIELKKLLEEGCNTADQVYSCDETGL 175          

HSP 2 Score: 175.252 bits (443), Expect = 4.297e-102
Identity = 104/173 (60.12%), Postives = 124/173 (71.68%), Query Frame = 1
Query: 2263 NEKVIRRGETG*LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR*KFRTS---RKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNNGSVDQSLVLLTLKEVCHF 2772
            NEK + RG T  LLFC+ KSGS+K+RPLMI K ++PRCFHHVNM +LPF Y NS NAW N+++F  WFHKTF+   RAHLRKLK EEKALLL+DN  AH   + L  V    K + S   + TT EIQP+++G+IS FKQNYRR MI  MV+DNN S D SL  L LKEVCH 
Sbjct:  178 NEKALSRGRTKSLLFCIKKSGSHKVRPLMIRKVRSPRCFHHVNMQALPFEYTNSKNAWMNSSMFEGWFHKTFMPAARAHLRKLKQEEKALLLLDNCSAHSTAENL--VSHDSKIKVSYLPKNTTSEIQPLDKGIISAFKQNYRREMIGQMVVDNNSSFDTSLASLNLKEVCHL 348          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A452ICV0 (HTH CENPB-type domain-containing protein OS=Gopherus agassizii OX=38772 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 5.281e-98
Identity = 117/178 (65.73%), Postives = 133/178 (74.72%), Query Frame = 3
Query: 1677 VKKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGL 2210
            ++KR SFS +EKL ALDQLK GK+Q QLAR+LGI E           K+ SLP+ILE+  GLQ K+VK  +D  LDSALYQWFVQA  E VPISGPILKAQ EKF+ LING +SK KAS+ WLDRF KRH  SQ+LVS EI S DKKAA+SYP  LK  LEEGC TADQVY+CDE GL
Sbjct:    9 LRKRKSFSAQEKLYALDQLKKGKQQIQLARELGIKE-----------KLCSLPSILEEETGLQSKKVKFPNDKSLDSALYQWFVQAHSERVPISGPILKAQAEKFDHLINGNESKSKASDSWLDRFKKRHTISQVLVSEEIHSADKKAADSYPIELKKLLEEGCNTADQVYSCDETGL 175          

HSP 2 Score: 160.999 bits (406), Expect = 5.281e-98
Identity = 98/166 (59.04%), Postives = 118/166 (71.08%), Query Frame = 1
Query: 2263 NEKVIRRGETG*LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR*KFRTS---RKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNNGSVDQSLVLLT 2751
            NEK + RG T  LLFC+ KSGS+K+RPLMI K ++PRCFHHVNM +LPF Y NS NAW N+++F  WFHKTF+   RAHLRKLK EEKALLL+DN  AH   + L  V    K + S   + TT EIQP+++G+IS FKQNYRR MI  MV+DNN S D SL   T
Sbjct:  178 NEKALSRGRTKSLLFCIKKSGSHKVRPLMIRKVRSPRCFHHVNMQALPFEYTNSKNAWMNSSMFEGWFHKTFMPAARAHLRKLKQEEKALLLLDNCSAHSTAENL--VSHDSKIKVSYLPKNTTSEIQPLDKGIISAFKQNYRREMIGQMVVDNNSSFDTSLPEFT 341          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: A0A452HST6 (HTH CENPB-type domain-containing protein OS=Gopherus agassizii OX=38772 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 1.157e-87
Identity = 174/316 (55.06%), Postives = 203/316 (64.24%), Query Frame = 3
Query: 1665 MVKQVKKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVTXXXXXXXXXXXXKAFDDWKIESTQMFPSCKYDVTSISLY*Q**CLDEYDRIL*LVSQNIRFRRSGSFKKTQARGKSTPPDG*LPCSSPAENLVSSDSKIKVSYL 2612
            M   V K  SFS +EKL  LDQLK GK+QTQLAR LGISESTLRGWK  E K+ SLP ILE+  GLQ K+VK A+++ LDSALYQWFVQAR EGVPISGPILKAQ EKF+RLING +SKFKASNGWLDRF KRH  SQ+LV GEI S DK+AA+ YP  LK  LEEGCYT DQVYNCDE GLC+KMLP+ TL TKT ++KREG+K+R+DRVTL           K F           P+ +  +           L + ++ L L+                    + PP         AENLVS + KIKVSYL
Sbjct:    1 MDTPVHKCKSFSAQEKLYTLDQLK-GKQQTQLARYLGISESTLRGWKKEE-KLCSLPRILEEETGLQRKKVKFANNDSLDSALYQWFVQARSEGVPISGPILKAQAEKFDRLINGNESKFKASNGWLDRFKKRHTISQVLVFGEICSADKEAADFYPIELKKLLEEGCYTVDQVYNCDETGLCFKMLPDCTLTTKTDSHKREGFKQRKDRVTLSCFASTSLAFHKTFT----------PAVRAHLRK---------LKQEEKALLLLDN----------------CPAHPP---------AENLVSHEGKIKVSYL 270          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: H3AEI1 (HTH CENPB-type domain-containing protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 8.716e-76
Identity = 98/206 (47.57%), Postives = 138/206 (66.99%), Query Frame = 3
Query: 1683 KRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            KR ++   EKL  + ++  G+ + ++  D G+ ESTL+GW   E K++S    + +  GL  KR ++ASD  LD+A+Y WFVQ R  G PISGPI+KAQ EKF + +NG D+ F AS GWLDRF +RH  SQ+ +SGEIRS D +AA+++P  LK +LEE  +T +QV N DE GL +KM P+ TLA K    K EG+K+ ++R+T
Sbjct:    4 KRKAYIVHEKLELIGRIHAGQSKAKIIHDTGVPESTLQGWLKEEYKLQSFVMTVSETKGLSRKRARTASDAPLDTAVYNWFVQERAVGTPISGPIVKAQAEKFCQELNG-DNNFSASQGWLDRFRRRHGISQVKISGEIRSADSEAASTFPDELKAYLEEEGFTEEQVCNADESGLYFKMFPDTTLAAKNDEKKSEGFKQDKNRIT 208          

HSP 2 Score: 115.931 bits (289), Expect = 8.716e-76
Identity = 69/145 (47.59%), Postives = 88/145 (60.69%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR*K-FRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNNGSVD 2730
             LF  NK+G+ KL PL IGKS+ P CFHH NM SLP  Y NS  AW    +F DWF  +FV  +R HL   +L EKA+LL+DN PAH   + L       K F   + TT +IQP+NQG+I  FK+ YR+ ++K +V  NN   D
Sbjct:  209 FLFACNKTGNRKLTPLCIGKSRQPHCFHHTNMKSLPIEYKNSKKAWMTGDLFKDWFFNSFVPSMRHHLYSKRLPEKAVLLLDNCPAHPPAESLKTSDGNIKVFYLPKNTTSKIQPLNQGIIVNFKKAYRKGLVKELVASNNSITD 353          
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Match: H3AAS9 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 GN=TIGD7 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.100e-75
Identity = 100/211 (47.39%), Postives = 143/211 (67.77%), Query Frame = 3
Query: 1668 VKQVKKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            V  + KR +++  EKL  +D++  G+ + +++ D G+ ESTL+GW   E  +R+    + +  GL  KR ++ASD  LD+A+Y WFVQ R  G PISGPI+KAQ EKF + +NGE++ F AS GWLDRF +RH  SQ+ +SGEIRS D +AAN++    K +LEE  +T +QVYN DE GL +KMLP+ TLA K+     EG+K+ ++RVT
Sbjct:    1 VTAMGKRKAYNVHEKLELIDRIHAGQSKAKISYDTGVPESTLQGWLKEEYNLRAFVMTVSETEGLSRKRARTASDAPLDTAVYNWFVQERAVGTPISGPIVKAQAEKFCKELNGENN-FAASQGWLDRFKRRHGISQVKISGEIRSADSEAANTFSNEFKAYLEEEGFTEEQVYNADESGLYFKMLPHTTLAAKS-----EGFKQDKNRVT 205          

HSP 2 Score: 114.39 bits (285), Expect = 1.100e-75
Identity = 72/159 (45.28%), Postives = 99/159 (62.26%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR*K-FRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNNGSVDQSLVLLTLKEVCHF 2772
             LF  NK+G++KL PL IGKS  PRCF+H NM SLP  Y NS  AW    +F DWF K  V  VR HLR  +L EKA+LL+DN PAH   + L       K F   + TT +IQP++QG+I+ FK+ YR+ ++K +V  +N S+   L + +LK++ + 
Sbjct:  206 FLFACNKTGNHKLTPLCIGKSCQPRCFYHTNMKSLPIEYKNSKKAWMTGDIFKDWFFKFCVPSVRRHLRSKRLPEKAVLLLDNCPAHPPAESLKTSDGNIKVFYLPKNTTSKIQPLDQGIIANFKKAYRKELVKELVASDN-SITNHLKMYSLKDMMYL 363          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:103030561])

HSP 1 Score: 90.8929 bits (224), Expect = 3.993e-18
Identity = 66/211 (31.28%), Postives = 101/211 (47.87%), Query Frame = 1
Query:   52 YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFI 654
            Y     + + LK+   L  H GCVNT++W+ +G  ILSG DD  L I         P+ +     I   +  NI SAKFMP+ N+ QIVS S  G I+      +   N++   F  H G    I T  ++ + F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L       ++
Sbjct:   28 YLGRREFVQRLKLEAILNVHDGCVNTISWNDTGEYILSGSDDTNLVI-------TNPYNRKVKTTIRSGHRANIFSAKFMPLTNDQQIVSCSGDGIIYYTHTEKSADINRQCQ-FTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLGTRATGNYM 230          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:103030561])

HSP 1 Score: 90.8929 bits (224), Expect = 4.532e-18
Identity = 65/205 (31.71%), Postives = 100/205 (48.78%), Query Frame = 1
Query:   70 YTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFI 654
            + + LK+   L  H GCVNT++W+ +G  ILSG DD  L I         P+ +     I   +  NI SAKFMP+ N+ QIVS S  G I+      +   N++   F  H G    I T  ++ + F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L       ++
Sbjct:   34 FVQRLKLEAILNVHDGCVNTISWNDTGEYILSGSDDTNLVI-------TNPYNRKVKTTIRSGHRANIFSAKFMPLTNDQQIVSCSGDGIIYYTHTEKSADINRQCQ-FTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLGTRATGNYM 230          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:103030561])

HSP 1 Score: 90.1225 bits (222), Expect = 6.843e-18
Identity = 65/205 (31.71%), Postives = 100/205 (48.78%), Query Frame = 1
Query:   70 YTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFI 654
            + + LK+   L  H GCVNT++W+ +G  ILSG DD  L I         P+ +     I   +  NI SAKFMP+ N+ QIVS S  G I+      +   N++   F  H G    I T  ++ + F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L       ++
Sbjct:   34 FVQRLKLEAILNVHDGCVNTISWNDTGEYILSGSDDTNLVI-------TNPYNRKVKTTIRSGHRANIFSAKFMPLTNDQQIVSCSGDGIIYYTHTEKSADINRQCQ-FTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLGTRATGNYM 230          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:103030561])

HSP 1 Score: 90.1225 bits (222), Expect = 6.988e-18
Identity = 65/205 (31.71%), Postives = 100/205 (48.78%), Query Frame = 1
Query:   70 YTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFI 654
            + + LK+   L  H GCVNT++W+ +G  ILSG DD  L I         P+ +     I   +  NI SAKFMP+ N+ QIVS S  G I+      +   N++   F  H G    I T  ++ + F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L       ++
Sbjct:   34 FVQRLKLEAILNVHDGCVNTISWNDTGEYILSGSDDTNLVI-------TNPYNRKVKTTIRSGHRANIFSAKFMPLTNDQQIVSCSGDGIIYYTHTEKSADINRQCQ-FTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLGTRATGNYM 230          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:103030561])

HSP 1 Score: 90.1225 bits (222), Expect = 7.878e-18
Identity = 65/205 (31.71%), Postives = 100/205 (48.78%), Query Frame = 1
Query:   70 YTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNSKFI 654
            + + LK+   L  H GCVNT++W+ +G  ILSG DD  L I         P+ +     I   +  NI SAKFMP+ N+ QIVS S  G I+      +   N++   F  H G    I T  ++ + F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L       ++
Sbjct:   34 FVQRLKLEAILNVHDGCVNTISWNDTGEYILSGSDDTNLVI-------TNPYNRKVKTTIRSGHRANIFSAKFMPLTNDQQIVSCSGDGIIYYTHTEKSADINRQCQ-FTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLGTRATGNYM 230          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 89.3521 bits (220), Expect = 9.912e-35
Identity = 68/209 (32.54%), Postives = 103/209 (49.28%), Query Frame = 3
Query: 1677 VKKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQ-VKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            ++KR+  S + KL  L +L+ G+   QLA +  +   T+   K  + K+  L  +L+   GL  +K ++ +    L+ A+Y+WF Q R  G+PI+  +L  Q   F+  + G    F AS GWL  F +R+   +++V  E  S D   A +       FLEE   +  QVY   E GL +K LP RT     A N R G    RDR+ 
Sbjct:    2 LRKRIVLSLETKLRILRRLEKGETAKQLALEFNLGHRTIYDIKKAKEKLWRLNKVLDVDTGLSYMKVIRESRFPQLEEAVYKWFRQHRAMGLPITSSMLIEQARHFHEHL-GLTEPFAASAGWLRNFKRRYCIGEVVV--EKVSDDAAEALAARESFMKFLEEQGLSPQQVYAATETGLYWKSLPART----AAGNCRVG----RDRIA 199          

HSP 2 Score: 76.6406 bits (187), Expect = 9.912e-35
Identity = 47/146 (32.19%), Postives = 76/146 (52.05%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKIL---SVVIAR*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMVLDNNGSV 2727
            LL C + +G+++L   ++G++  PR F ++++  LP HY N   AW  T +F  WF + FV +V  +L  L L  KA+LL+DN PAH     L    + +    F         ++P+ QG +   K  YRR + +GM L  +  +
Sbjct:  200 LLLCASAAGTHRLPLAVVGRAAHPRVFRNLDVSLLPVHYYNHRRAWVTTDIFRRWFRERFVPEVTQNLEALGLPPKAVLLLDNSPAHPDDGSLCCGDITV----FYLPPNLAPALKPLEQGAVGHLKVLYRREVARGMALGVDADL 341          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004617.1 (pep scaffold:Pmarinus_7.0:GL477874:26927:28564:-1 gene:ENSPMAG00000004208.1 transcript:ENSPMAT00000004617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.383 bits (272), Expect = 3.401e-34
Identity = 66/215 (30.70%), Postives = 113/215 (52.56%), Query Frame = 3
Query: 1683 KRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDN-VLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSK--------FKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            KR+  S ++K+  L++++ G+    +A D  I  +T+R  + N  KI    + L+     + ++   ++DN  LD+ LY+WF+Q R +G P+SGP+L  + + F+  +              F AS GWL  F +RH   ++ V GE   +D  A   Y    +  +++    A Q+YN DE GL +K LP++TLA+ +  N   GYK  ++ +T
Sbjct:    5 KRVFLSLEKKIEVLEKIRTGRSLQAIAADYNIGYTTVRDIRDNADKISKFFSELQSANATKKRKTTRSADNKELDAKLYEWFLQQRAQGHPVSGPMLCEKAKVFSAKLRSRQEGGDEEEEETFMASQGWLRSFKERHGIRRLSVVGERHGSDVDAVREYIARFQAMVDDKGLCASQIYNADETGLFWKSLPSKTLASSSEVNA-AGYKCSKEGMT 218          

HSP 2 Score: 54.6842 bits (130), Expect = 3.401e-34
Identity = 34/87 (39.08%), Postives = 49/87 (56.32%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAH 2559
            +L C N SG+++L+   +GKSK       ++   LP HY     AW +   F DWF   FV  VR +L + KL  +A+L++DN PAH
Sbjct:  219 VLMCANASGTHRLKLTCLGKSKNLGALKDLSEDCLPVHYYGQRKAWMDQFTFKDWFFTKFVPAVRDNLFREKLGSRAILVIDNAPAH 305          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000423.1 (pep scaffold:Pmarinus_7.0:GL480036:4967:5889:-1 gene:ENSPMAG00000000380.1 transcript:ENSPMAT00000000423.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 6.059e-34
Identity = 74/210 (35.24%), Postives = 115/210 (54.76%), Query Frame = 3
Query: 1677 VKKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDK-KAANSYPFWLKMFLEEGCYTADQVYNCDEM--GLCYKMLPNRT-LATKTANNKREGYKKRRDR 2294
            V +R S++ KEKL  ++++K+G  +  + R+LGI E T+RGW   E ++R   + L++  GLQ K+ + + + ++D  LY WFV  R  G P+SGP LK Q E F   +  E  KF+AS+GWL R+ KRH   +I ++GE  S  + K   S P   +  +E   YT   + +   M   L   MLP  T L  + +   ++ +K   DR
Sbjct:    4 VNRRKSYTIKEKLAIIERVKSGVSKAHINRELGIPEGTIRGWIAEEGRLRWFLDKLDEAPGLQRKKTRLSRNEIVDDCLYAWFVHKRSLGSPVSGPALKMQAETFFCDLKLE-GKFRASDGWLWRWKKRHGIGEITLAGESESHPRPKVPRSIPVEFQCVIERDVYTVTSIISRVAMKSALFSWMLPTDTSLGPEISPETKQAWKLSNDR 212          

HSP 2 Score: 37.3502 bits (85), Expect = 6.059e-34
Identity = 22/59 (37.29%), Postives = 33/59 (55.93%), Query Frame = 1
Query: 2305 FCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFV 2481
            FC NK+G++KL   + GKSK+PR F     +S+   + +S+N    T V   W   +FV
Sbjct:  216 FCFNKAGTHKLL-CVSGKSKSPRFFKFKEKLSV--QHTSSSNDRMTTNVLLTWLQDSFV 271          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 1.091e-19
Identity = 50/195 (25.64%), Postives = 93/195 (47.69%), Query Frame = 3
Query: 1740 GKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLIN------GEDS---KFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRV 2297
            G+    +++ LG++ ST+ G       I++    +   +  ++ R +S     ++ +L  W        +P+S  +++A   K  RL N      GE +    F AS GW  +F  R+    + ++GE    D +AA ++   LK  +E G Y+ +QV+N +E GL +K +P  T  ++       G+K  +DR+
Sbjct:   30 GETVRDISKSLGLATSTVCGIHKASENIKARAQRMTPLVAAKLTRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQA---KALRLFNDFKKRAGESAANETFGASTGWYAKFKGRYNLRHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETGLFWKRMPASTFLSREEKTA-PGFKASKDRL 220          

HSP 2 Score: 44.2838 bits (103), Expect = 1.091e-19
Identity = 30/87 (34.48%), Postives = 44/87 (50.57%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAH 2559
            LL   N +G  KL+PL++  SK PR         LP  + ++   W   +VF DW    F   +  + +K  L+ KALLL++N P H
Sbjct:  222 LLVGANAAGDCKLKPLLVYHSKTPRALKGCIKADLPVIWRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDHKALLLLNNAPGH 308          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001313.1 (pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gene:ENSPMAG00000001181.1 transcript:ENSPMAT00000001313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 1.586e-17
Identity = 45/196 (22.96%), Postives = 93/196 (47.45%), Query Frame = 3
Query: 1722 LDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSK----FKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRV 2297
            + Q + G+    +++ LG++ ST+ G +     I +    +   +   + R +S     ++ +L  W        +P+S  +++ +     + +  E+S+    F AS GW  +F  R+    + ++GE    D +AA ++   LK  +E G Y+ +QV+N +E  L +K +P  T  ++       G+K  +DR+
Sbjct:   24 IRQYEGGETVRDISKSLGLATSTVCGIRKASENIEAKAQRMTPFVAATLMRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQVKALIQAKALRLEESRQAETFGASTGWYAKFKGRYNLHHLKMTGETAGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTA-PGFKASKDRL 218          

HSP 2 Score: 38.5058 bits (88), Expect = 1.586e-17
Identity = 29/87 (33.33%), Postives = 43/87 (49.43%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAH 2559
            LL   N +G  +L+PL++  SK PR         LP  + ++   W   +VF DW    F   +  + +K  L+ KALLL +N P H
Sbjct:  220 LLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPI-WRSNKKGWITASVFLDWLKNHFCPAIEKYCKKKNLDLKALLLRNNAPGH 305          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Match: EDO44738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ6])

HSP 1 Score: 67.0106 bits (162), Expect = 1.215e-22
Identity = 57/199 (28.64%), Postives = 95/199 (47.74%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNG-KRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLE-EGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKRE 2270
            K+R   S  EK+  + + + G K Q +LA    I ++T+      +  I        DG   +V    + SD  ++   +QW+ + R +G  ISGP+L+ +   F   ++ +D  F+ASNGWL+ F +RH  S     G   S  + + N    W +  +E    Y +  +YN  E GL Y+ LP++ L  +T +   E
Sbjct:    1 KRRRELSLSEKIQLIHESQTGTKSQRKLADIYQIGKTTVHEILKKKDDILKAYEQNVDGGRKRVCTRSAYSD--INRLAWQWYERMRAQGNQISGPMLQEKARTFAAELDMKD--FRASNGWLEGFRRRHGIS----FGASFSGYETSVNVTTEWTEKIMEVTDGYRSTDIYNLVETGLYYRALPDKNLVPETESTSTE 191          

HSP 2 Score: 58.9214 bits (141), Expect = 1.215e-22
Identity = 44/166 (26.51%), Postives = 76/166 (45.78%), Query Frame = 1
Query: 2305 FCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMV--LDNNG---SVDQSLVLLTLKEVCHFYVDTL 2787
             C N  G  + +PL+IG +  P CF  ++   LP  +  +  AW  T++F DW             +  + + + LL +DN P H     L+ V      + S  T  ++QP+ QG++  F+  YRR ++   +  LD++    S  Q +  +T  + C +   TL
Sbjct:  197 LCCNMDGEFE-KPLVIGPTANPPCFAKLDSECLPVIWRANRRAWITTSIFADWLR-------TLDRKMRQKDRRILLFLDNSPPHPPTLQLTNVKLVFLIKPSNNTVNQLQPLTQGIVEAFRMAYRRKVLFSTLAKLDDSNSPRSAKQLMQEITELDACFWIAATL 354          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Match: EDO40000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8J7])

HSP 1 Score: 79.337 bits (194), Expect = 3.217e-19
Identity = 49/129 (37.98%), Postives = 71/129 (55.04%), Query Frame = 3
Query: 1869 KRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKF-NRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSY-PFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATK 2249
            +R+    +  L+ ALY W V+ + +GVPISGP+LK     F N LI+   S F  SNGW+DR+ KR   +   VSGEI S   +   S+    L   L +  Y  + +++ DE GL YK LP++ +  K
Sbjct:   22 QRLTPCGNEDLEKALYTWSVRMKQQGVPISGPVLKETAIHFANELISIVLSGFVGSNGWIDRWKKRQDVAFKTVSGEILSCTLEMTASWEESTLPTLLSK--YALEDMFDADEFGLFYKALPDKLMHLK 148          

HSP 2 Score: 35.039 bits (79), Expect = 3.217e-19
Identity = 18/52 (34.62%), Postives = 26/52 (50.00%), Query Frame = 1
Query: 2320 SGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWT-NTTVFYDWFHK 2472
            S   KL   +IGKS+ PRCF  V   +LP  Y      W  ++ +F +W  +
Sbjct:  170 SSGEKLPMFVIGKSQKPRCFSGVR--NLPCRYRAPKKGWILDSNLFEEWVRE 219          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Match: EDO29936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T282])

HSP 1 Score: 74.3294 bits (181), Expect = 1.677e-13
Identity = 60/206 (29.13%), Postives = 97/206 (47.09%), Query Frame = 1
Query:   55 HDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIP---------FLKMNLPCSLSA----IAIHPLCSYKIAIGGSDSCVRVFDKRYLNK 633
            H    + E L + ++LEGH GCVN +   +SG  + SG DD    I + LS + K  V      I+  ++ NI S KF+P   ++I++ +   +   +     N+   V++ H G    +A   +      +AS D T   FD+R+ +             + +N+  S  A    IAI+PL    +AIG +D  VR++D R L K
Sbjct:   28 HVYPPFVERLGLEKELEGHTGCVNCLELTESGELLASGSDDLNAIIWEPLS-YKKKCV------IATGHTGNIFSIKFLPCTGDRIIATAAADTKVRIHSVEKNETTQVYHCHIGRVKRLAVAPNMPSLVWSASEDGTIRQFDLRQPHCCNSNSKNCNNVLINLNVHSSALAEPKCIAINPLRPNMMAIGCNDPFVRIYDHRMLAK 226          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Match: EDO28293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWN2])

HSP 1 Score: 63.1586 bits (152), Expect = 6.572e-12
Identity = 42/115 (36.52%), Postives = 57/115 (49.57%), Query Frame = 1
Query:   76 ENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVNSTNKELNVFYK-HSGPTLNI 414
            + LK    L GH GCVNT+AW + G  +LSG DD  L I+       +P     V  I   +  NI SAKFMP  NN+ IVS +  G +   +++        FY  H+G T  +
Sbjct:    7 QCLKRSGTLSGHDGCVNTIAWSECGELLLSGSDDCRLNIY-------RPCENKLVQCIRSGHRANIFSAKFMPCSNNKWIVSCAGDGMLQFTNLDRPEMIGTCFYNCHTGTTYEV 114          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Match: EDO31891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWN2])

HSP 1 Score: 63.1586 bits (152), Expect = 6.572e-12
Identity = 42/115 (36.52%), Postives = 57/115 (49.57%), Query Frame = 1
Query:   76 ENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVNSTNKELNVFYK-HSGPTLNI 414
            + LK    L GH GCVNT+AW + G  +LSG DD  L I+       +P     V  I   +  NI SAKFMP  NN+ IVS +  G +   +++        FY  H+G T  +
Sbjct:    7 QCLKRSGTLSGHDGCVNTIAWSECGELLLSGSDDCRLNIY-------RPCENKLVQCIRSGHRANIFSAKFMPCSNNKWIVSCAGDGMLQFTNLDRPEMIGTCFYNCHTGTTYEV 114          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 5.569e-21
Identity = 59/208 (28.37%), Postives = 94/208 (45.19%), Query Frame = 3
Query: 1680 KKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYP-FWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            ++R   +  +K+  LD LK G+  + + R  G++EST+R  K  E  IR    I         KRV +    V +  + +   Q   E  P +  +            + E S F AS GW D+F KR     + + GE    D   A +Y     K  ++EG Y  +QV+N  E GL +K +P++  A+        G++ ++DRVT
Sbjct:    7 RQRKMLTVTQKVGLLDMLKEGRSYSAVGRHYGLNESTVRYIKKEENNIRRTAAI---SFNKDAKRVVT----VRNKTIIRMESQGDVEPSPSTSAL------------HSEPSPFYASKGWFDKFQKRFGLKSVSLQGEATPADAAGAEAYAKTKFKTIIKEGTYKPEQVFNMGETGLFWKQIPSQAKAS--------GFRGQKDRVT 187          

HSP 2 Score: 51.6026 bits (122), Expect = 5.569e-21
Identity = 42/136 (30.88%), Postives = 75/136 (55.15%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPFHYINSNNAWTNTTVFYDWFHKTFVSDVXXXXXXXXXXXXXXXXMDNYPAHHQRKILSVVIAR*KFRTSRKTTIEIQPINQGVISVFKQNYRR*MIKGMV 2706
            L+ C N +G   ++P +I + K PR   + NM +LP +++++  AW    +  +WF   F+ +V+ +L +  L+ K LLL+DN  A      LS    + +F     +++ IQP++QG+I  FK  Y R  ++ +V
Sbjct:  188 LVMCGNAAGF-MIKPGLISRLKNPRALKNKNMSALPVYWMHNTMAWMTKALNLNWFKGCFIPEVKGYLTEKGLDFKVLLLIDN--AGGFADDLSHDGVQIEFLPPNTSSL-IQPMDQGIIRTFKALYTRNTLQHLV 319          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:101156538])

HSP 1 Score: 97.4413 bits (241), Expect = 3.437e-20
Identity = 69/211 (32.70%), Postives = 103/211 (48.82%), Query Frame = 1
Query:   28 NSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN 630
            N R +S F  +   + + LK+   L  H GCVNT++W+++G  ILSG DD  L I         P+ K     I   +  NI SAKFMP  N+Q I+S S  G I+      +   N++   F  H G    I T  ++   F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L 
Sbjct:   21 NPRGRSVFLSERREFVQRLKLESTLNVHDGCVNTISWNETGEYILSGSDDTFLVI-------TNPYNKKVKTSIRSGHRANIFSAKFMPHTNDQEIISCSGDGIIYYTHTEKSPEHNRQCQ-FTCHYGTAYEIMTVPNDPCTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLG 223          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:101156538])

HSP 1 Score: 89.7373 bits (221), Expect = 9.602e-18
Identity = 66/203 (32.51%), Postives = 98/203 (48.28%), Query Frame = 1
Query:   52 YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN 630
            Y     + + LK+   L  H GCVNT++W+++G  ILSG DD  L I         P+ K     I   +  NI SAKFMP  N+Q I+S S  G I+      +   N++   F  H G    I T  ++   F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L 
Sbjct:   31 YLGRREFVQRLKLESTLNVHDGCVNTISWNETGEYILSGSDDTFLVI-------TNPYNKKVKTSIRSGHRANIFSAKFMPHTNDQEIISCSGDGIIYYTHTEKSPEHNRQCQ-FTCHYGTAYEIMTVPNDPCTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLG 225          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:101156538])

HSP 1 Score: 89.7373 bits (221), Expect = 9.637e-18
Identity = 66/203 (32.51%), Postives = 98/203 (48.28%), Query Frame = 1
Query:   52 YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN 630
            Y     + + LK+   L  H GCVNT++W+++G  ILSG DD  L I         P+ K     I   +  NI SAKFMP  N+Q I+S S  G I+      +   N++   F  H G    I T  ++   F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L 
Sbjct:   31 YLGRREFVQRLKLESTLNVHDGCVNTISWNETGEYILSGSDDTFLVI-------TNPYNKKVKTSIRSGHRANIFSAKFMPHTNDQEIISCSGDGIIYYTHTEKSPEHNRQCQ-FTCHYGTAYEIMTVPNDPCTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLG 225          
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:101156538])

HSP 1 Score: 89.7373 bits (221), Expect = 1.058e-17
Identity = 66/203 (32.51%), Postives = 98/203 (48.28%), Query Frame = 1
Query:   52 YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN 630
            Y     + + LK+   L  H GCVNT++W+++G  ILSG DD  L I         P+ K     I   +  NI SAKFMP  N+Q I+S S  G I+      +   N++   F  H G    I T  ++   F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L 
Sbjct:   31 YLGRREFVQRLKLESTLNVHDGCVNTISWNETGEYILSGSDDTFLVI-------TNPYNKKVKTSIRSGHRANIFSAKFMPHTNDQEIISCSGDGIIYYTHTEKSPEHNRQCQ-FTCHYGTAYEIMTVPNDPCTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLG 225          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000073620.1 (SMESG000073620.1)

HSP 1 Score: 445.662 bits (1145), Expect = 0.000e+0
Identity = 213/213 (100.00%), Postives = 213/213 (100.00%), Query Frame = 1
Query:    4 MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 642
            MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN
Sbjct:    1 MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 213          

HSP 2 Score: 340.117 bits (871), Expect = 0.000e+0
Identity = 162/163 (99.39%), Postives = 163/163 (100.00%), Query Frame = 2
Query:  686 DVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM 1174
            +VEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM
Sbjct:  214 NVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM 376          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000073620.1 (SMESG000073620.1)

HSP 1 Score: 444.891 bits (1143), Expect = 0.000e+0
Identity = 213/213 (100.00%), Postives = 213/213 (100.00%), Query Frame = 1
Query:    4 MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 642
            MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN
Sbjct:    1 MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 213          

HSP 2 Score: 341.658 bits (875), Expect = 0.000e+0
Identity = 163/164 (99.39%), Postives = 164/164 (100.00%), Query Frame = 2
Query:  686 DVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME 1177
            +VEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME
Sbjct:  214 NVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME 377          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000073620.1 (SMESG000073620.1)

HSP 1 Score: 428.713 bits (1101), Expect = 0.000e+0
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 1
Query:   25 MNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 642
            MNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN
Sbjct:    1 MNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 206          

HSP 2 Score: 340.502 bits (872), Expect = 0.000e+0
Identity = 162/163 (99.39%), Postives = 163/163 (100.00%), Query Frame = 2
Query:  686 DVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM 1174
            +VEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM
Sbjct:  207 NVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM 369          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000073620.1 (SMESG000073620.1)

HSP 1 Score: 427.943 bits (1099), Expect = 0.000e+0
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 1
Query:   25 MNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 642
            MNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN
Sbjct:    1 MNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFN 206          

HSP 2 Score: 342.428 bits (877), Expect = 0.000e+0
Identity = 163/164 (99.39%), Postives = 164/164 (100.00%), Query Frame = 2
Query:  686 DVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME 1177
            +VEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME
Sbjct:  207 NVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME 370          
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000013943.1 (SMESG000013943.1)

HSP 1 Score: 371.318 bits (952), Expect = 1.062e-117
Identity = 180/212 (84.91%), Postives = 191/212 (90.09%), Query Frame = 3
Query: 1665 MVKQVKKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNEVKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGPILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDKKAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNKREGYKKRRDRVT 2300
            M KQV+KRMSFSTKEKLLALDQLKNGK+QTQLARD GISEST+RGWKTNE+ IRSLPNILED L LQ KRVKSASDNVLDSALYQW VQAR EGVPISGPILKA+ EKFNR INGEDSKFKASN WLDRF KRH  SQ+LVSGEI S DK+ ANSYPF LK FLEEGCYTADQVYNCDE GLCYKMLPNRTLATKT N+KREG+KKR+DR+T
Sbjct:    1 MEKQVQKRMSFSTKEKLLALDQLKNGKQQTQLARDFGISESTVRGWKTNEIMIRSLPNILEDELILQRKRVKSASDNVLDSALYQWLVQARSEGVPISGPILKAKAEKFNRRINGEDSKFKASNIWLDRFKKRHTISQVLVSGEIHSADKEDANSYPFLLKKFLEEGCYTADQVYNCDETGLCYKMLPNRTLATKTDNHKREGFKKRKDRLT 212          

HSP 2 Score: 73.559 bits (179), Expect = 1.062e-117
Identity = 32/37 (86.49%), Postives = 34/37 (91.89%), Query Frame = 1
Query: 2299 LLFCVNKSGSNKLRPLMIGKSKAPRCFHHVNMMSLPF 2409
            LLFC+NKSGS+KL PLMIGKSKAPRCFHHVNM SLP 
Sbjct:  213 LLFCINKSGSHKLSPLMIGKSKAPRCFHHVNMKSLPL 249          

HSP 3 Score: 51.6026 bits (122), Expect = 3.122e-6
Identity = 23/26 (88.46%), Postives = 24/26 (92.31%), Query Frame = 1
Query: 2692 IKGMVLDNNGSVDQSLVLLTLKEVCH 2769
            + GMVLDNNGSVDQSL LLTLKEVCH
Sbjct:  249 LTGMVLDNNGSVDQSLALLTLKEVCH 274          
The following BLAST results are available for this feature:
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JRKL2.291e-4034.93JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
TIGD23.497e-3731.88tigger transposable element derived 2 [Source:HGNC... [more]
TIGD23.497e-3731.88tigger transposable element derived 2 [Source:HGNC... [more]
TIGD52.256e-3633.93tigger transposable element derived 5 [Source:HGNC... [more]
TIGD52.256e-3633.93tigger transposable element derived 5 [Source:HGNC... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
adpr-17.327e-825.52ADiPose (Drosophila obesity gene) Related [Source... [more]
eif-3.I7.466e-746.34Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adp8.246e-1630.19gene:FBgn0000057 transcript:FBtr0340288[more]
adp8.246e-1630.19gene:FBgn0000057 transcript:FBtr0086744[more]
CG80015.099e-926.87gene:FBgn0035268 transcript:FBtr0072774[more]
CG80015.099e-926.87gene:FBgn0035268 transcript:FBtr0334073[more]
CG80015.535e-926.87gene:FBgn0035268 transcript:FBtr0334074[more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dcaf64.122e-1832.68ddb1 and cul4 associated factor 6 [Source:ZFIN;Acc... [more]
dcaf85.191e-1425.65DDB1 and CUL4 associated factor 8 [Source:ZFIN;Acc... [more]
dcaf85.191e-1425.65DDB1 and CUL4 associated factor 8 [Source:ZFIN;Acc... [more]
wdtc11.272e-1124.62WD and tetratricopeptide repeats 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
apmapl8.273e-4338.96adipocyte plasma membrane associated protein LIKE ... [more]
kif62.068e-2728.17kinesin family member 6 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000046714.13.672e-2534.67pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
dcaf61.745e-2133.17DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
dcaf61.193e-2033.67DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tigd58.103e-4236.16tigger transposable element derived 5 [Source:MGI ... [more]
Jrkl1.992e-4035.94Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
Tigd22.308e-3832.85tigger transposable element derived 2 [Source:MGI ... [more]
Jrk8.347e-3228.71jerky [Source:MGI Symbol;Acc:MGI:106214][more]
Tigd41.443e-2831.63tigger transposable element derived 4 [Source:MGI ... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B1WC39|TIGD5_RAT4.537e-4135.59Tigger transposable element derived 5 OS=Rattus no... [more]
sp|Q499M4|TIGD5_MOUSE4.969e-4136.16Tigger transposable element derived 5 OS=Mus muscu... [more]
sp|Q9Y4A0|JERKL_HUMAN1.018e-3934.93Jerky protein homolog-like OS=Homo sapiens OX=9606... [more]
sp|B2RRL2|JERKL_MOUSE1.222e-3935.94Jerky protein homolog-like OS=Mus musculus OX=1009... [more]
sp|G3MY25|TIGD5_BOVIN2.001e-3934.68Tigger transposable element-derived protein 5 OS=B... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A452ICN34.297e-10265.73HTH CENPB-type domain-containing protein OS=Gopher... [more]
A0A452ICV05.281e-9865.73HTH CENPB-type domain-containing protein OS=Gopher... [more]
A0A452HST61.157e-8755.06HTH CENPB-type domain-containing protein OS=Gopher... [more]
H3AEI18.716e-7647.57HTH CENPB-type domain-containing protein OS=Latime... [more]
H3AAS91.100e-7547.39Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcaf63.993e-1831.28DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
dcaf64.532e-1831.71DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
dcaf66.843e-1831.71DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
dcaf66.988e-1831.71DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
dcaf67.878e-1831.71DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JRKL9.912e-3532.54JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
ENSPMAT00000004617.13.401e-3430.70pep scaffold:Pmarinus_7.0:GL477874:26927:28564:-1 ... [more]
ENSPMAT00000000423.16.059e-3435.24pep scaffold:Pmarinus_7.0:GL480036:4967:5889:-1 ge... [more]
ENSPMAT00000005656.11.091e-1925.64pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
ENSPMAT00000001313.11.586e-1722.96pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gen... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447381.215e-2228.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400003.217e-1937.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299361.677e-1329.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282936.572e-1236.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318916.572e-1236.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036785.15.569e-2128.37pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
dcaf63.437e-2032.70DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
dcaf69.602e-1832.51DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
dcaf69.637e-1832.51DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
dcaf61.058e-1732.51DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
back to top
BLAST of HTH CENPB-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073620.10.000e+0100.00SMESG000073620.1[more]
SMESG000073620.10.000e+0100.00SMESG000073620.1[more]
SMESG000073620.10.000e+0100.00SMESG000073620.1[more]
SMESG000073620.10.000e+0100.00SMESG000073620.1[more]
SMESG000013943.11.062e-11784.91SMESG000013943.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000201 ID=SMED30000201|Name=HTH CENPB-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3202bp
CGAATGTTAACACATTGGCGTTTTATGAATTCTAGAAGTAAATCATCGTT
TTATCATGATTCTGCATCATATACAGAAAATCTTAAAGTATTTGAAAAGT
TAGAGGGTCACAGAGGCTGTGTTAATACAGTGGCTTGGGATAAGAGTGGT
ACAAAGATTTTATCTGGTGGAGATGATGCAATTTTACGCATTCATCAATT
TTTATCTGACTGGGATAAACCATGGGTTAAAGACCATGTATATGAAATCT
CTTTACCCAATTCACGAAATATATTGAGTGCTAAATTCATGCCAATTTAT
AACAATCAAATAGTTTCAGCTTCAAAATGCGGTTCAATATTTCTAGTCGA
TGTCAATAGTACCAACAAGGAATTAAATGTTTTTTATAAGCATTCTGGAC
CTACACTAAATATTGCTACATTTGAAGACGAAGCATTTAATTTTGCAACC
GCGAGCAATGATAAAACCTTTTGCATTTTCGATATTCGTGAATCGAATAA
TATACCATTTTTAAAAATGAATTTACCGTGCTCCTTATCCGCCATAGCAA
TTCATCCATTATGTTCTTATAAAATTGCAATTGGTGGAAGTGATAGTTGT
GTCAGAGTTTTCGATAAAAGATATTTAAACAAAAGCTTTAACAGTAAGTT
CATTTTATGCGATTTTAAATTAATTATAATAAATAGATGTTGAAAAAACA
TTAAAGTACGTTACAGAAATTTGTAGGCCTCTTCAGTTTCCAATAGATAA
TAAGATATCGAATCGAAGCCCACTTTATAATTATGGAAGACGATGTGTAA
ATAGCGTGAGTTTTGAACCGCGTTTAGGAAATCATATATTAGTTAGTTAC
ATGTATGATTCAATATATTTGTTTGATACAAGACAGCAAGAAAATCGTCA
ATCTGATTTTCAACCAGAACGATTACCTTTAGATACAAGTTCATTTCGAA
TTCATTATAATTGGGAAAATACTGGACCACCTAGACCTGAGGGAGAGCAA
GAACGAGGTGACATTATTTGCCCGCCATCTATTCAATCATTTTTAGATGA
TCTACAACTAAATGAATCCAGTTATGAATCAAAAATTGATTTTACAATCG
AATCGCAGTTAAAATCAGTTAAAAGGTATAAAGAAGTTCAGATATATGTT
GGTCATCAGAACTGTCGAACAATGGAATAAGATGTGTCATCCAGCACATT
TGGGTATTACTCACCAGTGAAGGGATTGGTCATGCATTAGTTAAAAAGTA
AGACAACATTTTGATGCGTCATATTTTTTGTTAGATACAATCTTTCATAA
ATTCTCAGCGGTTACATCACAAATAAAAGTCTTCTATAAATACAGTGGAG
CCCCGCTATAACGCGAATTCGGATTTAACTCGGTCGTAGCATGGAACCCA
AAATTTTTATATTCATTTACATTTAGAAAAAAATTTGATAAAATTAAAAG
AACCAAAACATGAAATTAAATTCATTTTTACCATAAAAAACTGTTCTTGA
AAAAAATAACAAAACTTAATAAATATAGCGTGATAAAATTGTCAAAATAT
ATGCCGTGATCAAACTTCTAGTTAATGAAAAATGATTCGTAATATTTAAG
TCTATTAATTTAAATCCTTTATAAGTGTATATTGTTTGTTTATATTAAAA
AATAATTATATGTTATGGTAAAACAAGTTAAAAAACGAATGTCGTTTTCT
ACCAAAGAAAAACTGCTTGCCCTAGATCAACTAAAGAATGGCAAACGACA
AACCCAGCTTGCGAGAGATTTGGGAATCAGCGAGTCCACTTTGAGAGGTT
GGAAAACAAACGAAGTAAAGATCCGTAGTCTACCCAACATTCTAGAAGAT
GGACTTGGTTTACAGGTTAAAAGAGTTAAGTCAGCAAGTGACAATGTGTT
AGATTCAGCTTTATATCAATGGTTTGTACAAGCTCGTTTTGAAGGTGTTC
CAATTTCAGGCCCAATTCTAAAAGCACAAGGAGAAAAATTTAATCGCCTT
ATAAATGGAGAAGATTCCAAATTTAAGGCGAGTAATGGCTGGCTAGACAG
ATTCATGAAAAGGCACGCTTTCAGCCAAATTCTTGTTTCTGGAGAAATTC
GCTCCACTGACAAAAAGGCTGCCAATTCCTACCCATTTTGGCTTAAAATG
TTTCTGGAAGAGGGTTGTTACACAGCCGACCAAGTTTACAATTGTGATGA
AATGGGTTTATGCTATAAAATGTTACCCAATCGCACCCTCGCAACTAAGA
CTGCCAATAATAAACGAGAAGGTTATAAGAAGAGGAGAGACAGGGTGACT
CTTATTTTGTGTTAACAAATCTGGTAGCAACAAATTAAGGCCTTTGATGA
TTGGAAAATCGAAAGCACCCAGATGTTTCCATCATGTAAATATGATGTCA
CTTCCATTTCACTATATTAACAGTAATAATGCTTGGACGAATACGACCGT
ATTTTATGACTGGTTTCACAAAACATTCGTTTCAGACGTTCGGGCTCATT
TAAGAAAACTCAAGCTAGAGGAAAAAGCACTCCTCCTGATGGATAATTAC
CCTGCTCATCACCAGCGGAAAATCTTGTCAGTAGTGATAGCAAGATAAAA
GTTTCGTACCTCCCGAAAAACAACAATAGAAATCCAGCCAATTAACCAAG
GCGTAATATCTGTATTTAAACAAAATTATCGCCGTTAAATGATAAAGGGA
ATGGTATTAGATAATAACGGTTCCGTCGATCAATCATTGGTATTACTTAC
TTTAAAAGAAGTATGCCACTTCTATGTTGATACACTTTTTATAATTTATG
ATATTTTGGTATTTTTGGTCAATCCGTATTATAACAATCAAAAAAATTAA
GAAATGTTATAATGCACGGTAATAACTTTTATATATTGGCATCGATGCTT
TAAATTTATCTAAATTTTAATCAGATTTTTATAATCATCTGATAATAAGC
CGACTTTTGATTTTAACATGTGTACACGTATATCTTGCCGAAAAAAAAGT
TCAATATTGTAAAACCCCGCATTTACGCGACCGCACTTTTAACGCGAACC
GATTTAATGGACCCTGATTTTCGCATTATAACGGAGTTTTTTACATATTT
CAATTAAAAACTCCAAGAAAAGTCTGTTTTTCCCTTTTTAAGATATAAAT
TTTTTTATTTTTATTTTCTTGGATTAATTTCAATTATTGTGTTTACTTGG
AG
back to top

protein sequence of SMED30000201-orf-1

>SMED30000201-orf-1 ID=SMED30000201-orf-1|Name=SMED30000201-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=231bp
RMLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSG
TKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIY
NNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFAT
ASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSC
VRVFDKRYLNKSFNSKFILCDFKLIIINRC*
back to top

protein sequence of SMED30000201-orf-2

>SMED30000201-orf-2 ID=SMED30000201-orf-2|Name=SMED30000201-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQ
ERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYV
GHQNCRTME*
back to top

protein sequence of SMED30000201-orf-3

>SMED30000201-orf-3 ID=SMED30000201-orf-3|Name=SMED30000201-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=217bp
MVKQVKKRMSFSTKEKLLALDQLKNGKRQTQLARDLGISESTLRGWKTNE
VKIRSLPNILEDGLGLQVKRVKSASDNVLDSALYQWFVQARFEGVPISGP
ILKAQGEKFNRLINGEDSKFKASNGWLDRFMKRHAFSQILVSGEIRSTDK
KAANSYPFWLKMFLEEGCYTADQVYNCDEMGLCYKMLPNRTLATKTANNK
REGYKKRRDRVTLILC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
IPR006600HTH_CenpB_DNA-bd_dom
IPR009057Homeobox-like_sf
IPR007889HTH_Psq
IPR004875DDE_SF_endonuclease_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003677DNA binding
GO:0003676nucleic acid binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 121..161
e-value: 0.3
score: 20.1
coord: 166..205
e-value: 18.0
score: 9.1
coord: 27..66
e-value: 5.3E-5
score: 32.6
coord: 78..117
e-value: 17.0
score: 9.2
IPR001680WD40 repeatPFAMPF00400WD40coord: 33..64
e-value: 2.7E-4
score: 21.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 34..64
score: 9.907
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 73..218
e-value: 1.9E-18
score: 68.7
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 4..72
e-value: 4.3E-6
score: 27.9
NoneNo IPR availablePANTHERPTHR15574:SF39DDB1- AND CUL4-ASSOCIATED FACTOR 6coord: 14..211
NoneNo IPR availablePANTHERPTHR15574WD REPEAT DOMAIN-CONTAINING FAMILYcoord: 14..211
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 34..214
score: 8.993
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 29..211