Polypeptide N-acetylgalactosaminyltransferase

Overview
NamePolypeptide N-acetylgalactosaminyltransferase
Smed IDSMED30000200
Length (bp)3400
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30000200) t-SNE clustered cells

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30000200) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Polypeptide N-acetylgalactosaminyltransferase (SMED30000200) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Polypeptide N-acetylgalactosaminyltransferase (SMED30000200) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000200

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30000200SMESG000017211.1 dd_Smed_v4_5368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000200SMESG000017211.1 dd_Smed_v4_5368_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000200SMESG000009970.1 dd_Smed_v4_5368_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4123])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 282/557 (50.63%), Postives = 377/557 (67.68%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C E+      + A  ++                      +    +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H++ EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R+ LR KL+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    ++   +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLIWVLLDMFLLLYFSECNKCDEKKE--RGLPAGDVLEP--------------------VQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 279/559 (49.91%), Postives = 377/559 (67.44%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLS--FTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C  K+E + + ++ A                          I    +GPGEMGKAV+IP   +++ K+ F ++QFNL+AS+++++NRSLPD R+  CK+K YP ++LPNTSV+IVFHNEAWSTLLRTV+S INRSP +LL E+I+VDD S++  LK  LE+Y+K L VPV + RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK++RK+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PY++PGG   +INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  + YD     ++   +  CL     +    P + DC
Sbjct:    8 KVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRA-------------------------VISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYP-DELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:HGNC Symbol;Acc:HGNC:23242])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 280/560 (50.00%), Postives = 378/560 (67.50%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQ---GATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C  K+E + + ++ A                          I    +GPGEMGKAV+IP   +++ K+ F ++QFNL+AS+++++NRSLPD R+  CK+K YP ++LPNTSV+IVFHNEAWSTLLRTV+S INRSP +LL E+I+VDD S++  LK  LE+Y+K L VPV + RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK++RK+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PY++PGG   +INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  + YD  +          CLS  +   G+  P ++ C
Sbjct:    8 KVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRA-------------------------VISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYP-DELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLNGPVIMLKCHHMRGNQLWEYDAES----------CLSVNKVADGSQHPTVETC 530          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: GALNT1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4123])

HSP 1 Score: 460.685 bits (1184), Expect = 4.476e-152
Identity = 222/403 (55.09%), Postives = 285/403 (70.72%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPS 1254
            K+++ TSL W+ +    L+Y    N C E+      + A  ++                      +    +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H++ EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P 
Sbjct:    8 KVVLATSLIWVLLDMFLLLYFSECNKCDEKKE--RGLPAGDVLEP--------------------VQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPG 387          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Match: POC1B-GALNT4 (POC1B-GALNT4 readthrough [Source:HGNC Symbol;Acc:HGNC:42957])

HSP 1 Score: 369.007 bits (946), Expect = 1.497e-114
Identity = 215/487 (44.15%), Postives = 295/487 (60.57%), Query Frame = 1
Query:  265 GEMGKAVVIPNYLKDESKKTFHL---HQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFE-YITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGW---IR-HDFTKFCID---TLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISD---ELCLDGSSSRSSPVKMVTCEL----TSVNLKFIYDPNAKQIKSKYNGLCLS 1671
            GE GKA  +    +DE K+   L   +  N+  S+ +S++R + D R+  CKS+ +    LP TSVII F+NEAWSTLLRT+HS +  SP  LL EII+VDD SD+V+LK +LE+Y+  L   V L R   R GL+RARL GA  ATG  L FLD HCE   GWLEPLL  I ++  +VV P+ID I  + FE Y+   +   GGF+W++ F+W++ P +E  RR + R +P+ +PT+AGGLFAV KK+F  LG YD GM++WGGENLE+SFR W C GKL I  CS VGHVF K +PY+ P  +     +N  R A VWMDEYK+ F   NP      +GDIS+R  LRE+L+CKSF+WYLKN++P  +L +P    GW   IR    +  C+D     +    +++ +F CH +GGNQ + +  N  I  +   ELC +    ++  V M  C         N+ + +  +   I   ++GLCLS
Sbjct:   72 GEWGKASKL-QLNEDELKQQEELIERYAINIYLSDRISLHRHIEDKRMYECKSQKFNYRTLPTTSVIIAFYNEAWSTLLRTIHSVLETSPAVLLKEIILVDDLSDRVYLKTQLETYISNLDR-VRLIRTNKREGLVRARLIGATFATGDVLTFLDCHCECNSGWLEPLLERIGRDETAVVCPVIDTIDWNTFEFYMQIGEPMIGGFDWRLTFQWHSVPKQERDRRIS-RIDPIRSPTMAGGLFAVSKKYFQYLGTYDTGMEVWGGENLELSFRVWQCGGKLEIHPCSHVGHVFPKRAPYARPNFL-----QNTARAAEVWMDEYKEHFYNRNPPARKEAYGDISERKLLRERLRCKSFDWYLKNVFP--NLHVPEDRPGWHGAIRSRGISSECLDYNSPDNNPTGANLSLFGCHGQGGNQFFEYTSNKEIRFNSVTELCAEVPEQKNY-VGMQNCPKDGFPVPANIIWHFKEDGT-IFHPHSGLCLS 546          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-3 (Polypeptide N-acetylgalactosaminyltransferase 3 [Source:UniProtKB/Swiss-Prot;Acc:P34678])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 271/503 (53.88%), Postives = 350/503 (69.58%), Query Frame = 1
Query:  223 RFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQ--LPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSS--SRSSPVKMVTCELTSVNLK--FIYDPNAKQIKSKYNGLCLSFTQGATSPI-LDDC 1710
            R L +    GP   G+ G  V +P   K   +K F  +QFN+VAS M+SVNR+LPDYR   C++    ++   +P TS+IIVFHNEAW+TLLRT+HS INRSP+HLL EII+VDD SD+ +L   L+SY+K  P+P+HL  +E+R+GLIRARL G+  A G  LLFLDAH E T GWLEPL+S + ++RK VVAPIIDVISDD FEY+TAS+ TWGGFNW +NF+W   P RE  RR +DRS P+ TPTIAGGLFA++K+FFY++G+YD+GM +WGGENLEISFR WMC G L I  CSRVGHVFRK +PY++PGG A++I+ N  RTA VWMDEYK FF K  P+      GD+S+R +LRE L+CKSF WYL+NIYPE+ L   F SLG I + FT+ C+DT  KK     G+ +CH  GGNQ W+    G I SD+LCL         S +K+  C ++ +N+K  F++D  A  +  K  G C++   GA   + LD+C
Sbjct:   96 RKLMETQAFGPGYHGQGGTGVTVPEDKKTIKEKRFLENQFNVVASEMISVNRTLPDYRSDACRTSGNNLKTAGMPKTSIIIVFHNEAWTTLLRTLHSVINRSPRHLLEEIILVDDKSDRDYLVKPLDSYIKMFPIPIHLVHLENRSGLIRARLTGSEMAKGKILLFLDAHVEVTDGWLEPLVSRVAEDRKRVVAPIIDVISDDTFEYVTASETTWGGFNWHLNFRWYAVPKRELNRRGSDRSMPIQTPTIAGGLFAIDKQFFYDIGSYDEGMQVWGGENLEISFRVWMCGGSLEIHPCSRVGHVFRKQTPYTFPGGTAKVIHHNAARTAEVWMDEYKAFFYKMVPAARNVEAGDVSERKKLRETLQCKSFKWYLENIYPEAPLPADFRSLGAIVNRFTEKCVDTNGKKDGQAPGIQACHGAGGNQAWSLTGKGEIRSDDLCLSSGHVYQIGSELKLERCSVSKINVKHVFVFDDQAGTLLHKKTGKCVT---GADQRVTLDEC 595          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 416.772 bits (1070), Expect = 2.385e-132
Identity = 228/482 (47.30%), Postives = 305/482 (63.28%), Query Frame = 1
Query:  265 GEMGKAVVI-PNYLKDESKKTFHL----HQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEY--ITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRS-EPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTK--FCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQ 1680
            GE+GKAVV+    L  E K  +      + FN  AS+M+SV+R+LP    + CK++ Y  E LP TSVII FHNEAWS LLRTVHS + R+P HLL E+++VDD+SD  H K  LE Y+ Q    V + RME R GLIRARL GAA ATG  L +LD+HCE   GW+EPLL  IK++  +VV P+IDVI D+ FEY    A   + GGF+W + F W++ P R+  R+N  R  +P+ +PT+AGGLF+++KK+F +LG YD G DIWGGENLE+SF+ WMC G L I  CS VGHVFRK SPY W  GV  ++ +N +R A VW+D+YK ++ +   + LG +FGDIS R +LRE L CKSF WYL NIYPE  +     + G +R+   K   CID         VGM+ CHN+GGNQ W  + +G I  DE C+D + S    V +  C     N ++ Y+ +  +++   +  CL  T+
Sbjct:  113 GELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYN-ENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERD--RKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGV-NVLKRNSIRLAEVWLDDYKTYYYERINNQLG-DFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEMRNAGGKNRQCID-YKPSGGKTVGMYQCHNQGGNQYWMLSKDGEIRRDESCVDYAGSD---VMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTK 585          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 416.772 bits (1070), Expect = 2.385e-132
Identity = 228/482 (47.30%), Postives = 305/482 (63.28%), Query Frame = 1
Query:  265 GEMGKAVVI-PNYLKDESKKTFHL----HQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEY--ITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRS-EPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTK--FCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQ 1680
            GE+GKAVV+    L  E K  +      + FN  AS+M+SV+R+LP    + CK++ Y  E LP TSVII FHNEAWS LLRTVHS + R+P HLL E+++VDD+SD  H K  LE Y+ Q    V + RME R GLIRARL GAA ATG  L +LD+HCE   GW+EPLL  IK++  +VV P+IDVI D+ FEY    A   + GGF+W + F W++ P R+  R+N  R  +P+ +PT+AGGLF+++KK+F +LG YD G DIWGGENLE+SF+ WMC G L I  CS VGHVFRK SPY W  GV  ++ +N +R A VW+D+YK ++ +   + LG +FGDIS R +LRE L CKSF WYL NIYPE  +     + G +R+   K   CID         VGM+ CHN+GGNQ W  + +G I  DE C+D + S    V +  C     N ++ Y+ +  +++   +  CL  T+
Sbjct:  113 GELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYN-ENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERD--RKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGV-NVLKRNSIRLAEVWLDDYKTYYYERINNQLG-DFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEMRNAGGKNRQCID-YKPSGGKTVGMYQCHNQGGNQYWMLSKDGEIRRDESCVDYAGSD---VMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTK 585          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 416.772 bits (1070), Expect = 2.385e-132
Identity = 228/482 (47.30%), Postives = 305/482 (63.28%), Query Frame = 1
Query:  265 GEMGKAVVI-PNYLKDESKKTFHL----HQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEY--ITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRS-EPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTK--FCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQ 1680
            GE+GKAVV+    L  E K  +      + FN  AS+M+SV+R+LP    + CK++ Y  E LP TSVII FHNEAWS LLRTVHS + R+P HLL E+++VDD+SD  H K  LE Y+ Q    V + RME R GLIRARL GAA ATG  L +LD+HCE   GW+EPLL  IK++  +VV P+IDVI D+ FEY    A   + GGF+W + F W++ P R+  R+N  R  +P+ +PT+AGGLF+++KK+F +LG YD G DIWGGENLE+SF+ WMC G L I  CS VGHVFRK SPY W  GV  ++ +N +R A VW+D+YK ++ +   + LG +FGDIS R +LRE L CKSF WYL NIYPE  +     + G +R+   K   CID         VGM+ CHN+GGNQ W  + +G I  DE C+D + S    V +  C     N ++ Y+ +  +++   +  CL  T+
Sbjct:  113 GELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYN-ENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERD--RKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGV-NVLKRNSIRLAEVWLDDYKTYYYERINNQLG-DFGDISSRKKLREDLGCKSFKWYLDNIYPELFVPGESVAKGEMRNAGGKNRQCID-YKPSGGKTVGMYQCHNQGGNQYWMLSKDGEIRRDESCVDYAGSD---VMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTK 585          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Match: gly-5 (Polypeptide N-acetylgalactosaminyltransferase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZJ1])

HSP 1 Score: 414.075 bits (1063), Expect = 2.298e-131
Identity = 226/484 (46.69%), Postives = 309/484 (63.84%), Query Frame = 1
Query:  265 GEMGKAVVI-PNYLKDESKKTFHL----HQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEY--ITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRS-EPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSL--GWIRHDFTKFCIDTL--DKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQ 1680
            GE+GKAVV+    L  E K  +      + FN  AS+M+SV+R+LP    + CK++ Y  E LP TSVII FHNEAWS LLRTVHS + R+P HLL E+++VDD+SD  H K  LE Y+ Q    V + RME R GLIRARL GAA ATG  L +LD+HCE   GW+EPLL  IK++  +VV P+IDVI D+ FEY    A   + GGF+W + F W++ P R+  R+N  R  +P+ +PT+AGGLF+++KK+F +LG YD G DIWGGENLE+SF+ WMC G L I  CS VGHVFRK SPY W  GV  ++ +N +R A VW+D+YK ++ +   + LG +FGDIS R +LRE L CKSF WYL NIYPE  L +P  S+  G +R+  T  C+D+   ++  +  +  + CH +GGNQ W  + +G I  DE C+D + S    V +  C     N ++ Y+ +  +++   +  CL  T+
Sbjct:  113 GELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYN-ENLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQFGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTVVCPVIDVIDDNTFEYHHSKAYFTSVGGFDWGLQFNWHSIPERD--RKNRTRPIDPVRSPTMAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRSPYKWRTGV-NVLKRNSIRLAEVWLDDYKTYYYERINNQLG-DFGDISSRKKLREDLGCKSFKWYLDNIYPE--LFVPGESVAKGELRNAQTSQCLDSAVGEEVENKAITPYPCHEQGGNQYWMLSKDGEIRRDESCVDYAGSD---VMVFPCHGMKGNQEWRYNHDTGRLQHAVSQKCLGMTK 586          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant5 (gene:FBgn0031681 transcript:FBtr0111024)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 269/497 (54.12%), Postives = 350/497 (70.42%), Query Frame = 1
Query:  226 FLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            FL   +      PGEMGK V IP  +KD  K+ F  +QFNL+AS+M+S+NRSL D R   C+ K Y   +LP TS++IVFHNEAW+TLLRTV S INRSP+ LL EII+VDD S++  L  +LE Y+ +LPV   + R E R+GLIRARL GA   +G  + FLDAHCE T GWLEPLL+ I +NR++VV PIIDVISD+ FEYITASD TWGGFNWK+NF+W   P RE  RRNNDR+ PL TPT+AGGLF+++K +FYE+G+YD+GMDIWGGENLE+SFR WMC G L IA CSRVGHVFRK++PY++PGG  +I+N N  R   VW+D++K+F+    P     + GD+S R  LR++LKCKSF WYL+N+YPES + + +  LG IR+  T+ C+DT+ +K +  VG+  CH  GGNQ++A+     I+SD+LCLD SSS + PV MV C     N +++YD   K I+    G CL  +    A +P+L  C
Sbjct:  117 FLAPSVQEAKGKPGEMGKPVKIPADMKDLMKEKFKENQFNLLASDMISLNRSLTDVRHEGCRRKHY-ASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERDFLGKQLEEYVAKLPVKTFVLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASDSTWGGFNWKLNFRWYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRVWMCGGVLEIAPCSRVGHVFRKSTPYTFPGGTTEIVNHNNARLVEVWLDDWKEFYYSFYPGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPESLMPLDYYYLGEIRNAETETCLDTMGRKYNEKVGISYCHGLGGNQVFAYTKRQQIMSDDLCLDASSS-NGPVNMVRCHNMGGNQEWVYDAEEKWIRHTNTGQCLQRATRDDANTPLLRPC 611          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant5 (gene:FBgn0031681 transcript:FBtr0079026)

HSP 1 Score: 540.806 bits (1392), Expect = 1.400e-179
Identity = 268/497 (53.92%), Postives = 347/497 (69.82%), Query Frame = 1
Query:  226 FLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            FL   +      PGEMGK V IP  +KD  K+ F  +QFNL+AS+M+S+NRSL D R   C+ K Y   +LP TS++IVFHNEAW+TLLRTV S INRSP+ LL EII+VDD S++  L  +LE Y+ +LPV   + R E R+GLIRARL GA   +G  + FLDAHCE T GWLEPLL+ I +NR++VV PIIDVISD+ FEYITASD TWGGFNWK+NF+W   P RE  RRNNDR+ PL TPT+AGGLF+++K +FYE+G+YD+GMDIWGGENLE+SFR W C G L I  CS VGHVFR  SPY++PGGVA+I+  N  R A VW+DE++DF+   +      + GD+S R  LR++LKCKSF WYL+N+YPES + + +  LG IR+  T+ C+DT+ +K +  VG+  CH  GGNQ++A+     I+SD+LCLD SSS + PV MV C     N +++YD   K I+    G CL  +    A +P+L  C
Sbjct:  117 FLAPSVQEAKGKPGEMGKPVKIPADMKDLMKEKFKENQFNLLASDMISLNRSLTDVRHEGCRRKHY-ASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERDFLGKQLEEYVAKLPVKTFVLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASDSTWGGFNWKLNFRWYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRIWQCGGILEIIPCSHVGHVFRDKSPYTFPGGVAKIVLHNAARVAEVWLDEWRDFYYSMSTGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPESLMPLDYYYLGEIRNAETETCLDTMGRKYNEKVGISYCHGLGGNQVFAYTKRQQIMSDDLCLDASSS-NGPVNMVRCHNMGGNQEWVYDAEEKWIRHTNTGQCLQRATRDDANTPLLRPC 611          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant9 (gene:FBgn0050463 transcript:FBtr0087113)

HSP 1 Score: 425.246 bits (1092), Expect = 3.587e-135
Identity = 225/494 (45.55%), Postives = 311/494 (62.96%), Query Frame = 1
Query:  256 DGPGEMGKAVVIPNYLKDESKKT----FHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEY--ITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSL--GWIRHDFTKFCIDTLDK-KADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATSPILDDC 1710
            + PGE+GK V +P  + DE KK     +  + FN   S+++SV+R+LPD R + CK ++  +  LP T VII FHNEAW+ LLRTVHS ++RSP+HL+ +II+VDDYSD  HLK +LE Y    P  V + R + R GLIRAR+ GA  A    L +LD+HCE T GWLEPLL  I +N  +VV P+IDVISD+  EY    +  +  GGF+W + F W+  P RE  +R+N  +EP+++PT+AGGLF+++++FF  LG YD G DIWGGENLE+SF+TWMC G L I  CS VGH+FRK SPY W  GV  ++ KN +R A VWMDEY  ++     +  G ++GD+S R +LR  LKCKSF WYL NIYPE  L IP  S+  G I +     C+D  +K + ++ V ++ CH +GGNQ W  +  G I  D+ CLD +      V +  C     N  + Y  N KQ+    +G CL+ ++     ++++C
Sbjct:  144 ENPGELGKPVRLPKEMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAYP-KVQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERER-KRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGV-NVLKKNSVRLAEVWMDEYSQYYYHRIGNDKG-DWGDVSDRRKLRNDLKCKSFKWYLDNIYPE--LFIPGDSVAHGEIANVPNGMCLDAKEKSEEETPVSIYECHGQGGNQYWMLSKAGEIRRDDSCLDYA---GKDVTLFGCHGGKGNQFWTYRENTKQLHHGTSGKCLAISESKDKLLMEEC 628          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant9 (gene:FBgn0050463 transcript:FBtr0113379)

HSP 1 Score: 425.246 bits (1092), Expect = 3.587e-135
Identity = 225/494 (45.55%), Postives = 311/494 (62.96%), Query Frame = 1
Query:  256 DGPGEMGKAVVIPNYLKDESKKT----FHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEY--ITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSL--GWIRHDFTKFCIDTLDK-KADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATSPILDDC 1710
            + PGE+GK V +P  + DE KK     +  + FN   S+++SV+R+LPD R + CK ++  +  LP T VII FHNEAW+ LLRTVHS ++RSP+HL+ +II+VDDYSD  HLK +LE Y    P  V + R + R GLIRAR+ GA  A    L +LD+HCE T GWLEPLL  I +N  +VV P+IDVISD+  EY    +  +  GGF+W + F W+  P RE  +R+N  +EP+++PT+AGGLF+++++FF  LG YD G DIWGGENLE+SF+TWMC G L I  CS VGH+FRK SPY W  GV  ++ KN +R A VWMDEY  ++     +  G ++GD+S R +LR  LKCKSF WYL NIYPE  L IP  S+  G I +     C+D  +K + ++ V ++ CH +GGNQ W  +  G I  D+ CLD +      V +  C     N  + Y  N KQ+    +G CL+ ++     ++++C
Sbjct:  144 ENPGELGKPVRLPKEMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAYP-KVQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERER-KRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGV-NVLKKNSVRLAEVWMDEYSQYYYHRIGNDKG-DWGDVSDRRKLRNDLKCKSFKWYLDNIYPE--LFIPGDSVAHGEIANVPNGMCLDAKEKSEEETPVSIYECHGQGGNQYWMLSKAGEIRRDDSCLDYA---GKDVTLFGCHGGKGNQFWTYRENTKQLHHGTSGKCLAISESKDKLLMEEC 628          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Match: Pgant9 (gene:FBgn0050463 transcript:FBtr0087112)

HSP 1 Score: 421.394 bits (1082), Expect = 1.394e-133
Identity = 227/497 (45.67%), Postives = 309/497 (62.17%), Query Frame = 1
Query:  256 DGPGEMGKAVVIPNYLKDESKKT----FHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEY--ITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSL--GWIRH--DFTKFCIDTL--DKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATSPILDDC 1710
            + PGE+GK V +P  + DE KK     +  + FN   S+++SV+R+LPD R + CK ++  +  LP T VII FHNEAW+ LLRTVHS ++RSP+HL+ +II+VDDYSD  HLK +LE Y    P  V + R + R GLIRAR+ GA  A    L +LD+HCE T GWLEPLL  I +N  +VV P+IDVISD+  EY    +  +  GGF+W + F W+  P RE  +R+N  +EP+++PT+AGGLF+++++FF  LG YD G DIWGGENLE+SF+TWMC G L I  CS VGH+FRK SPY W  GV  ++ KN +R A VWMDEY  ++     +  G ++GD+S R +LR  LKCKSF WYL NIYPE  L IP  S+  G IR+     + C+D     K     VG + CH +GGNQ W  +  G I  D+ CLD +      V +  C     N  + Y  N KQ+    +G CL+ ++     ++++C
Sbjct:  144 ENPGELGKPVRLPKEMSDEMKKAVDDGWTKNAFNQYVSDLISVHRTLPDPRDAWCKDEARYLTNLPKTDVIICFHNEAWTVLLRTVHSVLDRSPEHLIGKIILVDDYSDMPHLKRQLEDYFAAYP-KVQIIRGQKREGLIRARILGANHAKSPVLTYLDSHCECTEGWLEPLLDRIARNSTTVVCPVIDVISDETLEYHYRDSGGVNVGGFDWNLQFSWHPVPERER-KRHNSTAEPVYSPTMAGGLFSIDREFFDRLGTYDSGFDIWGGENLELSFKTWMCGGTLEIVPCSHVGHIFRKRSPYKWRSGV-NVLKKNSVRLAEVWMDEYSQYYYHRIGNDKG-DWGDVSDRRKLRNDLKCKSFKWYLDNIYPE--LFIPGDSVAHGEIRNLGYGGRTCLDAPAGKKHQKKAVGTYPCHRQGGNQYWMLSKAGEIRRDDSCLDYA---GKDVTLFGCHGGKGNQFWTYRENTKQLHHGTSGKCLAISESKDKLLMEEC 631          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 281/557 (50.45%), Postives = 372/557 (66.79%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSF--TQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C  ++   HS+                        L   +    + PGEMGKAVVIP   +D+ K+ F ++QFNL+AS+M+++NRSLPD R+  CK+K+YP + LPNTS++IVFHNEAWSTLLRTVHS INRSP+ LL+EI++VDD S++  LK KLE Y+  L VPV + RME RTGLIRARL GAA   G  + FLDAHCE T GWLEPL++ IK++R++VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PYS+PGG  Q+INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG F+CH  GGNQ++++  +  I +D+LCLD +S  + PV M+ C     N  F YD     +    +  CL     +    P L DC
Sbjct:    8 KVVLTTSLVWVLVDVFLLLYFSECNKC--DNRKDHSLLPA---------------------LRAVMSRAHEAPGEMGKAVVIPKEEQDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYP-DDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVPVRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPDSQIPRRYYSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLD-ASRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLKDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt13 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 [Source:ZFIN;Acc:ZDB-GENE-091204-444])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 271/514 (52.72%), Postives = 359/514 (69.84%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTC 1587
            K+++ TSL W+ +    L+Y    N C  ++   HS+                        L   +    + PGEMGKAVVIP   +D+ K+ F ++QFNL+AS+M+++NRSLPD R+  CK+K+YP + LPNTS++IVFHNEAWSTLLRTVHS INRSP+ LL+EI++VDD S++  LK KLE Y+  L VPV + RME RTGLIRARL GAA   G  + FLDAHCE T GWLEPL++ IK++R++VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PYS+PGG  Q+INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG F+CH  GGNQ++++  +  I +D+LCLD +S  + PV M+ C
Sbjct:    8 KVVLTTSLVWVLVDVFLLLYFSECNKC--DNRKDHSLLPA---------------------LRAVMSRAHEAPGEMGKAVVIPKEEQDKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKTYP-DDLPNTSIVIVFHNEAWSTLLRTVHSAINRSPRQLLYEILLVDDASERDFLKEKLEDYVATLEVPVRILRMEQRTGLIRARLRGAAATRGQVITFLDAHCECTTGWLEPLMARIKEDRRAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRTYFEEIGTYDSGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSSRKALRESLKCKPFSWYLENVYPDSQIPRRYYSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLD-ASRLNGPVVMLKC 496          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 268/487 (55.03%), Postives = 350/487 (71.87%), Query Frame = 1
Query:  256 DGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATS--PILDDC 1710
            DGPGEMGK VVI    +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAW+TLLRTVHS I+RSP+HLL EI++VDD S++  LK +LE Y+++L VPV + RME R+GLIRARL GA+ +TG  + FLDAHCE T GWLEPLLS IK ++K+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R  LR++L+CK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    +    +  CL       S  P + DC
Sbjct:   54 DGPGEMGKPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDC 538          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt1 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2360])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 268/487 (55.03%), Postives = 350/487 (71.87%), Query Frame = 1
Query:  256 DGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATS--PILDDC 1710
            DGPGEMGK VVI    +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAW+TLLRTVHS I+RSP+HLL EI++VDD S++  LK +LE Y+++L VPV + RME R+GLIRARL GA+ +TG  + FLDAHCE T GWLEPLLS IK ++K+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R  LR++L+CK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    +    +  CL       S  P + DC
Sbjct:   54 DGPGEMGKPVVIAKDQQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DDLPRTSVVIVFHNEAWTTLLRTVHSVIDRSPRHLLEEIVLVDDASERDFLKRQLEHYVRKLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTTGWLEPLLSRIKLDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQRLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVMMLKCHHLKGNQLWEYDPVKLSLVHVNSNQCLDKASEDDSQVPSVRDC 538          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Match: galnt11 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) [Source:ZFIN;Acc:ZDB-GENE-060929-998])

HSP 1 Score: 375.555 bits (963), Expect = 4.674e-117
Identity = 207/468 (44.23%), Postives = 287/468 (61.32%), Query Frame = 1
Query:  253 PDGPGEMGKAVVIPNYLKDESKKT-FHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQ-LPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIP-----------------FTSLGWIRHDFTKFCIDTLDKKADSD--VGMFSCHNEGGNQLWAFNVNGN-IISDELCLDGSSSRSS-PVKMVTC 1587
            PD   E+G   +I N    E +   +H H FN++ SN +  +R +PD R   C+ ++Y V  LP  S++I F NEA+S LLRTVHS ++R+P +LLHEII+VDD+S+   LK  L+SY++Q L   V + R E R GLIR R+ GA+ ATG  L+FLD+HCE    WL+PLL+ IK+NRK+VV P+ID+IS D   Y T S +  GGFNW ++FKW+  P+ E     N     + +PT+AGGLFA+++ +FYELG YD GMDIWGGENLEISFR WMC G+LLI  CSRVGH+FRK  PY  PGG    +  N +R A VWMD+YK+ +    P +   ++GDIS+R+ +R++L+C SF WYL NIYPE  +S P                     G +R+     C+    + +     V +  C  +   Q WA++     +++  LCLD S  RSS P +++ C
Sbjct:   78 PDLSPELG---MIFNKQDQEVRDMGYHKHAFNVLISNRLGYHRDVPDTRTDKCRDRAYSVS-LPTASIVICFFNEAFSALLRTVHSVLDRTPNYLLHEIILVDDHSELDDLKEDLDSYVQQHLQKKVKVVRNEKREGLIRGRMIGASHATGEVLVFLDSHCEVNEAWLQPLLTPIKENRKTVVCPVIDIISADTLVY-TPSPIVRGGFNWGLHFKWDPVPMSE----LNSPDGAIRSPTMAGGLFAMDRNYFYELGQYDRGMDIWGGENLEISFRIWMCGGQLLIVPCSRVGHIFRKRRPYGSPGG-QDTMAHNSLRLAHVWMDDYKEQYFALRPELRNRDYGDISERVSIRKRLQCHSFKWYLDNIYPEMQVSSPHKPQQPVFINKGLKRPKVLQRGRLRNLLADKCLVAQGRPSQKGGAVVVKDCDPQDPEQEWAYDEEHELVLAGLLCLDMSEIRSSDPPRLMKC 535          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 280/557 (50.27%), Postives = 377/557 (67.68%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C ++   + ++ ++K                             +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAW+TLLRTVHS INRSP+HLL EII+VDD S++  LK  LE+Y+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R+ LR KL+CK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  + YDP    +    +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVFLDMFLLLYFSECNKCDDKKERVPALKSEKPH---------------------------EGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLD-VSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDC 535          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 283/560 (50.54%), Postives = 377/560 (67.32%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC---KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C   KE       +++ K                   F+        +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAW+TLLRTVHS INRSP+HLL EII+VDD S++  LK  LE+Y+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R+ LR KL+CK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  + YDP    +    +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVFLDMFLLLYFSECNKCDDKKERGLPGGDVTSRKS------------------FIKPH-----EGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLD-VSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDC 542          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 284/560 (50.71%), Postives = 376/560 (67.14%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGP-DGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C  K+E         D                         I+  P +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAW+TLLRTVHS INRSP+HLL EII+VDD S++  LK  LE+Y+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R+ LR KL+CK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  + YDP    +    +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVFLDMFLLLYFSECNKCDDKKERGLPGGDGPD-------------------------INQKPHEGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLD-VSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 270/487 (55.44%), Postives = 354/487 (72.69%), Query Frame = 1
Query:  256 DGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAW+TLLRTVHS INRSP+HLL EII+VDD S++  LK  LE+Y+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R+ LR KL+CK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  + YDP    +    +  CL  +  + +  P + DC
Sbjct:   55 EGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLD-VSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:594943])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 283/564 (50.18%), Postives = 376/564 (66.67%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPD-------GPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C ++                             R L    ++ PD       GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAW+TLLRTVHS INRSP+HLL EII+VDD S++  LK  LE+Y+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R+ LR KL+CK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  + YDP    +    +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVFLDMFLLLYFSECNKCDDKKE---------------------------RGLPGGDEIVPDSLNKPHEGPGEMGKPVVIPKEEQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DSLPTTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLQEIILVDDASEREFLKRPLETYVKKLTVPVHVLRMEQRSGLIRARLRGAAASKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRRGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRVGLRHKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTASKEIRTDDLCLD-VSKLNGPVIMLKCHHLRGNQLWEYDPVKLTLVHVNSNQCLDKAAEEDSQVPSIRDC 542          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 283/557 (50.81%), Postives = 378/557 (67.86%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C+E+      + A  ++                    + +    +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H++ EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS RL LR KL+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    ++   +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVLLDMFLLLYFSECNKCEEKQE--RGLPAGDVL--------------------ELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 283/557 (50.81%), Postives = 378/557 (67.86%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C+E+      + A  ++                    + +    +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H++ EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS RL LR KL+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    ++   +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVLLDMFLLLYFSECNKCEEKQE--RGLPAGDVL--------------------ELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:MGI Symbol;Acc:MGI:894693])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 283/557 (50.81%), Postives = 378/557 (67.86%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C+E+      + A  ++                    + +    +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H++ EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS RL LR KL+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    ++   +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVLLDMFLLLYFSECNKCEEKQE--RGLPAGDVL--------------------ELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 280/559 (50.09%), Postives = 377/559 (67.44%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLS--FTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C  K+E + + ++ A                          I    +GPGEMGKAV+IP   +++ K+ F ++QFNL+AS+++++NRSLPD R+  CK+K YP ++LPNTSV+IVFHNEAWSTLLRTV+S INRSP +LL E+I+VDD S++  LK  LE+Y+K L VPV + RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK++RK+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PY++PGG   +INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  +  I +D+LCLD  S  S PV M+ C     N  + YD     ++   +  CL     +    P + DC
Sbjct:    8 KVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRA-------------------------VISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYP-DELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLSGPVIMLKCHHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Match: Galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:MGI Symbol;Acc:MGI:2139447])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 280/559 (50.09%), Postives = 377/559 (67.44%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLS--FTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C  K+E + + ++ A                          I    +GPGEMGKAV+IP   +++ K+ F ++QFNL+AS+++++NRSLPD R+  CK+K YP ++LPNTSV+IVFHNEAWSTLLRTV+S INRSP +LL E+I+VDD S++  LK  LE+Y+K L VPV + RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK++RK+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PY++PGG   +INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  +  I +D+LCLD  S  S PV M+ C     N  + YD     ++   +  CL     +    P + DC
Sbjct:    8 KVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRA-------------------------VISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYP-DELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKTLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLSGPVIMLKCHHMRGNQLWEYDAERLTLRHANSNQCLDEPSEEDKMVPTMQDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q29121|GALT1_PIG (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Sus scrofa OX=9823 GN=GALNT1 PE=2 SV=1)

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 285/557 (51.17%), Postives = 377/557 (67.68%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C E+      + A  ++                      +    +GPGEMGK VVIP   +D+ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H+L EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +RK+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K FF   +P V   ++GDIS RL LR KL+C+ F+WYL+NIYP+S +   ++SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    ++   +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLIWVLLDMFLLLYFSECNKCDEKKE--RGLPAGDVLEP--------------------VQKPHEGPGEMGKPVVIPKEDQDKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMLEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKTFFYIISPGVTKVDYGDISSRLGLRHKLQCRPFSWYLENIYPDSQIPRHYSSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|O08912|GALT1_MOUSE (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Galnt1 PE=1 SV=1)

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 283/557 (50.81%), Postives = 378/557 (67.86%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C+E+      + A  ++                    + +    +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H++ EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS RL LR KL+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    ++   +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVLLDMFLLLYFSECNKCEEKQE--RGLPAGDVL--------------------ELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q10473|GALT1_RAT (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Galnt1 PE=1 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 282/557 (50.63%), Postives = 378/557 (67.86%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C+E+      + A  ++                    + +    +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M++ NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H++ EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R+ LR KL+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    ++   +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVLLDMFLLLYFSECNKCEEKKE--RGLPAGDVL--------------------ELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIAFNRSLPDVRLEGCKTKVYP-DSLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q10472|GALT1_HUMAN (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GALNT1 PE=1 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 282/557 (50.63%), Postives = 377/557 (67.68%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C E+      + A  ++                      +    +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H++ EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +R++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R+ LR KL+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    ++   +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLIWVLLDMFLLLYFSECNKCDEKKE--RGLPAGDVLEP--------------------VQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Match: sp|Q07537|GALT1_BOVIN (Polypeptide N-acetylgalactosaminyltransferase 1 OS=Bos taurus OX=9913 GN=GALNT1 PE=1 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 284/557 (50.99%), Postives = 377/557 (67.68%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C E+      + A  ++                      +    +GPGEMGK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS INRSP+H+L EI++VDD S++  LK  LESY+K+L VPVH+ RME R+GLIRARL GAA + G  + FLDAHCE T+GWLEPLL+ IK +RK+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS RL LR KL+C+ F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    ++   +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLIWVLLDMFLLLYFSECNKCDEKKE--RGLPAGDVLEP--------------------VQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMLEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRHKLQCRPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATDEDSQVPSIRDC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A2T7PAW6 (Polypeptide N-acetylgalactosaminyltransferase OS=Pomacea canaliculata OX=400727 GN=C0Q70_09824 PE=3 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 303/537 (56.42%), Postives = 383/537 (71.32%), Query Frame = 1
Query:   31 RKHLQWYTIKIIVLTSLFWICIQSLFLIY-NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLG-----PDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYP-VEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIY 1620
            R  LQ+   K+I+LTS+ W+ +    L+Y   C   S + +S +                      FL+K I  G     P GPGEMGKAVV+P   + ++K+ F ++QFNLVAS+M+S+NRSLPDYR+  CK KSYP + +LP TSV+IVFHNEAWSTLLRTV S INRSP  L+ E+I+VDD S++ HL  KL+ Y+ +LP+ VH+ R+E RTGLIRARL GA+ A G  L FLDAHCE T GWL+PLLSEI K+RKSVV PIIDVISDD FEYIT SDMTWGGFNWK+NF+W   P RE  RRN DR+ P  TPT+AGGLF++++ +FYELG+YD+GMDIWGGENLE+SFR WMC G++LI TCSRVGHVFRKTSPYSWPGGVA+IIN N  R   VWMD+YKDFF K NP V  T +GD+S+R  LREKL+CKSF WYL+N+YPES L + + SLG IR+  T  C+DT+ +K+   VG+  CH +GGNQ++++     + +D+LCLD  S+   PVK+  C     N K+ Y
Sbjct:    5 RIRLQY--CKVIILTSMVWVMVDVFVLMYFTDCTNTSNSCNSGNNGAANGGGLTKQDSPG------FLDKIIPKGLLTKTPTGPGEMGKAVVVPKDQEAQAKELFKINQFNLVASDMMSLNRSLPDYRMDGCKKKSYPTLNELPKTSVVIVFHNEAWSTLLRTVWSIINRSPWELVEEVILVDDASEKEHLGRKLDDYVAKLPLRVHVVRLEKRTGLIRARLKGASVAKGQVLTFLDAHCECTEGWLQPLLSEIHKDRKSVVCPIIDVISDDTFEYITGSDMTWGGFNWKLNFRWYPVPQRELDRRNGDRAVPTRTPTMAGGLFSIDRDYFYELGSYDEGMDIWGGENLEMSFRIWMCGGQILIVTCSRVGHVFRKTSPYSWPGGVARIINHNTQRIVEVWMDDYKDFFYKINPGVKATEYGDVSERKILREKLQCKSFRWYLENVYPESQLPLDYHSLGEIRNKETNQCVDTMGRKSGEKVGLVMCHGQGGNQIFSYTKKKALQTDDLCLD-VSALGGPVKLFQCHGLGGNQKWEY 532          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A210PGQ1 (Polypeptide N-acetylgalactosaminyltransferase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19258 PE=3 SV=1)

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 299/561 (53.30%), Postives = 387/561 (68.98%), Query Frame = 1
Query:   31 RKHLQWYTIKIIVLTSLFWICIQSLFLIYNSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLG-----PDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSY-PVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATSP 1695
            R  LQ+   K+I++TS+ W  I    L+Y +   +  A+ S +  K     +       +   + FL K +  G     P GPGEMGK VV+P+  + E+K+ F ++QFNLVAS+M+S+NRSLPDYR+  CK K Y PV  LP TS++IVFHNEAWSTLLRTVHS INRSP  LL EII+VDD S++  L  KLE Y+  L V   + R E+R GLIRARL GAA A G  + FLDAHCE T GWLEPLL+EI K+R SVV PIIDVISDD FEYIT SDMTWGGFNWK+NF+W   P RE  RRN DRS P  TPT+AGGLFA+++ +FYE+G+YD+GMDIWGGENLE+SFR WMC G++ I TCSRVGHVFRKTSPYSWPGGVA+IIN N  R   VWMDEYK+FF K NP+V  T++GD++ R ++R+K  CKSF WYL+N+YPES + + + +LG IR+  T  CID++ +K+   VG+ +CH  GGNQ++++     + +D+LCLD  SS   PVK+  C     N ++ Y+  + +++   +  CL    GA  P
Sbjct:    4 RVRLQY--CKVILVTSMVWFLIDVFILMYYT---DCAAMGSGAECKGKNDNQPRMDDKHRGSDEGFLGKLLPKGLIQRPPTGPGEMGKGVVVPSDRQSEAKEKFKINQFNLVASDMMSLNRSLPDYRMDACKRKKYAPVADLPTTSIVIVFHNEAWSTLLRTVHSIINRSPPRLLKEIILVDDASEREELGRKLEKYIATLSVSTKVMRSEARNGLIRARLTGAAAAKGDVITFLDAHCECTEGWLEPLLAEIHKDRTSVVCPIIDVISDDTFEYITGSDMTWGGFNWKLNFRWYPVPQRELDRRNGDRSNPTKTPTMAGGLFAIDRSYFYEVGSYDEGMDIWGGENLEMSFRVWMCGGQVFIVTCSRVGHVFRKTSPYSWPGGVARIINHNTQRIVEVWMDEYKEFFYKINPAVKSTSYGDVTARKDMRKKANCKSFRWYLENVYPESQMPVDYFALGEIRNKETGHCIDSMGRKSGEKVGLVNCHGMGGNQIFSYTKKKALQTDDLCLD-VSSIGGPVKLFQCHGLGGNQQWEYNGQSLELRHINSKQCL----GAAKP 554          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: K1R324 (Polypeptide N-acetylgalactosaminyltransferase OS=Crassostrea gigas OX=29159 GN=CGI_10026144 PE=3 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 292/493 (59.23%), Postives = 360/493 (73.02%), Query Frame = 1
Query:  253 PDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPV-EQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYD------PNAKQIKSKYNGLCLSFTQGATSPILDDC 1710
            P GPGEMGK VVIP   + ESK+ F ++QFNLVAS+M+S+NRSLPDYR+  CK KSYP    LP+TSV+IVFHNEAWSTLLRTVHS INRSP+ LL+EI++VDD S++  L  KLE Y+ +LPV   + R E RTGLIRARL GA +A G  + FLDAHCE T GWLEPLL EI K+R +VV PIIDVI DD+FEYIT SDMTWGGFNWK+NF+W   P RE  RR  DRS P  TPT+AGGLF++++ +FYE+G+YD+GMDIWGGENLE+SFR WMC GK+ I TCSRVGHVFRKTSPYSWPGGVA+IIN N  R   VWMDEYKDFF K NP V  T++GD+S+R  LREKL CKSF WYL+N+YPES + + + +LG IR+  T  CID++ +K+   VGM  CH  GGNQ++++     + +D++CLD  SS   PVK+  C     N K+ YD        +KQ+ +  N LC+  T    SP+   C
Sbjct:  112 PTGPGEMGKPVVIPLDRQAESKEKFKINQFNLVASDMISLNRSLPDYRMDACKRKSYPPNSDLPDTSVVIVFHNEAWSTLLRTVHSIINRSPRELLNEILLVDDASEREELGKKLEDYIARLPVSTRVIRSEERTGLIRARLKGAKQARGKVITFLDAHCECTEGWLEPLLYEIHKDRTAVVCPIIDVIGDDSFEYITGSDMTWGGFNWKLNFRWYPVPQRELDRRGGDRSNPTKTPTMAGGLFSIDRDYFYEVGSYDEGMDIWGGENLEMSFRVWMCGGKVYIVTCSRVGHVFRKTSPYSWPGGVARIINHNTQRIVEVWMDEYKDFFYKINPGVRSTSYGDVSERKALREKLHCKSFKWYLQNVYPESQMPVEYHALGEIRNKATGQCIDSMGRKSGEKVGMVQCHGMGGNQIFSYTKKQALQTDDVCLD-VSSLHGPVKLFQCHGLGGNQKWEYDRQVFAYTGSKQLATDDN-LCVDAT--YNSPVFTRC 600          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A0L8H986 (Polypeptide N-acetylgalactosaminyltransferase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22020538mg PE=3 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 281/470 (59.79%), Postives = 354/470 (75.32%), Query Frame = 1
Query:  259 GPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL 1668
            GPGE GK V++P Y + ESK+ F ++QFNLVAS+M+S+NRSLPDYR+  CK K+Y +E+   TS+IIVFHNEAWSTLLRTVHS INRSP  LL E+IMVDD S++ +L  KL+ Y+ +L   VH+ R+E RTGLIRARL GAA A G+ L FLDAHCE + GWLEPL++EI K+RKSVV PIIDVISDD FEYIT SDMTWGGFNWK+NF+W   P RE  RR+ DR+ P  TPT+AGGLFA+E+ +FYE+G+YD+GMDIWGGENLE+SFR WMC G++ I TCSRVGHVFRKTSPYSWPGGVA+IIN N MR   VWMDEYK+FF K NP V   +FGDIS+R+E R+K KCKSF WYL+NIYPES + + + S+G IR+  +  C+D++ +K+   VGM SCH  GGNQ++++     + +D++CLD  S+   PVK+  C     N  + YD     +K   +  CL
Sbjct:  111 GPGEYGKPVIVPAYRQQESKEKFKINQFNLVASDMISLNRSLPDYRMDGCKKKTYTIEKYLKTSIIIVFHNEAWSTLLRTVHSIINRSPPELLEEVIMVDDASERDYLGKKLDDYVAKLGAKVHIVRLEERTGLIRARLKGAAVAKGSILTFLDAHCECSPGWLEPLIAEIHKDRKSVVCPIIDVISDDTFEYITGSDMTWGGFNWKLNFRWYPVPQREMQRRDGDRALPTKTPTMAGGLFAIERDYFYEIGSYDEGMDIWGGENLEMSFRIWMCGGQIFIVTCSRVGHVFRKTSPYSWPGGVARIINHNTMRIVEVWMDEYKEFFYKINPGVRSADFGDISERVEFRKKKKCKSFRWYLENIYPESQMPLDYYSVGEIRNKASGLCLDSMGRKSGEKVGMVSCHGFGGNQIFSYTKKQALQTDDVCLD-VSAVGGPVKLFQCHGLGGNQIWEYDKETLSLKHVNSNQCL 579          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Match: A0A0L8H7R2 (Polypeptide N-acetylgalactosaminyltransferase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22020538mg PE=3 SV=1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 281/470 (59.79%), Postives = 354/470 (75.32%), Query Frame = 1
Query:  259 GPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL 1668
            GPGE GK V++P Y + ESK+ F ++QFNLVAS+M+S+NRSLPDYR+  CK K+Y +E+   TS+IIVFHNEAWSTLLRTVHS INRSP  LL E+IMVDD S++ +L  KL+ Y+ +L   VH+ R+E RTGLIRARL GAA A G+ L FLDAHCE + GWLEPL++EI K+RKSVV PIIDVISDD FEYIT SDMTWGGFNWK+NF+W   P RE  RR+ DR+ P  TPT+AGGLFA+E+ +FYE+G+YD+GMDIWGGENLE+SFR WMC G++ I TCSRVGHVFRKTSPYSWPGGVA+IIN N MR   VWMDEYK+FF K NP V   +FGDIS+R+E R+K KCKSF WYL+NIYPES + + + S+G IR+  +  C+D++ +K+   VGM SCH  GGNQ++++     + +D++CLD  S+   PVK+  C     N  + YD     +K   +  CL
Sbjct:   89 GPGEYGKPVIVPAYRQQESKEKFKINQFNLVASDMISLNRSLPDYRMDGCKKKTYTIEKYLKTSIIIVFHNEAWSTLLRTVHSIINRSPPELLEEVIMVDDASERDYLGKKLDDYVAKLGAKVHIVRLEERTGLIRARLKGAAVAKGSILTFLDAHCECSPGWLEPLIAEIHKDRKSVVCPIIDVISDDTFEYITGSDMTWGGFNWKLNFRWYPVPQREMQRRDGDRALPTKTPTMAGGLFAIERDYFYEIGSYDEGMDIWGGENLEMSFRIWMCGGQIFIVTCSRVGHVFRKTSPYSWPGGVARIINHNTMRIVEVWMDEYKEFFYKINPGVRSADFGDISERVEFRKKKKCKSFRWYLENIYPESQMPLDYYSVGEIRNKASGLCLDSMGRKSGEKVGMVSCHGFGGNQIFSYTKKQALQTDDVCLD-VSAVGGPVKLFQCHGLGGNQIWEYDKETLSLKHVNSNQCL 557          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 282/559 (50.45%), Postives = 375/559 (67.08%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSF--TQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C  +++ + + ++ A                          +    +GPGEMGKAV+IP   +++ K+ F ++QFNL+AS+M+++NRSLPD R+  CK+K YP + LPNTS++IVFHNEAWSTLLRTVHS INRSP+HLL EI++VDD S++  LK KLE Y+K L VPV + RME R+GLIRARL GAA   G  + FLDAHCE T+GWLEPLLS IK++RK+VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PYS+PGG  Q+INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE L+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  F YD     +    +  CL     +    P L DC
Sbjct:    8 KVVLTTSLVWVLVDVFLLLYFSECNKCDDRKDRSLLPALRA-------------------------VMSRTHEGPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYP-DDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIPRRYFSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 281/560 (50.18%), Postives = 376/560 (67.14%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQ---GATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C  +++ + + ++ A                          +    +GPGEMGKAV+IP   +++ K+ F ++QFNL+AS+M+++NRSLPD R+  CK+K YP + LPNTS++IVFHNEAWSTLLRTVHS INRSP+HLL EI++VDD S++  LK KLE Y+K L VPV + RME R+GLIRARL GAA   G  + FLDAHCE T+GWLEPLLS IK++RK+VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PYS+PGG  Q+INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE L+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  F YD             CL+ ++   G   P ++ C
Sbjct:    8 KVVLTTSLVWVLVDVFLLLYFSECNKCDDRKDRSLLPALRA-------------------------VMSRTHEGPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYP-DDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIPRRYFSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLNGPVVMLKCHHMKGNQMFEYDAEKGTFMHIITQSCLTISRLEDGTYGPTVEYC 540          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 281/557 (50.45%), Postives = 375/557 (67.32%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATS--PILDDC 1710
            K+++ TSL W+ +    L+Y    N C ++         D+ +                   ++ +    DGPGEMGK VVIP    ++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAW+TLLRTVHS INRSP+HLL E+++VDD S++  LK KLE Y+++L VPV + RME R+GLIRARL GA+ +TG  + FLDAHCE TMGWLEPLLS IK+++K+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDI+ R  LR+KL+CK F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    +    +  CL       S  P + DC
Sbjct:    8 KVVLATSLVWVMLDMFILLYFSECNKCDDKK--------DRGLPGR----------------DEVVPRPHDGPGEMGKPVVIPKEQHEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKVYP-DDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRKLEVPVRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDIATRASLRQKLQCKPFSWYLENVYPDSQIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVMMLKCHHLKGNQLWDYDPLKLSLVHVNSNQCLDKASEDDSQVPSVRDC 538          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:103031512])

HSP 1 Score: 517.694 bits (1332), Expect = 4.031e-172
Identity = 259/459 (56.43%), Postives = 327/459 (71.24%), Query Frame = 1
Query:  256 DGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLG---------WIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFN--------VNGNIISDELCLDGSSSRSSPVKMV 1581
            DGPGEMGK VVIP    ++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAW+TLLRTVHS INRSP+HLL E+++VDD S++  LK KLE Y+++L VPV + RME R+GLIRARL GA+ +TG  + FLDAHCE TMGWLEPLLS IK+++K+VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDI+ R  LR+KL+CK F+WYL+N+YP+S +   + SLG          IR D    C+D    K +  V M  CH+  GNQLW ++        VN N      CLD +S   S V  V
Sbjct:   54 DGPGEMGKPVVIPKEQHEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKVYP-DDLPRTSVVIVFHNEAWTTLLRTVHSVINRSPRHLLEEVVLVDDASERDFLKRKLEQYVRKLEVPVRIVRMEQRSGLIRARLKGASLSTGQVITFLDAHCECTMGWLEPLLSRIKQDKKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDIATRASLRQKLQCKPFSWYLENVYPDSQIPRHYYSLGEVFSYTANKEIRTD--DLCLDV--SKLNGPVMMLKCHHLKGNQLWDYDPLKLSLVHVNSN-----QCLDKASEDDSQVPSV 502          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:103039482])

HSP 1 Score: 516.538 bits (1329), Expect = 9.668e-172
Identity = 267/559 (47.76%), Postives = 355/559 (63.51%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSF--TQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C  +++ + + ++ A                          +    +GPGEMGKAV+IP   +++ K+ F ++QFNL+AS+M+++NRSLPD R+  CK+K YP + LPNTS++IVFHNEAWSTLLRTVHS INRSP+HLL EI++VDD S++  LK KLE Y+K L VPV + RME R+GLIRARL GAA   G  + FLDAHCE T+GWLEPLLS IK++RK+VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PYS+PGG  Q+INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE L+CK F+WYL+NIYP+S +   + SLG                                 +++++  +  I +D+LCLD  S  + PV M+ C     N  F YD     +    +  CL     +    P L DC
Sbjct:    8 KVVLTTSLVWVLVDVFLLLYFSECNKCDDRKDRSLLPALRA-------------------------VMSRTHEGPGEMGKAVIIPKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVYP-DDLPNTSIVIVFHNEAWSTLLRTVHSVINRSPRHLLVEILLVDDASERDFLKKKLEDYVKTLEVPVRILRMEQRSGLIRARLRGAAATRGQVITFLDAHCECTVGWLEPLLSRIKEDRKAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRSYFEEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVVRVDYGDVSARKALREALQCKPFSWYLENIYPDSQIPRRYFSLG---------------------------------EVFSYTADKEIRTDDLCLD-VSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDC 506          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000477.1 (pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 gene:ENSPMAG00000000418.1 transcript:ENSPMAT00000000477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 483.797 bits (1244), Expect = 7.969e-161
Identity = 234/439 (53.30%), Postives = 312/439 (71.07%), Query Frame = 1
Query:  406 CKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKY--NGLCL--SFTQGATSPILDDC 1710
            CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS I RSP+H+L EII+VDD S++  LK  LE Y  +LPVPVH+ RMESR+GLIRARL GAA + G  + FLDAHCE T GWLEPLL+ IK +RK+VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P  E  RR  DR+ P+ +PT+AGGLFA+++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PY++PGG  Q+INKN  R A VWMD +KDFF   +P V    +GD+S+R  LR++LKCK F+W+L+N+YP S +   + SLG +R+  T  C+D + +K +  +G+F+CH+ GGNQ++++  +  + +D+LCLD  S  + PV M+ C     N  + YD   +++  ++  +  CL  +  Q    P + +C
Sbjct:    1 CKTKVYP-DGLPKTSVVIVFHNEAWSTLLRTVHSIIGRSPRHMLEEIILVDDASERDFLKSPLEEYASKLPVPVHIVRMESRSGLIRARLRGAAVSRGQVITFLDAHCECTTGWLEPLLARIKADRKNVVCPIIDVISDETFEYLAGSDMTYGGFNWKLNFRWYPVPQSEMDRRKGDRTIPVRSPTMAGGLFAIDRDYFQEIGTYDAGMDIWGGENLEMSFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQVINKNNRRLAEVWMDNFKDFFYIISPGVTKVEYGDVSQRKALRDRLKCKPFSWFLENVYPNSQIPRHYYSLGEVRNVETNQCLDNMGRKENEKIGIFNCHSMGGNQVFSYTADKELRTDDLCLD-VSRMNGPVLMLKCHHMKGNQLWDYDQQMQKLIMRHTNSNQCLDKATEQDRQVPTMREC 437          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010805.1 (pep scaffold:Pmarinus_7.0:GL478309:9001:42806:-1 gene:ENSPMAG00000009786.1 transcript:ENSPMAT00000010805.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 391.349 bits (1004), Expect = 3.092e-126
Identity = 198/379 (52.24%), Postives = 260/379 (68.60%), Query Frame = 1
Query:  580 LKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            LK  LE Y+++L  PV L RM  R+GLIRARL GAA A G  + FLDAHCEAT GWLEPLL+ IK++R++VV P+IDVISD+ FEY+T SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLFA+++ +F E+G YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PY++PGG  Q+INKN  R A VWMDE+K FF   +P V    +GD+S R  LRE+LKC  F+WYL+N+YP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++     + SD+LCLD  S  S PV M+ C     N  + YD     ++   +  CL  +  +   +P + DC
Sbjct:    7 LKKPLEDYVRKLETPVRLLRMAQRSGLIRARLRGAAAAQGQVITFLDAHCEATTGWLEPLLARIKEDRRAVVCPVIDVISDETFEYLTGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFAIDRDYFQEIGTYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGQVINKNNRRLAEVWMDEFKGFFYVISPGVTKVEYGDVSARKALRERLKCMPFSWYLENVYPDSQIPRHYYSLGEIRNMETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTAEQELRSDDLCLD-VSRLSGPVMMLKCHHLKGNQLWHYDREKMTLRHVNSNQCLDKAGEEDRQAPTISDC 384          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt11 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 11 (GalNAc-T11) [Source:ZFIN;Acc:ZDB-GENE-060929-998])

HSP 1 Score: 363.614 bits (932), Expect = 2.346e-114
Identity = 194/442 (43.89%), Postives = 273/442 (61.76%), Query Frame = 1
Query:  325 FHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQ-LPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPF---------------TSLGWIRHDFTKFCIDTLDKKADSD--VGMFSCHNEGGNQLWAFNVNGNI-ISDELCLDGS--SSRSSPVKMVTC 1587
            +  H FNL+ SN +  +R++PD R   C +KSYP  QLP  SV+I F+NEA S LLRTVHS   R+P  LLHE+++VDD+SD V L+  LE  LK+  P  V L R E R GLIR R+ GA  ATG  L+FLD+HCE  + WLEPLL+ + +N  +VV PIID+++ D F Y +AS +  GGFNW ++F+W+  P    +   +    P+ +PT+AGGLFA+++K+F +LG YD GMDIWGGENLEISFR WMC G L I  CSR+GH+FRK  PY  P G A  +++N +R A VW+DEYK+ ++   P +    +GD+S+R  LRE+L C+ F WYL+N+YPE  +  P                   G +RH  T  C+   +  ++    V +  C +    Q+W +N    + +++ LCLD      R+SP +++ C
Sbjct:   16 YQKHAFNLLISNRLDPHRTIPDTRHPRCATKSYPA-QLPTASVVICFYNEAVSALLRTVHSVTERTPPALLHEVLLVDDFSDLVDLREGLEKELKEKFPKKVKLVRNEKREGLIRGRMVGANHATGDVLVFLDSHCEVNVAWLEPLLARVAENPSTVVCPIIDIVNPDTFLY-SASPLVRGGFNWGLHFRWDPVP-SSLLSGPDGEMAPIKSPTMAGGLFAMDRKYFNKLGQYDGGMDIWGGENLEISFRIWMCGGSLEIIPCSRIGHIFRKRRPYGSPAG-ADTMSRNSLRLAHVWLDEYKEQYLALRPELREREYGDVSERKALRERLGCRPFRWYLQNVYPEIEVGRPQLPQAVLSKMHKRPKPVQRGRLRHLQTGKCLVAHNDPSEKGGLVVVRPCDSGDIEQVWVYNEGQELQLANLLCLDMPEMEPRASP-RLMKC 452          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: galnt2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-041111-110])

HSP 1 Score: 352.058 bits (902), Expect = 1.949e-111
Identity = 194/378 (51.32%), Postives = 234/378 (61.90%), Query Frame = 1
Query:  436 LPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENL------EISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIP---FTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCL 1542
            LP TSVII FHNEA STLLRTV S +N+SP HL+ EII+VDDYSD       L    K     V   R E R GL+R+R+ GA  A  A L FLD+HCE    WLEPLL  + ++R  VV PIIDVI+ DNF+Y+ AS    GGF W + FKW+     +   R    + P+ TP IAGGLF +EK +F ELG YD  MDIWGGENL      EISFR W C G L I  CSRVGHVFRK  PYS+PGG   +  +N  R A VWMDEYK+F+    PS    +FG+I  RLELREKLKCK F WYL N+YPE  L +P     + G ++      C+DT+   AD  VG++ CHN GGNQ WAF    ++   +LCL
Sbjct:   10 LPATSVIITFHNEARSTLLRTVVSVLNKSPAHLIREIILVDDYSDDPEDGKLLAKIEK-----VKTIRNEKREGLMRSRVRGADIAESAILTFLDSHCECNEHWLEPLLERVAEDRTRVVCPIIDVINMDNFQYVGASADLKGGFEWNLVFKWDYLTPEQRKARQTTPTSPIRTPMIAGGLFVMEKAYFEELGKYDMMMDIWGGENLGSAPRAEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYSFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARSVSFGNIQGRLELREKLKCKPFKWYLDNVYPE--LRVPDKQDVAFGALQQGAN--CLDTMGHFADGTVGVYECHNAGGNQEWAFTKEKSLKHIDLCL 378          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Match: poc1bl (POC1 centriolar protein homolog B (Chlamydomonas), like [Source:ZFIN;Acc:ZDB-GENE-050306-41])

HSP 1 Score: 357.451 bits (916), Expect = 5.233e-111
Identity = 216/528 (40.91%), Postives = 295/528 (55.87%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIYNSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVI-------PNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFE-YITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGW----IRHDFTKFCID---TLDKKADSDVGMFSCHNEGGNQLWAFNVNGNI---ISDELCLDGSSSRSSPVKMVTC 1587
            + +VL SL W     + L+ +S +E+S       A      EK  S    +  L R L           GE  KA  +          L++ES + + L   N+  S+ +S++R +PD R+  CK++ +   +LP TSV+I F+NEAWSTLLRTVHS +  SP  LL EII+VDD+SD+ +LK  LE Y+  L   V L R   R GL+RARL GA  ATG  L FLD HCE   GW+EPLL  I +   +VV P+ID I  + FE Y+  S+   GGF+W++ F+W+  P  E  RR + R EP+ +PT+AGGLFAV KK+F  +G YD GM++WGGENLE+SFR W C G L +  CS VGHVF K +PY  P  +     +N +R A VWMD YK+ F   NP      +GD+S+R  LREKL CKSF WYLKNIYP+  L +P    G+            CID     +    + + ++ CH +GGNQ + +    ++    + ELC +    +   V M  C
Sbjct:   14 RALVLLSLVWFAYVLVQLVTSSSREQSE-----RAQPFEPAEKGESQEVVEEDLSRPLYSKPPPDERALGEWAKAARLNLPEGSSERKLEEESIERYAL---NIYLSDRISLHRHIPDGRMYECKAQKFDYRRLPTTSVVIAFYNEAWSTLLRTVHSVLESSPAVLLREIILVDDFSDRAYLKSPLEDYISTLER-VRLVRTTQREGLVRARLLGATHATGQVLTFLDCHCECVPGWIEPLLQRIWEKETAVVCPVIDTIDWNTFEFYMQTSEPAIGGFDWRLTFQWHGVPEHERSRRAS-RIEPIQSPTMAGGLFAVSKKYFDHIGTYDQGMEVWGGENLELSFRVWQCGGSLEVHPCSHVGHVFPKKAPYPRPRFL-----QNTVRAAEVWMDSYKEHFYNRNPPGRKEKYGDLSERKTLREKLGCKSFEWYLKNIYPD--LHVPEDRPGFHGAIQNKGIQSECIDYNAPDNNPTGAMLSLYPCHGQGGNQFFEYTTRKDLRFNSATELCAEVRDGKPQ-VAMRHC 523          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 100.523 bits (249), Expect = 7.127e-22
Identity = 64/188 (34.04%), Postives = 99/188 (52.66%), Query Frame = 3
Query: 2790 IIYHCS*GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEY-LNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQ 3350
            I+ HC+ GSLR+ L+  G + E  I  I  ++L+ ++ IH+  +IHRDI + N++     N KL DFG++  VN  S        ++ + G   ++APE  +    Y  KVDIWS G  T E+ TG  PY  ++   A   I K+K    +  +  S  L  F  LCL+ DP+ R +   L ++ FI+
Sbjct:   98 IMEHCAGGSLRSLLRP-GKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTS------LRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLED-RSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIR 277          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 95.5153 bits (236), Expect = 1.562e-20
Identity = 60/190 (31.58%), Postives = 90/190 (47.37%), Query Frame = 3
Query: 2766 QRFGNVPPIIYHCS*GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQ 3335
            Q  GN+   + +   GS+ + L   G   E  I+    QIL+ +  +H+  IIHRDI   NI+ D     K+ DFGISK    +SP    +  +  + G++ +++PE +     + K DIWS G V +EMFTG  P+    +  A  +I      T + P   + E  NF R     D Q R +   L Q
Sbjct:  524 QEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKK---LSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTN--TTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQ 708          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 91.2781 bits (225), Expect = 4.066e-19
Identity = 56/176 (31.82%), Postives = 84/176 (47.73%), Query Frame = 3
Query: 2847 LVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK 3374
            L EG I  +C + L  +E +H   ++HRDI S NI+     + KL DFG    +N     +L+ K    + G   ++APE ++ + Y  KVDIWS G + +EM  G  PY +     A   IA       K P+ +S  L  F   CL  +P+ R++       L    Y+  IA+
Sbjct:  711 LTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQIN-----ELNLKRTTMV-GTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATE----LLHDEYITEIAE 876          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 85.5001 bits (210), Expect = 1.544e-18
Identity = 58/192 (30.21%), Postives = 88/192 (45.83%), Query Frame = 3
Query: 2790 IIYHCS*GSLRAYLKQ--VGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNE--PYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQN 3353
            ++ +C  GS    LK+  V GL E  +S I H++ L ++ +H  + IHRDI + NI+ +E    KL DFG+S ++        S   +    G   ++APE +  E   Y+EK DIWS G  T E+  G  P            + K K    +   P S    +F   CL   P  R + + L    F++N
Sbjct:   92 VMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIR-------STLKRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQG--PFSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVKN 274          

HSP 2 Score: 25.409 bits (54), Expect = 1.544e-18
Identity = 20/73 (27.40%), Postives = 35/73 (47.95%), Query Frame = 2
Query: 2558 LAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDD-----LYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKY 2761
            +  G FG VY   D+V+ E   +K    ++ D     L +EI    +L+S   I  Y    L++  +++ M+Y
Sbjct:   24 IGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSP-LITNYIATMLEDVSMWIVMEY 95          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 88.9669 bits (219), Expect = 2.291e-18
Identity = 58/168 (34.52%), Postives = 84/168 (50.00%), Query Frame = 3
Query: 2790 IIYHCS*GSLRAYL-KQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCL 3290
            ++ +C+ GSLR  + +   GL E +      Q LL ++ +H   +IHRDI + NI+    +  KL DFG+S  VN       S  L   + G + ++APE L N   S   DIWS GA  VEM T   PYH+L    A++  A  +  T+  P   S+ L +F   C 
Sbjct:   98 LLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVN-------SSALT--LAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTD--ANIYYA-VENDTYYPPSSFSEPLKDFLSKCF 253          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO43861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXK4])

HSP 1 Score: 417.542 bits (1072), Expect = 7.793e-136
Identity = 214/416 (51.44%), Postives = 283/416 (68.03%), Query Frame = 1
Query:  268 EMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASD-MTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSW---PGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIP---FTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQL 1494
            +MG+AV +P  LK++ ++ + LH FNLVAS+M+S+ R LPDYR   CK+K YP+  LP +S+II FHNEAWSTLLRTVHS INR+P  LL EI+++DD S++  LK KLE Y+ +L V V + R+  R GLIRARL GAA A G+ L FLDAHCE + GWLEPL ++I +N  +VV P+ID ISD  F Y    +    G F W++ F W   P  E + R  D ++ + TP +AGGLF+++K +F ++G YD GMDIWGGENLEISFR WMC G + +  CSRVGHVFR   PYS+   PG    +++ NLMR A VWMDEYK  F      +      D+S+RL LREKLKCK+F WYL N+YPE  L +P   F + G +R+  +  C+DTL KK D+ +G++ CH +GGNQ+
Sbjct:    2 DMGEAVSVPKRLKEKEEEGYELHSFNLVASDMMSLYRRLPDYRNDACKAKKYPL-HLPKSSIIICFHNEAWSTLLRTVHSVINRTPPRLLEEILLIDDASNRDELKEKLEEYVAKLKV-VRIIRLSKRQGLIRARLKGAAAAKGSILTFLDAHCECSKGWLEPLAAKIAENSSNVVMPVIDEISDTTFYYHAVPEPFHRGVFRWRLEFGWKPVPQYE-MERRKDEADGIRTPVMAGGLFSIDKNYFEKIGTYDTGMDIWGGENLEISFRIWMCGGAIEMLPCSRVGHVFRPRFPYSFPARPGHNTDVVSNNLMRVADVWMDEYKKHFYNIRFDLKRKQHDDVSQRLALREKLKCKNFKWYLDNVYPE--LEVPDTNFAASGQVRNPSSDMCLDTLGKKDDTPLGLYQCHGQGGNQV 412          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO37266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG81])

HSP 1 Score: 406.757 bits (1044), Expect = 1.611e-130
Identity = 227/495 (45.86%), Postives = 306/495 (61.82%), Query Frame = 1
Query:  259 GPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKS--YPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDM--TWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRK-TSPYSWPGGVAQIINKNLMRTALVWMDEYKD-FFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGW---IRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNII-SDELCLDG-SSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATSPILDDC 1710
            G G++G+A  +P   K+ +   F  H FN++ S+ +S++R L D R   CK K   YP   LP TSVII FHNEA S LLRTVHS +N SP  L+ +II+VDDYS+   LK  L  ++  L   V L RM SR GL+ ARL GA  A G  L FLD+HCEAT GWLEPLL  I ++R++VV P+I+VI+ D+F Y  ASD+    GGF W + F W   P  E  RR  D ++ + +PT+AGGLFA+ KK+FY+LG+YD  M+IWGGENLE+SFR WMC G+L I  CSRVGHVFRK TSPY +P G    + +N  R A VWMDEYKD ++ K        + GDIS R+ LR++L CKSF WYL NIYP+ +  +P  S  +   IR+  +  C+DTL +K    VG+++CH  GGNQ +    +  I+ +D+ CLD  +    S V+M+TC     N ++ ++     I   +   CL  +Q     I++ C
Sbjct:    1 GLGDLGEAATLPTRFKEHAAHAFDNHSFNVMLSDRISLDRRLKDVRGPKCKRKHKLYP-RALPTTSVIICFHNEALSVLLRTVHSVLNESPPRLIADIILVDDYSEYDDLKQPLIDHISMLN-KVKLIRMPSRQGLVPARLRGAEEARGEVLTFLDSHCEATPGWLEPLLVRIAEDRRNVVCPVIEVINADDFRY-QASDVIHERGGFTWDLFFTWKAIPEAEKKRRK-DETDYIRSPTMAGGLFAIHKKYFYDLGSYDSKMEIWGGENLEMSFRIWMCGGQLEIVPCSRVGHVFRKYTSPYKFPKGTTTTLARNFNRLAEVWMDEYKDHYYRKKTEEERNVDIGDISDRVALRKRLGCKSFKWYLDNIYPDMTNKLPPKSYLYSHQIRNKESSLCLDTLGEKNIKRVGLYTCHGMGGNQFFTLTKSNEILFNDDKCLDSPNGDPGSYVEMITCHGLKGNQEWKHNKRMGTIVHVWTENCLDISQDGQFIIVNPC 491          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV7])

HSP 1 Score: 402.905 bits (1034), Expect = 9.173e-129
Identity = 214/457 (46.83%), Postives = 301/457 (65.86%), Query Frame = 1
Query:  292 PNYLKDE-----SKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSK--SYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTW-GGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRK-TSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSL-SIPFTSLGWIRHDFTKFCIDTLDKKADSD--VGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSR-SSPVKMVTCELTSVNLKFIYD 1623
            P +L+ E     ++K F  H FN + S+ +S++R+L D R   CK+K  +YP  +LP TSVII FH E  S LLRTVHS INR+P  LL E+I+VDD+S    L   L+ ++ Q    V + RM+ R GL+RARL GA  A G  L FLD+HCEAT GW EPLL+ I  +R++VV P I+VI+ D F Y  +++    GGF+W + FKW   P  E   RN+D S+P+ TPT+AGGLF++ +++F+++G+YD+ MDIWGGENLE+SFR WMC G+L I TCSRVGHVFRK TSPY +P GV + + KN  R A VWMDEYKD +    P    +++GDISKRLELR++LKCKSF WY+ NIYP+  +  +   + G +R+  +  C+D+L  K + +  VG+++CH +GGNQ+  +     I  +E C D S +   +PV+++ C     N ++ +D
Sbjct:   13 PAFLESEENKKLAEKYFANHSFNWLLSDKISLDRTLDDVRSERCKAKHNTYPA-KLPTTSVIICFHKERLSVLLRTVHSVINRTPPELLAEVIVVDDFSQDAKLGKPLDDHVAQF-TKVKVLRMKKREGLVRARLQGANTAKGDVLTFLDSHCEATPGWAEPLLARIAADRRNVVCPAIEVINADTFAYQGSTNADQRGGFSWDLFFKWKGIPPEEQKLRNDD-SDPIRTPTMAGGLFSIHRQYFFDIGSYDEEMDIWGGENLELSFRVWMCGGRLEIVTCSRVGHVFRKYTSPYKFPDGVERTLTKNFNRLAEVWMDEYKDLYYNKKPQAKNSDYGDISKRLELRKRLKCKSFKWYINNIYPDVQMPELDPPARGEVRNPSSNQCLDSLGAKPEHNARVGIYTCHGQGGNQVSKYMPRELIFEEENCFDVSKTHPGAPVELMKCHGMRGNQEWKHD 466          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO45830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRV8])

HSP 1 Score: 381.333 bits (978), Expect = 2.305e-122
Identity = 209/404 (51.73%), Postives = 264/404 (65.35%), Query Frame = 1
Query:  304 KDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYS---DQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGG-FNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIP---FTSLGWIRHDFTKFCIDTLDK-KADSDVGMFSCHNEGGNQ 1491
            K+  K+ F L+QFN +AS+ V+++RS+PD R   C S SYP  +LP  SVII+FHNEAWSTLLRTVHS + RSP +LL EI++VDD+S      HL  KLESY+ Q    V L R   R GLIRARL GA +A G  L+FLD+HCEA +GWLEPLL+ I +NR  VV P I+VI    F Y         G FNW++ FKW   P  E  RR +D S+P+ +PT+AGGLFA++K +FYE+G+YD  M  WGGEN+EISFR WMC G L I  CS+VGHVFR++ PY    G    I++N MR A VWMD+YK  F    P + G ++GD+S R  LRE+L CKSF WYL N+  E  L+IP       G IR+  T  C+DTL K +A  + GM+ CH  G NQ
Sbjct:    3 KEIEKERFRLYQFNELASSKVALDRSIPDNRPQSCLSLSYPT-KLPTASVIIIFHNEAWSTLLRTVHSVLARSPPYLLREIVLVDDHSRLDTYGHLGSKLESYISQF-TKVQLIRAPKREGLIRARLIGAKQAKGEVLVFLDSHCEANLGWLEPLLARIGENRSIVVTPDIEVIDLRTFGYTHEHGANNRGIFNWELTFKWRGIPEYERRRRKSD-SDPIRSPTMAGGLFAIDKSYFYEIGSYDTEMSFWGGENVEISFRIWMCGGSLEIIPCSKVGHVFRESQPYKIGEGA---IDRNNMRLAEVWMDDYKKIFYAMRPQLKGKDYGDVSGRKALRERLMCKSFKWYLDNVISE--LAIPDLYPIGRGEIRNLGTNTCLDTLAKNEAGGEPGMYMCHGMGNNQ 398          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Match: EDO30269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T197])

HSP 1 Score: 375.941 bits (964), Expect = 7.057e-119
Identity = 211/460 (45.87%), Postives = 281/460 (61.09%), Query Frame = 1
Query:  310 ESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVP-VHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKW-NTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFT---SLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQ--IKSKYNGLCL 1668
            E +  +  +QFN   S+ +  +R +PD R S C+ ++YP   LP TS+II FHNEA STLLRTV S +N++P +L++EII+VDD+SD        E  L  + +P V + R   R GLIR+R+ G+  A    L FLD+HCE    WL+PLL  + +N+K+VV+PIIDVI+ D+F YI AS    GGF+W ++FKW N  P ++  RR+   + P+ TP IAGGLF V K +F E+G YD  MDIWGGEN EISFRTW C G + I  CSRVGHVFRK  PY++P G A    KN  RTA VWMDEYK F+    P      +G I  R ELR++L+CK F WYL+N+YPE  L IP +   S G ++    K C+DTL  +A   VGMF CH + GNQ WA      +   +LCL   S     V +  C     + K I++  + Q  ++ K +GLCL
Sbjct:   16 EGEDAYGKNQFNQAISDKIGGDRDVPDTRHSHCRYEAYP-STLPATSIIITFHNEARSTLLRTVKSILNKTPPNLVNEIILVDDFSDDA------EDGLLLMGLPKVKVLRNNKRQGLIRSRVKGSDTAKSDVLTFLDSHCECNTDWLQPLLKRVVQNKKAVVSPIIDVINMDDFSYIGASADIKGGFDWSLHFKWDNLTPEQKQSRRSTPIA-PIKTPMIAGGLFVVTKSWFEEMGKYDTMMDIWGGENFEISFRTWQCGGSMEIIPCSRVGHVFRKRHPYTFPDGNANTYMKNTRRTAEVWMDEYKRFYYAARPMARSALYGSIKSRKELRKRLQCKPFKWYLQNVYPE--LQIPDSQDVSFGELKQ--GKSCLDTLGSQAGGSVGMFDCHGQAGNQEWALTKKSTVRHLDLCLTLGS--GGAVTLEGCR--DGDPKQIWEQTSPQHTLRHKQSGLCL 459          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 279/559 (49.91%), Postives = 371/559 (66.37%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSF--TQGATSPILDDC 1710
            K+++ TSL W+ + +  L+Y    N C  +++ + + ++ A                          I    +GPGEMGKAV I    +++ K+ F ++QFNL+AS+M+++NRSLPD R+  CK+K Y  + LP TS++IVFHNEAWSTLLRTVHS I+RSP+HLL EI++VDD S++  LK KLE Y++ L VPV + RME R+GLIRARL GAA  TG  + FLDAHCE T GWLEPLL+ IK++R +VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF+++K +F E+G+YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PYS+PGG  Q+INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  F YD     +    +  CL     +    P L DC
Sbjct:    8 KVVLTTSLVWVLVDAFLLLYFSECNKCDDRKDRSLLPALRA-------------------------VISRSHEGPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVY-ADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIPRRYYSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 279/559 (49.91%), Postives = 371/559 (66.37%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSF--TQGATSPILDDC 1710
            K+++ TSL W+ + +  L+Y    N C  +++ + + ++ A                          I    +GPGEMGKAV I    +++ K+ F ++QFNL+AS+M+++NRSLPD R+  CK+K Y  + LP TS++IVFHNEAWSTLLRTVHS I+RSP+HLL EI++VDD S++  LK KLE Y++ L VPV + RME R+GLIRARL GAA  TG  + FLDAHCE T GWLEPLL+ IK++R +VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF+++K +F E+G+YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PYS+PGG  Q+INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  F YD     +    +  CL     +    P L DC
Sbjct:    8 KVVLTTSLVWVLVDAFLLLYFSECNKCDDRKDRSLLPALRA-------------------------VISRSHEGPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVY-ADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIPRRYYSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 279/559 (49.91%), Postives = 371/559 (66.37%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSF--TQGATSPILDDC 1710
            K+++ TSL W+ + +  L+Y    N C  +++ + + ++ A                          I    +GPGEMGKAV I    +++ K+ F ++QFNL+AS+M+++NRSLPD R+  CK+K Y  + LP TS++IVFHNEAWSTLLRTVHS I+RSP+HLL EI++VDD S++  LK KLE Y++ L VPV + RME R+GLIRARL GAA  TG  + FLDAHCE T GWLEPLL+ IK++R +VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF+++K +F E+G+YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PYS+PGG  Q+INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  F YD     +    +  CL     +    P L DC
Sbjct:    8 KVVLTTSLVWVLVDAFLLLYFSECNKCDDRKDRSLLPALRA-------------------------VISRSHEGPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVY-ADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIPRRYYSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt13 (polypeptide N-acetylgalactosaminyltransferase 13 [Source:NCBI gene;Acc:101172857])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 279/559 (49.91%), Postives = 371/559 (66.37%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSC--KEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSF--TQGATSPILDDC 1710
            K+++ TSL W+ + +  L+Y    N C  +++ + + ++ A                          I    +GPGEMGKAV I    +++ K+ F ++QFNL+AS+M+++NRSLPD R+  CK+K Y  + LP TS++IVFHNEAWSTLLRTVHS I+RSP+HLL EI++VDD S++  LK KLE Y++ L VPV + RME R+GLIRARL GAA  TG  + FLDAHCE T GWLEPLL+ IK++R +VV PIIDVISD+ FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF+++K +F E+G+YD GMDIWGGENLE+SFR W C G L I TCS VGHVFRK +PYS+PGG  Q+INKN  R A VWMDE+KDFF   +P V+  ++GD+S R  LRE LKCK F WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG F+CH  GGNQ++++  +  I +D+LCLD  S  + PV M+ C     N  F YD     +    +  CL     +    P L DC
Sbjct:    8 KVVLTTSLVWVLVDAFLLLYFSECNKCDDRKDRSLLPALRA-------------------------VISRSHEGPGEMGKAVNIAKDDQEKMKELFKINQFNLMASDMIALNRSLPDVRLDGCKTKVY-ADDLPTTSIVIVFHNEAWSTLLRTVHSVISRSPRHLLVEIVLVDDASERDFLKKKLEGYVRTLEVPVKILRMEQRSGLIRARLRGAAATTGQVITFLDAHCECTEGWLEPLLARIKEDRTAVVCPIIDVISDETFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDKMYFEEIGSYDPGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYSFPGGTGQVINKNNRRLAEVWMDEFKDFFYIISPGVMRVDYGDVSSRKALREALKCKPFAWYLENIYPDSQIPRRYYSLGEIRNVETNQCVDNMGRKENEKVGFFNCHGMGGNQVFSYTADKEIRTDDLCLD-VSRLNGPVVMLKCHHMKGNQMFEYDAERLTLLHVNSNQCLDMPSEEDKMVPTLRDC 539          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Match: galnt1 (polypeptide N-acetylgalactosaminyltransferase 1 [Source:NCBI gene;Acc:101166578])

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 278/557 (49.91%), Postives = 373/557 (66.97%), Query Frame = 1
Query:   58 KIIVLTSLFWICIQSLFLIY----NSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCL--SFTQGATSPILDDC 1710
            K+++ TSL W+ +    L+Y    N C ++        AD                         +    DGPGE GK VVIP   +++ K+ F ++QFNL+AS M+++NRSLPD R+  CK+K YP + LP TSV+IVFHNEAWSTLLRTVHS I+RSP+ LL EI++VDD S++  LK +LE Y+++L VPV + RME R+GLIRARL GA+ +TG  + FLDAHCE T+GWLEPLL+ IK+++++VV PIIDVISDD FEY+  SDMT+GGFNWK+NF+W   P RE  RR  DR+ P+ TPT+AGGLF++++ +F E+G YD GMDIWGGENLEISFR W C G L I TCS VGHVFRK +PY++PGG  QIINKN  R A VWMDE+K+FF   +P V   ++GDIS R  LR+KL+CK F+WYL+NIYP+S +   + SLG IR+  T  C+D + +K +  VG+F+CH  GGNQ++++  N  I +D+LCLD  S  + PV M+ C     N  + YDP    +    +  CL  +  + +  P + DC
Sbjct:    8 KVVLATSLVWVMLDMFILLYFSECNKCDDKKERGLPGRADS------------------------LSRPRDGPGEGGKPVVIPKENQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKNKLYP-DDLPRTSVVIVFHNEAWSTLLRTVHSVIDRSPRSLLEEIVLVDDASERDFLKRQLEQYVRRLEVPVRVVRMEQRSGLIRARLKGASISTGQVITFLDAHCECTLGWLEPLLTRIKQDKRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTIPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISTRTSLRQKLQCKPFSWYLENIYPDSQIPRHYYSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLD-VSKLNGPVMMLKCHHLKGNQLWEYDPVKLTLVHVNSNQCLDKASEEDSQVPSVRDC 538          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000009970.1 (SMESG000009970.1)

HSP 1 Score: 1120.15 bits (2896), Expect = 0.000e+0
Identity = 587/587 (100.00%), Postives = 587/587 (100.00%), Query Frame = 1
Query:   28 MRKHLQWYTIKIIVLTSLFWICIQSLFLIYNSCKEESTAIHSISADKXXXXXXXXXXXXXXXXXXRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISXXXXXXXXXXCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATSPILDDCXXXXXXXXXXXXXXXXYKPRRLEDTK 1788
            MRKHLQWYTIKIIVLTSLFWICIQSLFLIYNSCKEESTAIHSISADKIITTEKELSSISSKSLLKRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISKRLELREKLKCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATSPILDDCSSSPESPQQQQWSIESYKPRRLEDTK
Sbjct:    1 MRKHLQWYTIKIIVLTSLFWICIQSLFLIYNSCKEESTAIHSISADKIITTEKELSSISSKSLLKRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTFHLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEAWSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPVHLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKKNRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRRNNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTWMCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYKDFFIKNNPSVLGTNFGDISKRLELREKLKCKSFNWYLKNIYPESSLSIPFTSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIISDELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFTQGATSPILDDCSSSPESPQQQQWSIESYKPRRLEDTK 587          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000017211.1 (SMESG000017211.1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 294/297 (98.99%), Postives = 296/297 (99.66%), Query Frame = 2
Query: 1880 LSLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLLLKQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK 2770
            + LSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLL+KQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK
Sbjct:  210 VRLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLLIKQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK 506          

HSP 2 Score: 392.119 bits (1006), Expect = 4.162e-122
Identity = 190/200 (95.00%), Postives = 194/200 (97.00%), Query Frame = 3
Query: 2775 GNVPPIIYHCS*GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK 3374
            G++   + + S GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK
Sbjct:  495 GDLYMAMKYLSKGSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK 694          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000017211.1 (SMESG000017211.1)

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 294/297 (98.99%), Postives = 296/297 (99.66%), Query Frame = 2
Query: 1880 LSLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLLLKQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK 2770
            + LSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLL+KQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK
Sbjct:  108 VRLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLLIKQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK 404          

HSP 2 Score: 392.504 bits (1007), Expect = 1.641e-123
Identity = 190/200 (95.00%), Postives = 194/200 (97.00%), Query Frame = 3
Query: 2775 GNVPPIIYHCS*GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK 3374
            G++   + + S GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK
Sbjct:  393 GDLYMAMKYLSKGSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK 592          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000017211.1 (SMESG000017211.1)

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 294/297 (98.99%), Postives = 296/297 (99.66%), Query Frame = 2
Query: 1880 LSLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLLLKQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK 2770
            + LSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLL+KQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK
Sbjct:  106 VRLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLLIKQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK 402          

HSP 2 Score: 392.119 bits (1006), Expect = 1.827e-123
Identity = 190/200 (95.00%), Postives = 194/200 (97.00%), Query Frame = 3
Query: 2775 GNVPPIIYHCS*GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK 3374
            G++   + + S GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK
Sbjct:  391 GDLYMAMKYLSKGSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK 590          
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Match: SMESG000017211.1 (SMESG000017211.1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 294/297 (98.99%), Postives = 296/297 (99.66%), Query Frame = 2
Query: 1880 LSLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLLLKQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK 2770
            + LSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLL+KQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK
Sbjct:  188 VRLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVMDYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQSIVLKALEYIIAYLSSASKNWRYWIKLLIKQNSLKQFSESEMERLLDNLDTDQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDADSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEKFVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLSK 484          

HSP 2 Score: 391.734 bits (1005), Expect = 2.798e-122
Identity = 190/200 (95.00%), Postives = 194/200 (97.00%), Query Frame = 3
Query: 2775 GNVPPIIYHCS*GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK 3374
            G++   + + S GSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK
Sbjct:  473 GDLYMAMKYLSKGSLRAYLKQVGGLVEGDISRICHQILLQIEVIHRHKIIHRDINSKNIVFDEFHNAKLIDFGISKNVNGISPEQLSEKLKKYINGNMRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIAKTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNRIAK 672          
The following BLAST results are available for this feature:
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALNT10.000e+050.63polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
GALNT130.000e+049.91polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
GALNT130.000e+050.00polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
GALNT14.476e-15255.09polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
POC1B-GALNT41.497e-11444.15POC1B-GALNT4 readthrough [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gly-30.000e+053.88Polypeptide N-acetylgalactosaminyltransferase 3 [... [more]
gly-52.385e-13247.30Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-52.385e-13247.30Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-52.385e-13247.30Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
gly-52.298e-13146.69Polypeptide N-acetylgalactosaminyltransferase 5 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgant50.000e+054.12gene:FBgn0031681 transcript:FBtr0111024[more]
Pgant51.400e-17953.92gene:FBgn0031681 transcript:FBtr0079026[more]
Pgant93.587e-13545.55gene:FBgn0050463 transcript:FBtr0087113[more]
Pgant93.587e-13545.55gene:FBgn0050463 transcript:FBtr0113379[more]
Pgant91.394e-13345.67gene:FBgn0050463 transcript:FBtr0087112[more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt130.000e+050.45UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt130.000e+052.72UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt10.000e+055.03UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt10.000e+055.03UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt114.674e-11744.23UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt10.000e+050.27polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt10.000e+050.54polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt10.000e+050.71polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt10.000e+055.44polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt10.000e+050.18polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galnt10.000e+050.81polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt10.000e+050.81polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt10.000e+050.81polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
Galnt130.000e+050.09polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
Galnt130.000e+050.09polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29121|GALT1_PIG0.000e+051.17Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|O08912|GALT1_MOUSE0.000e+050.81Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|Q10473|GALT1_RAT0.000e+050.63Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|Q10472|GALT1_HUMAN0.000e+050.63Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
sp|Q07537|GALT1_BOVIN0.000e+050.99Polypeptide N-acetylgalactosaminyltransferase 1 OS... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PAW60.000e+056.42Polypeptide N-acetylgalactosaminyltransferase OS=P... [more]
A0A210PGQ10.000e+053.30Polypeptide N-acetylgalactosaminyltransferase OS=M... [more]
K1R3240.000e+059.23Polypeptide N-acetylgalactosaminyltransferase OS=C... [more]
A0A0L8H9860.000e+059.79Polypeptide N-acetylgalactosaminyltransferase OS=O... [more]
A0A0L8H7R20.000e+059.79Polypeptide N-acetylgalactosaminyltransferase OS=O... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt130.000e+050.45polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt130.000e+050.18polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt10.000e+050.45polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt14.031e-17256.43polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
galnt139.668e-17247.76polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000477.17.969e-16153.30pep scaffold:Pmarinus_7.0:GL501308:12705:54064:-1 ... [more]
ENSPMAT00000010805.13.092e-12652.24pep scaffold:Pmarinus_7.0:GL478309:9001:42806:-1 g... [more]
galnt112.346e-11443.89UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
galnt21.949e-11151.32UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-a... [more]
poc1bl5.233e-11140.91POC1 centriolar protein homolog B (Chlamydomonas),... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIC17.127e-2234.04Protein kinase of the PAK/Ste20 family, required f... [more]
STE111.562e-2031.58Signal transducing MEK kinase; involved in pheromo... [more]
STE204.066e-1931.82Cdc42p-activated signal transducing kinase; involv... [more]
SPS11.544e-1830.21Putative protein serine/threonine kinase; localize... [more]
CDC152.291e-1834.52Protein kinase of the Mitotic Exit Network; locali... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438617.793e-13651.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372661.611e-13045.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458299.173e-12946.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458302.305e-12251.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302697.057e-11945.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galnt130.000e+049.91polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt130.000e+049.91polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt130.000e+049.91polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt130.000e+049.91polypeptide N-acetylgalactosaminyltransferase 13 [... [more]
galnt10.000e+049.91polypeptide N-acetylgalactosaminyltransferase 1 [S... [more]
back to top
BLAST of Polypeptide N-acetylgalactosaminyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009970.10.000e+0100.00SMESG000009970.1[more]
SMESG000017211.14.162e-12298.99SMESG000017211.1[more]
SMESG000017211.11.641e-12398.99SMESG000017211.1[more]
SMESG000017211.11.827e-12398.99SMESG000017211.1[more]
SMESG000017211.12.798e-12298.99SMESG000017211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000200 ID=SMED30000200|Name=Polypeptide N-acetylgalactosaminyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=3400bp
TCTATATAAATCTTATATGATAACTAAATGCGGAAGCACTTGCAATGGTA
TACTATCAAGATAATTGTATTAACGTCATTATTTTGGATTTGCATACAAT
CATTATTTTTAATTTATAATTCATGCAAAGAAGAATCAACAGCTATCCAT
TCGATATCCGCTGATAAAATTATCACCACAGAAAAAGAGTTATCAAGTAT
ATCATCAAAAAGCTTACTGAAACGGTTTTTGAACAAATTTATCGACCTTG
GACCCGATGGACCCGGTGAAATGGGTAAAGCAGTGGTGATTCCAAATTAC
CTCAAAGATGAATCCAAAAAAACATTTCATCTCCATCAATTCAATTTAGT
TGCCAGTAACATGGTGTCCGTTAACCGCTCGCTGCCAGATTATCGGATCT
CAGTCTGCAAATCCAAATCATATCCAGTAGAGCAATTACCAAATACCAGT
GTGATAATCGTATTCCACAATGAAGCATGGAGTACCCTTCTGCGCACTGT
CCACAGTACCATCAACCGTTCCCCCAAGCATTTATTACATGAAATTATAA
TGGTTGATGATTACAGTGATCAAGTTCACCTGAAGTACAAATTAGAGTCA
TATCTAAAACAGTTGCCTGTCCCTGTCCATTTGTACAGAATGGAATCTAG
AACCGGATTGATTCGGGCTAGACTTCACGGGGCTGCCAGAGCAACTGGGG
CTACGTTACTTTTCCTTGACGCCCACTGCGAAGCGACAATGGGATGGCTG
GAACCGTTGTTATCTGAAATAAAAAAGAACCGTAAATCAGTCGTTGCCCC
GATTATCGATGTTATCAGTGACGACAATTTTGAGTATATTACAGCGTCAG
ACATGACTTGGGGAGGTTTTAACTGGAAAATGAATTTCAAATGGAATACA
GCTCCGATACGAGAAGACATACGACGGAACAATGACAGATCGGAACCGTT
ACATACACCAACAATTGCTGGTGGATTATTTGCTGTAGAAAAGAAGTTTT
TCTATGAGCTCGGTGCTTATGATGATGGAATGGATATTTGGGGCGGAGAA
AATCTAGAGATATCATTCAGAACCTGGATGTGTCATGGTAAATTATTGAT
TGCTACTTGCAGTCGAGTAGGCCACGTTTTCCGGAAAACCTCTCCGTATT
CATGGCCTGGTGGAGTAGCCCAAATCATTAATAAAAATCTGATGCGCACC
GCCCTCGTTTGGATGGATGAATATAAAGATTTCTTTATTAAGAATAATCC
CAGTGTGCTCGGAACGAATTTTGGTGACATTTCTAAGCGATTAGAACTTC
GGGAGAAATTGAAATGCAAATCATTTAACTGGTACTTGAAAAATATTTAT
CCAGAATCGTCTTTAAGCATTCCATTCACTTCCCTTGGCTGGATTCGTCA
TGATTTCACGAAGTTTTGCATTGATACTTTGGATAAAAAGGCGGATTCAG
ATGTCGGAATGTTTTCTTGTCACAACGAAGGTGGCAATCAGTTATGGGCA
TTTAATGTCAATGGTAACATAATTTCCGATGAATTATGCCTTGATGGATC
AAGTAGTAGATCTTCCCCGGTCAAAATGGTGACTTGTGAATTGACATCAG
TAAACCTAAAATTCATTTACGATCCTAATGCCAAGCAAATCAAAAGCAAA
TACAATGGACTTTGTTTGTCCTTCACCCAAGGTGCTACCAGTCCGATTTT
GGATGACTGCAGCAGCTCACCCGAGTCCCCCCAGCAGCAGCAATGGAGCA
TCGAGAGCTACAAGCCCAGGAGGCTCGAGGATACCAAATAGCACCGATAT
ATATATATATATATATATAACCTGTAAAGGAATAATAAATAAATAGCTTC
ACTTGTGAATATTGTCCATGAACCTTTATCTCAGCTTGAGTATCTCATCA
AATGATTTCATGGACCCGAGATTGCGCAAACCTATCAATGAATTTCCGCG
TTCATATATAAACGCAAAGTATTTATTTGGCATGGACCTGACGGACAGGA
TCTGGGAAATCGTCATGGACTATTGGACATTAGCTCGGCCGGAATACGAT
GACAGTGTTAATGAATTTATCGTTCACTACTTCCGAAATGCTATAGAATT
GGCCATTTTATTTCATATAAATTCAATTCCAGATCAGATTGATTGCACTG
ATAAATCAATACAAAGTATTGTATTAAAAGCTCTGGAATATATTATTGCT
TATTTGTCCTCTGCTAGCAAAAATTGGCGTTATTGGATTAAATTATTACT
TAAGCAAAATTCTTTGAAACAATTCAGTGAAAGTGAAATGGAAAGATTAT
TAGATAATTTAGACACGGATCAAATATTTGTCAATATAAAAGTGAACGGG
ATCAGGCATAGGATGTATGTGACAAGGAAAGTGGACACGGTTATGGACGC
AAAAAATGTCATCTCACATATTACTGGGATTGACACGAGGCAAATGCTTT
GCATCAAACAGGACGCCGACAGTAAACCCTGCGATGGGGATTTGTTTGAT
CACAGATTCGTTATTGAAATCGCTTTAAGTATGGAAGATGTCGAAAAGTT
GAAATTGCTAGCGGAAGGAGGATTCGGAGCCGTCTATTTGTATCAGGACA
AAGTAAGCATGGAGAAATTTGTCGTTAAAAGGCAAAAAGAAAAGAATGAT
GATCTTTACCGAGAAATCAGTCTTCAGTTTCAGTTACAGAGTTCAGAATT
CATTCAATGCTACTCCGGGCTGTATTTAGACAACGGGGATCTCTATATGG
CAATGAAATATTTGTCAAAGGTTTGGTAATGTTCCTCCTATAATTTATCA
TTGCAGTTAGGGCTCTCTCCGTGCATATTTGAAACAAGTTGGAGGTCTTG
TCGAAGGTGATATATCAAGAATTTGCCATCAGATCTTGCTACAAATTGAG
GTGATCCACCGGCACAAAATTATACATCGGGATATCAATAGCAAAAATAT
CGTTTTCGATGAGTTTCACAATGCCAAGCTGATAGATTTCGGAATTTCCA
AGAATGTGAACGGGATCTCCCCAGAGCAATTGAGTGAAAAGCTAAAGAAA
TATATCAACGGCAACATGCGCTACTTGGCGCCGGAATATTTGAACAATGA
ACCGTATTCAGAGAAGGTTGATATTTGGTCCTTTGGTGCTGTGACAGTCG
AAATGTTCACAGGCTTCAAACCTTATCACAGTCTCAAAAAGTTTTTGGCT
TCAATGAGAATCGCCAAGACTAAAAAGATCACATTCAAATCCCCGAAGCC
AATGTCAAAAGAACTGGACAACTTCACCCGCCTCTGCCTGAACCCAGATC
CTCAATTGAGATCGAATGTTTTCTACTTGAAACAAACTTTATTTATTCAA
AATTATTTGAATAGAATTGCTAAATAATAAATTTATTAATTGAAAAAAAA
back to top

protein sequence of SMED30000200-orf-1

>SMED30000200-orf-1 ID=SMED30000200-orf-1|Name=SMED30000200-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=588bp
MRKHLQWYTIKIIVLTSLFWICIQSLFLIYNSCKEESTAIHSISADKIIT
TEKELSSISSKSLLKRFLNKFIDLGPDGPGEMGKAVVIPNYLKDESKKTF
HLHQFNLVASNMVSVNRSLPDYRISVCKSKSYPVEQLPNTSVIIVFHNEA
WSTLLRTVHSTINRSPKHLLHEIIMVDDYSDQVHLKYKLESYLKQLPVPV
HLYRMESRTGLIRARLHGAARATGATLLFLDAHCEATMGWLEPLLSEIKK
NRKSVVAPIIDVISDDNFEYITASDMTWGGFNWKMNFKWNTAPIREDIRR
NNDRSEPLHTPTIAGGLFAVEKKFFYELGAYDDGMDIWGGENLEISFRTW
MCHGKLLIATCSRVGHVFRKTSPYSWPGGVAQIINKNLMRTALVWMDEYK
DFFIKNNPSVLGTNFGDISKRLELREKLKCKSFNWYLKNIYPESSLSIPF
TSLGWIRHDFTKFCIDTLDKKADSDVGMFSCHNEGGNQLWAFNVNGNIIS
DELCLDGSSSRSSPVKMVTCELTSVNLKFIYDPNAKQIKSKYNGLCLSFT
QGATSPILDDCSSSPESPQQQQWSIESYKPRRLEDTK*
back to top

protein sequence of SMED30000200-orf-2

>SMED30000200-orf-2 ID=SMED30000200-orf-2|Name=SMED30000200-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
MNLYLSLSISSNDFMDPRLRKPINEFPRSYINAKYLFGMDLTDRIWEIVM
DYWTLARPEYDDSVNEFIVHYFRNAIELAILFHINSIPDQIDCTDKSIQS
IVLKALEYIIAYLSSASKNWRYWIKLLLKQNSLKQFSESEMERLLDNLDT
DQIFVNIKVNGIRHRMYVTRKVDTVMDAKNVISHITGIDTRQMLCIKQDA
DSKPCDGDLFDHRFVIEIALSMEDVEKLKLLAEGGFGAVYLYQDKVSMEK
FVVKRQKEKNDDLYREISLQFQLQSSEFIQCYSGLYLDNGDLYMAMKYLS
KVW*
back to top

protein sequence of SMED30000200-orf-3

>SMED30000200-orf-3 ID=SMED30000200-orf-3|Name=SMED30000200-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MRYLAPEYLNNEPYSEKVDIWSFGAVTVEMFTGFKPYHSLKKFLASMRIA
KTKKITFKSPKPMSKELDNFTRLCLNPDPQLRSNVFYLKQTLFIQNYLNR
IAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035992Ricin_B-like_lectins
IPR000772Ricin_B_lectin
IPR001173Glyco_trans_2-like
IPR029044Nucleotide-diphossugar_trans
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
GO:0030246carbohydrate binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006486protein glycosylation
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000772Ricin B, lectin domainSMARTSM00458ricin_3coord: 451..576
e-value: 3.8E-19
score: 79.6
IPR000772Ricin B, lectin domainPFAMPF00652Ricin_B_lectincoord: 454..565
e-value: 1.7E-19
score: 70.3
IPR000772Ricin B, lectin domainPROSITEPS50231RICIN_B_LECTINcoord: 464..576
score: 21.102
IPR000772Ricin B, lectin domainCDDcd00161RICINcoord: 454..575
e-value: 1.47659E-19
score: 82.5534
IPR001173Glycosyltransferase 2-likePFAMPF00535Glycos_transf_2coord: 141..320
e-value: 8.6E-31
score: 107.0
NoneNo IPR availableGENE3DG3DSA:2.80.10.50coord: 450..581
e-value: 1.2E-28
score: 101.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 560..587
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 560..577
NoneNo IPR availablePANTHERPTHR11675:SF47POLYPEPTIDE N-ACETYLGALACTOSAMINYLTRANSFERASE 13coord: 9..579
NoneNo IPR availablePANTHERPTHR11675N-ACETYLGALACTOSAMINYLTRANSFERASEcoord: 9..579
NoneNo IPR availableCDDcd02510pp-GalNAc-Tcoord: 141..441
e-value: 2.70598E-170
score: 483.245
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 67..449
e-value: 3.7E-162
score: 541.5
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 116..443
IPR035992Ricin B-like lectinsSUPERFAMILYSSF50370Ricin B-like lectinscoord: 450..576