Transformer 2 alpha homolog

Overview
NameTransformer 2 alpha homolog
Smed IDSMED30000198
Length (bp)1638
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transformer 2 alpha homolog (SMED30000198) t-SNE clustered cells

Violin plots show distribution of expression levels for Transformer 2 alpha homolog (SMED30000198) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transformer 2 alpha homolog (SMED30000198) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transformer 2 alpha homolog (SMED30000198) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000198

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000198h1SMcG0015443 SmedASXL_014912SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000198h1SMcG0015443 SmedASXL_014912SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30000198h1SMcG0015443 dd_Smed_v4_6379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000198h1SMcG0015443 dd_Smed_v4_6379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000198h1SMcG0015443 dd_Smed_v4_6379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000198h1SMcG0015443 dd_Smed_v4_6379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000198h1SMcG0015443 dd_Smed_v4_6379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000198h1SMcG0015443 Contig39405uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000198h1SMcG0015443 Contig39405newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transformer 2 alpha homolog vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 107.457 bits (267), Expect = 1.791e-26
Identity = 48/101 (47.52%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+A+TPTPG  Y G+ T+
Sbjct:   14 PDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGI-YMGRPTH 113          
BLAST of Transformer 2 alpha homolog vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 107.457 bits (267), Expect = 1.839e-26
Identity = 48/101 (47.52%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+A+TPTPG  Y G+ T+
Sbjct:   14 PDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGI-YMGRPTH 113          
BLAST of Transformer 2 alpha homolog vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 107.457 bits (267), Expect = 1.839e-26
Identity = 48/101 (47.52%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+A+TPTPG  Y G+ T+
Sbjct:   14 PDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGI-YMGRPTH 113          
BLAST of Transformer 2 alpha homolog vs. Ensembl Human
Match: TRA2B (transformer 2 beta homolog [Source:HGNC Symbol;Acc:HGNC:10781])

HSP 1 Score: 106.301 bits (264), Expect = 7.198e-26
Identity = 48/104 (46.15%), Postives = 70/104 (67.31%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKIT 511
            N   PDP+ C+G+FGLS  T+ER L + F  +G I  VS++ D+ ++ S GFAF+ +E ++ A  A +  NGM LD + +RVD+SITK+ +TPTPG  Y G+ T
Sbjct:   10 NRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGI-YMGRPT 112          
BLAST of Transformer 2 alpha homolog vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 107.842 bits (268), Expect = 1.801e-25
Identity = 48/101 (47.52%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+A+TPTPG  Y G+ T+
Sbjct:  115 PDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGI-YMGRPTH 214          
BLAST of Transformer 2 alpha homolog vs. Ensembl Celegans
Match: rsp-8 (SR Protein (Splicing factor) [Source:UniProtKB/TrEMBL;Acc:G3MU77])

HSP 1 Score: 85.1149 bits (209), Expect = 5.438e-18
Identity = 38/93 (40.86%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGS 490
            P PS C+G+F LS  T+E+ L   FG FG+I    L+ D+ +  S GF FI +  +  AT A  +     LD   +RVD+S+TK+ ++PTPG 
Sbjct:   72 PQPSKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIEDATAARDKLCNTDLDGHKIRVDFSLTKRGHSPTPGQ 164          
BLAST of Transformer 2 alpha homolog vs. Ensembl Celegans
Match: rsp-8 (SR Protein (Splicing factor) [Source:UniProtKB/TrEMBL;Acc:G3MU77])

HSP 1 Score: 85.1149 bits (209), Expect = 5.438e-18
Identity = 38/93 (40.86%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGS 490
            P PS C+G+F LS  T+E+ L   FG FG+I    L+ D+ +  S GF FI +  +  AT A  +     LD   +RVD+S+TK+ ++PTPG 
Sbjct:   72 PQPSKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIEDATAARDKLCNTDLDGHKIRVDFSLTKRGHSPTPGQ 164          
BLAST of Transformer 2 alpha homolog vs. Ensembl Celegans
Match: rbmx-2 (RBMX2 ortholog [Source:UniProtKB/TrEMBL;Acc:Q18318])

HSP 1 Score: 55.8398 bits (133), Expect = 3.082e-8
Identity = 29/77 (37.66%), Postives = 47/77 (61.04%), Query Frame = 2
Query:  221 STCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDY 451
            S  I I GLS   SE  +   F  +G++ +++LI DK T +S GFAF+ Y++  S   A+   NG++L  +++RVD+
Sbjct:   37 SAWIYIGGLSYALSEGDVIAVFSQYGEVMNINLIRDKDTGKSKGFAFLCYKDQRSTILAVDNFNGISLHKRMIRVDH 113          
BLAST of Transformer 2 alpha homolog vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 54.6842 bits (130), Expect = 5.580e-8
Identity = 30/82 (36.59%), Postives = 42/82 (51.22%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSI 457
            PD +    I+ L +   +  L  TF  FG I S  + +DK T  S  F F++YE   SATNAI   NG  + SK ++V   +
Sbjct:  190 PDGANLF-IYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKV 270          
BLAST of Transformer 2 alpha homolog vs. Ensembl Celegans
Match: etr-1 (ELAV-Type RNA binding-protein family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR37])

HSP 1 Score: 54.6842 bits (130), Expect = 5.580e-8
Identity = 30/82 (36.59%), Postives = 42/82 (51.22%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSI 457
            PD +    I+ L +   +  L  TF  FG I S  + +DK T  S  F F++YE   SATNAI   NG  + SK ++V   +
Sbjct:  190 PDGANLF-IYHLPQDFGDSDLINTFAPFGGILSAKVFIDKVTNLSKCFGFVSYENAQSATNAISAMNGFQIGSKRLKVQLKV 270          
BLAST of Transformer 2 alpha homolog vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089616)

HSP 1 Score: 94.3597 bits (233), Expect = 3.379e-22
Identity = 39/97 (40.21%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  197 KNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            K+   P  S CIG+FGL+  TS+  + + F  +G I+ + +++D  T+ S GF FI +E+L+ A  A    +G+ +D + +RVD+SIT++A+TPTPG
Sbjct:    3 KSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPG 99          
BLAST of Transformer 2 alpha homolog vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089615)

HSP 1 Score: 95.1301 bits (235), Expect = 5.757e-22
Identity = 39/97 (40.21%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  197 KNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            K+   P  S CIG+FGL+  TS+  + + F  +G I+ + +++D  T+ S GF FI +E+L+ A  A    +G+ +D + +RVD+SIT++A+TPTPG
Sbjct:   50 KSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPG 146          
BLAST of Transformer 2 alpha homolog vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089619)

HSP 1 Score: 95.1301 bits (235), Expect = 5.757e-22
Identity = 39/97 (40.21%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  197 KNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            K+   P  S CIG+FGL+  TS+  + + F  +G I+ + +++D  T+ S GF FI +E+L+ A  A    +G+ +D + +RVD+SIT++A+TPTPG
Sbjct:   50 KSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPG 146          
BLAST of Transformer 2 alpha homolog vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089620)

HSP 1 Score: 95.9005 bits (237), Expect = 7.061e-22
Identity = 39/97 (40.21%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  197 KNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            K+   P  S CIG+FGL+  TS+  + + F  +G I+ + +++D  T+ S GF FI +E+L+ A  A    +G+ +D + +RVD+SIT++A+TPTPG
Sbjct:   88 KSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPG 184          
BLAST of Transformer 2 alpha homolog vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089621)

HSP 1 Score: 95.9005 bits (237), Expect = 7.061e-22
Identity = 39/97 (40.21%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  197 KNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            K+   P  S CIG+FGL+  TS+  + + F  +G I+ + +++D  T+ S GF FI +E+L+ A  A    +G+ +D + +RVD+SIT++A+TPTPG
Sbjct:   88 KSREHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPG 184          
BLAST of Transformer 2 alpha homolog vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 106.301 bits (264), Expect = 6.163e-26
Identity = 45/92 (48.91%), Postives = 66/92 (71.74%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ A  A++  NGM LD + +RVDYSITK+ +TPTPG
Sbjct:  102 PDPNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPHTPTPG 193          
BLAST of Transformer 2 alpha homolog vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 106.301 bits (264), Expect = 6.163e-26
Identity = 45/92 (48.91%), Postives = 66/92 (71.74%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ A  A++  NGM LD + +RVDYSITK+ +TPTPG
Sbjct:  102 PDPNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPHTPTPG 193          
BLAST of Transformer 2 alpha homolog vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 108.227 bits (269), Expect = 9.387e-26
Identity = 48/101 (47.52%), Postives = 71/101 (70.30%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ A  A++  NGM LD + +RVDYSITK+ +TPTPG  Y G+ T+
Sbjct:  131 PDPNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPHTPTPGI-YMGRPTH 230          
BLAST of Transformer 2 alpha homolog vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 107.842 bits (268), Expect = 1.408e-25
Identity = 48/101 (47.52%), Postives = 71/101 (70.30%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ A  A++  NGM LD + +RVDYSITK+ +TPTPG  Y G+ T+
Sbjct:  131 PDPNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPHTPTPGI-YMGRPTH 230          
BLAST of Transformer 2 alpha homolog vs. Ensembl Zebrafish
Match: tra2b (transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1094])

HSP 1 Score: 101.293 bits (251), Expect = 1.521e-23
Identity = 46/108 (42.59%), Postives = 68/108 (62.96%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITNRGA 523
            +   PDP+ C+G+FGLS  T+ER L + F  +G +  V ++ D+ ++ S GFAF+ +E    +  A +  NGM LD + +RVDYSITK+ +TPTPG  Y G+ T  G 
Sbjct:  115 DRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPLSDVCIVYDQQSRRSRGFAFVYFENREDSKEAKERANGMELDGRRIRVDYSITKRPHTPTPGI-YMGRPTYGGG 221          
BLAST of Transformer 2 alpha homolog vs. Ensembl Xenopus
Match: plekhg5 (pleckstrin homology and RhoGEF domain containing G5 [Source:Xenbase;Acc:XB-GENE-6039487])

HSP 1 Score: 108.997 bits (271), Expect = 6.920e-26
Identity = 51/114 (44.74%), Postives = 78/114 (68.42%), Query Frame = 2
Query:  182 LSSRSKNNTT---PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            +S+R ++N +   PDP+ CIG+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E +  +  A++  NGM LD + +RVDYSITK+A+TPTPG  Y G+ T+
Sbjct:   97 MSNRRRHNGSRANPDPNICIGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIEDSREAMEHANGMELDGRRIRVDYSITKRAHTPTPGI-YMGRPTH 209          
BLAST of Transformer 2 alpha homolog vs. Ensembl Xenopus
Match: rit1 (Ras-like without CAAX 1 [Source:Xenbase;Acc:XB-GENE-5777077])

HSP 1 Score: 104.76 bits (260), Expect = 3.792e-24
Identity = 44/96 (45.83%), Postives = 66/96 (68.75%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            N   PDP+ C+G+FGLS  T+ER L + F  +G I  VS++ D+ ++ S GF+F+ +E ++ A  A +  NGM LD + +RVD+SITK+ +TPTPG
Sbjct:  145 NRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPISDVSIVYDQQSRRSRGFSFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPG 240          
BLAST of Transformer 2 alpha homolog vs. Ensembl Xenopus
Match: adat1 (adenosine deaminase, tRNA-specific 1 [Source:Xenbase;Acc:XB-GENE-1002540])

HSP 1 Score: 64.6994 bits (156), Expect = 6.371e-11
Identity = 32/100 (32.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query:  215 DPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITK--KAYTPTP-GSGYKGK 505
            DP   + +  LS++T+E  L + F  +G IK + L+ D  T  S G+AFI Y++ N+   A ++ N + +D + + VD+ + +  K + P   G G+ GK
Sbjct:   48 DPHLTLYVARLSQQTTEEKLKEVFSRYGDIKRIRLVRDFITGFSKGYAFIEYKQENAIMKAHRDANKLVIDQREIFVDFELERNLKGWVPRRLGGGFGGK 147          
BLAST of Transformer 2 alpha homolog vs. Ensembl Xenopus
Match: trerf1 (transcriptional regulating factor 1 [Source:Xenbase;Acc:XB-GENE-940630])

HSP 1 Score: 63.5438 bits (153), Expect = 3.155e-10
Identity = 33/93 (35.48%), Postives = 54/93 (58.06%), Query Frame = 2
Query:  176 NNLSSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYS 454
            NN SS  +++ T D  T + +  L +  ++  L   FG+ G+I+S  L+ DK T +SLG+ F+NY +   A  AI   NG+ L +K ++V Y+
Sbjct:   40 NNCSSPVESSNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYA 132          

HSP 2 Score: 54.6842 bits (130), Expect = 2.127e-7
Identity = 26/79 (32.91%), Postives = 41/79 (51.90%), Query Frame = 2
Query:  227 CIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITK 463
            CI ++ L+    E  LW+ FG FG + +V +I D  T +  GF F+     + A  AI   NG  L  +V++V +  +K
Sbjct:  282 CIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTSK 360          
BLAST of Transformer 2 alpha homolog vs. Ensembl Xenopus
Match: trerf1 (transcriptional regulating factor 1 [Source:Xenbase;Acc:XB-GENE-940630])

HSP 1 Score: 63.1586 bits (152), Expect = 3.737e-10
Identity = 33/93 (35.48%), Postives = 54/93 (58.06%), Query Frame = 2
Query:  176 NNLSSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYS 454
            NN SS  +++ T D  T + +  L +  ++  L   FG+ G+I+S  L+ DK T +SLG+ F+NY +   A  AI   NG+ L +K ++V Y+
Sbjct:   51 NNCSSPVESSNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYA 143          

HSP 2 Score: 54.6842 bits (130), Expect = 2.266e-7
Identity = 26/79 (32.91%), Postives = 41/79 (51.90%), Query Frame = 2
Query:  227 CIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITK 463
            CI ++ L+    E  LW+ FG FG + +V +I D  T +  GF F+     + A  AI   NG  L  +V++V +  +K
Sbjct:  293 CIFVYNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTSK 371          
BLAST of Transformer 2 alpha homolog vs. Ensembl Mouse
Match: Tra2b (transformer 2 beta [Source:MGI Symbol;Acc:MGI:106016])

HSP 1 Score: 106.301 bits (264), Expect = 4.941e-26
Identity = 48/104 (46.15%), Postives = 70/104 (67.31%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKIT 511
            N   PDP+ C+G+FGLS  T+ER L + F  +G I  VS++ D+ ++ S GFAF+ +E ++ A  A +  NGM LD + +RVD+SITK+ +TPTPG  Y G+ T
Sbjct:   10 NRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGI-YMGRPT 112          
BLAST of Transformer 2 alpha homolog vs. Ensembl Mouse
Match: Tra2a (transformer 2 alpha [Source:MGI Symbol;Acc:MGI:1933972])

HSP 1 Score: 107.842 bits (268), Expect = 1.188e-25
Identity = 48/101 (47.52%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+A+TPTPG  Y G+ T+
Sbjct:  113 PDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGI-YMGRPTH 212          
BLAST of Transformer 2 alpha homolog vs. Ensembl Mouse
Match: Tra2a (transformer 2 alpha [Source:MGI Symbol;Acc:MGI:1933972])

HSP 1 Score: 107.842 bits (268), Expect = 1.237e-25
Identity = 48/101 (47.52%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+A+TPTPG  Y G+ T+
Sbjct:  113 PDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGI-YMGRPTH 212          
BLAST of Transformer 2 alpha homolog vs. Ensembl Mouse
Match: Tra2b (transformer 2 beta [Source:MGI Symbol;Acc:MGI:106016])

HSP 1 Score: 107.071 bits (266), Expect = 2.237e-25
Identity = 45/96 (46.88%), Postives = 66/96 (68.75%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            N   PDP+ C+G+FGLS  T+ER L + F  +G I  VS++ D+ ++ S GFAF+ +E ++ A  A +  NGM LD + +RVD+SITK+ +TPTPG
Sbjct:  110 NRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPG 205          
BLAST of Transformer 2 alpha homolog vs. Ensembl Mouse
Match: Gm29289 (predicted gene 29289 [Source:MGI Symbol;Acc:MGI:5579995])

HSP 1 Score: 71.2478 bits (173), Expect = 3.966e-14
Identity = 34/75 (45.33%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  230 IGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYS 454
            I I GL+ KT ++TL + FG FG +  V L+ D+ TK+S GFAF+ +  L  A NA+KE NG+ LD K ++V  +
Sbjct:   10 IFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAFLTFRRLADAKNAVKEMNGVILDGKRIKVKQA 84          
BLAST of Transformer 2 alpha homolog vs. UniProt/SwissProt
Match: sp|Q6PFR5|TRA2A_MOUSE (Transformer-2 protein homolog alpha OS=Mus musculus OX=10090 GN=Tra2a PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.478e-25
Identity = 48/101 (47.52%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+A+TPTPG  Y G+ T+
Sbjct:  113 PDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGI-YMGRPTH 212          
BLAST of Transformer 2 alpha homolog vs. UniProt/SwissProt
Match: sp|Q13595|TRA2A_HUMAN (Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 8.650e-25
Identity = 48/101 (47.52%), Postives = 72/101 (71.29%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+A+TPTPG  Y G+ T+
Sbjct:  115 PDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGI-YMGRPTH 214          
BLAST of Transformer 2 alpha homolog vs. UniProt/SwissProt
Match: sp|P62997|TRA2B_RAT (Transformer-2 protein homolog beta OS=Rattus norvegicus OX=10116 GN=Tra2b PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.565e-24
Identity = 45/96 (46.88%), Postives = 66/96 (68.75%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            N   PDP+ C+G+FGLS  T+ER L + F  +G I  VS++ D+ ++ S GFAF+ +E ++ A  A +  NGM LD + +RVD+SITK+ +TPTPG
Sbjct:  110 NRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPG 205          
BLAST of Transformer 2 alpha homolog vs. UniProt/SwissProt
Match: sp|P62996|TRA2B_MOUSE (Transformer-2 protein homolog beta OS=Mus musculus OX=10090 GN=Tra2b PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.565e-24
Identity = 45/96 (46.88%), Postives = 66/96 (68.75%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            N   PDP+ C+G+FGLS  T+ER L + F  +G I  VS++ D+ ++ S GFAF+ +E ++ A  A +  NGM LD + +RVD+SITK+ +TPTPG
Sbjct:  110 NRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPG 205          
BLAST of Transformer 2 alpha homolog vs. UniProt/SwissProt
Match: sp|P62995|TRA2B_HUMAN (Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.565e-24
Identity = 45/96 (46.88%), Postives = 66/96 (68.75%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            N   PDP+ C+G+FGLS  T+ER L + F  +G I  VS++ D+ ++ S GFAF+ +E ++ A  A +  NGM LD + +RVD+SITK+ +TPTPG
Sbjct:  110 NRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPG 205          
BLAST of Transformer 2 alpha homolog vs. TrEMBL
Match: A0A3B3CGK9 (Transformer 2 alpha homolog OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 3.259e-25
Identity = 51/105 (48.57%), Postives = 75/105 (71.43%), Query Frame = 2
Query:  182 LSSRSKNNTT---PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            +SSR ++  T   PDPSTC+G+FGL+  T+ER L + F  +G++  ++++ D+ T  S GFAFI +E L  A  AI++TNGM +D + +RVDYSITK+ +TPTPG
Sbjct:   94 MSSRRRHTGTRENPDPSTCLGVFGLNLSTTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEQTNGMNMDGRQIRVDYSITKRPHTPTPG 198          
BLAST of Transformer 2 alpha homolog vs. TrEMBL
Match: A0A437CW16 (RRM domain-containing protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00111960 PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 3.646e-25
Identity = 51/105 (48.57%), Postives = 75/105 (71.43%), Query Frame = 2
Query:  182 LSSRSKNNTT---PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            +SSR ++  T   PDPSTC+G+FGL+  T+ER L + F  +G++  ++++ D+ T  S GFAFI +E L  A  AI++TNGM +D + +RVDYSITK+ +TPTPG
Sbjct:   92 MSSRRRHTGTRENPDPSTCLGVFGLNLSTTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEQTNGMNMDGRQIRVDYSITKRPHTPTPG 196          
BLAST of Transformer 2 alpha homolog vs. TrEMBL
Match: A0A3P9K3F4 (Transformer 2 alpha homolog OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 7.441e-25
Identity = 54/113 (47.79%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  182 LSSRSKNNTT---PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKIT 511
            +SSR ++  T   PDPSTC+G+FGL+  T+ER L + F  +G++  ++++ D+ T  S GFAFI +E L  A  AI+ TNGM +D + +RVDYSITK+ +TPTPG  Y G+ T
Sbjct:   92 MSSRRRHTGTRENPDPSTCLGVFGLNLSTTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEHTNGMNMDGRQIRVDYSITKRPHTPTPGI-YMGRPT 203          
BLAST of Transformer 2 alpha homolog vs. TrEMBL
Match: A0A3B3H7T6 (Transformer 2 alpha homolog OS=Oryzias latipes OX=8090 GN=LOC101157868 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 7.608e-25
Identity = 54/113 (47.79%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  182 LSSRSKNNTT---PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKIT 511
            +SSR ++  T   PDPSTC+G+FGL+  T+ER L + F  +G++  ++++ D+ T  S GFAFI +E L  A  AI+ TNGM +D + +RVDYSITK+ +TPTPG  Y G+ T
Sbjct:   92 MSSRRRHTGTRENPDPSTCLGVFGLNLSTTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEHTNGMNMDGRQIRVDYSITKRPHTPTPGI-YMGRPT 203          
BLAST of Transformer 2 alpha homolog vs. TrEMBL
Match: A0A3P9I3E4 (Transformer 2 alpha homolog OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 7.739e-25
Identity = 54/113 (47.79%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  182 LSSRSKNNTT---PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKIT 511
            +SSR ++  T   PDPSTC+G+FGL+  T+ER L + F  +G++  ++++ D+ T  S GFAFI +E L  A  AI+ TNGM +D + +RVDYSITK+ +TPTPG  Y G+ T
Sbjct:   92 MSSRRRHTGTRENPDPSTCLGVFGLNLSTTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEHTNGMNMDGRQIRVDYSITKRPHTPTPGI-YMGRPT 203          
BLAST of Transformer 2 alpha homolog vs. Ensembl Cavefish
Match: ENSAMXT00000034164.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:6544829:6548035:1 gene:ENSAMXG00000039469.1 transcript:ENSAMXT00000034164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 4.292e-26
Identity = 49/109 (44.95%), Postives = 71/109 (65.14%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITNRGAR 526
            N   PDP+ C+G+FGLS  T+ER L + F  +G + SVS++ D+ ++ S GFAF+ +E    +  A +  NGM LD + +RVDYSIT++ +TPTPG  Y G+ T  G R
Sbjct:   10 NRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPLSSVSIVYDQQSRRSRGFAFVYFENREDSREAKERANGMELDGRRIRVDYSITQRPHTPTPGI-YMGRPTYGGGR 117          
BLAST of Transformer 2 alpha homolog vs. Ensembl Cavefish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 106.686 bits (265), Expect = 1.103e-25
Identity = 48/113 (42.48%), Postives = 74/113 (65.49%), Query Frame = 2
Query:  176 NNLSSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            +N    + +   PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+ +TPTPG  Y G+ T 
Sbjct:   91 SNRRRHAGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLAGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRPHTPTPGI-YMGRPTQ 202          
BLAST of Transformer 2 alpha homolog vs. Ensembl Cavefish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 105.531 bits (262), Expect = 2.000e-25
Identity = 47/101 (46.53%), Postives = 70/101 (69.31%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            PDP+TC+G+FGLS  T+ER L + F  +G +  V+++ D+ T  S GFAF+ +E ++ +  A++  NGM LD + +RVDYSITK+ +TPTPG  Y G+ T 
Sbjct:  131 PDPNTCLGVFGLSLYTTERDLREVFSRYGPLAGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRPHTPTPGI-YMGRPTQ 230          
BLAST of Transformer 2 alpha homolog vs. Ensembl Cavefish
Match: tra2b (transformer-2 protein homolog alpha-like [Source:NCBI gene;Acc:103029311])

HSP 1 Score: 100.908 bits (250), Expect = 2.592e-23
Identity = 45/104 (43.27%), Postives = 67/104 (64.42%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKIT 511
            N   PDP+ C+G+FGLS  T+ER L + F  +G +  V ++ D+ ++ S GFAF+ +E    +  A +  NGM LD + +RVD+SITK+ +TPTPG  Y G+ T
Sbjct:  110 NRANPDPTCCLGVFGLSLYTTERDLREVFSKYGPLADVCIVYDQQSRRSRGFAFVYFENREDSQEAKERANGMELDGRRIRVDFSITKRPHTPTPGI-YMGRPT 212          
BLAST of Transformer 2 alpha homolog vs. Ensembl Cavefish
Match: rbmx (RNA binding motif protein X-linked [Source:NCBI gene;Acc:103022315])

HSP 1 Score: 69.3218 bits (168), Expect = 2.414e-12
Identity = 30/74 (40.54%), Postives = 45/74 (60.81%), Query Frame = 2
Query:  236 IFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSI 457
            I GL+ +T+E+ L   F  FG+I  V L+ D+ T +S GFAF+ YE    A +A +E NG  LD K ++V+ + 
Sbjct:   12 IGGLNTETTEKALESYFSKFGRISEVLLMKDRETNKSRGFAFVTYENPGDAKDAARELNGKALDGKPIKVEQAT 85          
BLAST of Transformer 2 alpha homolog vs. Ensembl Sea Lamprey
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 101.679 bits (252), Expect = 2.048e-24
Identity = 43/94 (45.74%), Postives = 64/94 (68.09%), Query Frame = 2
Query:  206 TTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
              PDPS C+G+FGLS  T E+ L + F  +G ++SV+++ D+ +  S GFAF+ ++    A  A +  NGM LD + +RVD+SITK+A+TPTPG
Sbjct:  106 VNPDPSCCLGVFGLSLHTGEKDLKEVFSRYGPVQSVNVVYDQQSGRSRGFAFVYFDNSEDAKEAKERANGMELDGRYIRVDFSITKRAHTPTPG 199          
BLAST of Transformer 2 alpha homolog vs. Ensembl Sea Lamprey
Match: tra2b (transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1094])

HSP 1 Score: 97.4413 bits (241), Expect = 8.201e-23
Identity = 40/92 (43.48%), Postives = 63/92 (68.48%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            P+P+TC+G+FGLS  T+E  L + FG +G +  V+++ D+ +    GFAF+  + +  +  A +  NGM LD + +RVD+SITK+A+TPTPG
Sbjct:  102 PEPNTCLGVFGLSLYTTEHDLREVFGRYGPVADVNVVYDQQSGRPRGFAFVYMQNMEDSKEAKERVNGMELDGRNIRVDFSITKRAHTPTPG 193          
BLAST of Transformer 2 alpha homolog vs. Ensembl Sea Lamprey
Match: rbmx (RNA binding motif protein X-linked [Source:NCBI gene;Acc:321860])

HSP 1 Score: 62.3882 bits (150), Expect = 9.058e-11
Identity = 33/96 (34.38%), Postives = 51/96 (53.12%), Query Frame = 2
Query:  215 DPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKG 502
            DP     + GL+  T+E+ L  TF  +G++  V L+ D+ T  S GFAF+ +     A  A ++ NG  L+ + +RVD   TK ++   PG G  G
Sbjct:    5 DPGKLF-VGGLNIDTTEKALEATFSKYGRVADVLLMKDRETNLSRGFAFVTFANPEDAKEAERDANGKVLEGRAMRVD-QATKPSFESFPGGGRYG 98          
BLAST of Transformer 2 alpha homolog vs. Ensembl Sea Lamprey
Match: srsf2b (serine and arginine rich splicing factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-2420])

HSP 1 Score: 56.9954 bits (136), Expect = 1.364e-9
Identity = 25/79 (31.65%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  218 PSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYS 454
            PS  + +  L+ +TS   L ++F  +G +  V +  D+FT+ES GFAF+ + +   A +A+   +G  LD + +RV  +
Sbjct:    6 PSRALQVDNLTYRTSPEMLRRSFEKYGDVGDVYIPRDRFTRESRGFAFVRFYDKRDAEDAMDAMDGKMLDGRELRVQVA 84          
BLAST of Transformer 2 alpha homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008236.1 (pep scaffold:Pmarinus_7.0:GL481499:15174:17509:-1 gene:ENSPMAG00000007450.1 transcript:ENSPMAT00000008236.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 2.210e-8
Identity = 27/88 (30.68%), Postives = 46/88 (52.27%), Query Frame = 2
Query:  188 SRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDY 451
            SR++       S  + +  LS  T+E  + + F   G IK + + +DK  + S GF F+ Y   + A NA++  NG  LD +++R D+
Sbjct:   31 SRTEQEELLRRSCTLYVGNLSFYTTEEQIHELFVKCGDIKRIIMGLDKVKRTSCGFCFVEYYIRSDAENALRYVNGTRLDDRIIRTDW 118          
BLAST of Transformer 2 alpha homolog vs. Ensembl Yeast
Match: CBC2 (Small subunit of the heterodimeric cap binding complex with Sto1p; interacts with Npl3p, possibly to package mRNA for export from the nucleus; may have a role in telomere maintenance; contains an RNA-binding motif [Source:SGD;Acc:S000006099])

HSP 1 Score: 48.9062 bits (115), Expect = 4.316e-7
Identity = 26/76 (34.21%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  221 STCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVD 448
            S+ I +  LS  TSE  +++ F   G IK + + +D+F     GF FI Y   + A NA+K  +   LD K + +D
Sbjct:   45 SSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYLSDTKLDEKTITID 120          
BLAST of Transformer 2 alpha homolog vs. Ensembl Yeast
Match: SNP1 (Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001323])

HSP 1 Score: 49.6766 bits (117), Expect = 5.607e-7
Identity = 36/113 (31.86%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  143 ESKVLSGIDGSNNLSSRSKN---NTTP-----DPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETN---GMTLDSKVVRVD 448
            E   LS I  +  L  R +N   N  P     DP   I I  L     E  L K F  FG+I+ + ++ DK T++S G+AFI +++  S+  A KE     G+ +  ++  VD
Sbjct:   72 EDIKLSKIKNAQLLDRRLQNWNPNVDPHIKDTDPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRICIVD 184          
BLAST of Transformer 2 alpha homolog vs. Ensembl Yeast
Match: RIE1 (Putative RNA binding protein; localizes to stress granules induced by glucose deprivation; interacts with Rbg1p in a two-hybrid assay; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003482])

HSP 1 Score: 46.9802 bits (110), Expect = 6.770e-6
Identity = 27/79 (34.18%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  230 IGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKK 466
            I + G++K  S   L   F  +G I S+ LI DK   E  G+ FI+Y   + A+  IKE NG T++   + ++Y + +K
Sbjct:  197 IFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKELNGRTVNGSTLFINYHVERK 275          
BLAST of Transformer 2 alpha homolog vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 46.595 bits (109), Expect = 7.566e-6
Identity = 23/96 (23.96%), Postives = 48/96 (50.00%), Query Frame = 2
Query:  167 DGSNNLSSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYS 454
            D     ++ S++ +  + S  + +  L    SE  L+  F   G + S+ +  D  TK SLG+A++N+ +  +   AI++ N   +  ++ R+ +S
Sbjct:   19 DDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWS 114          
BLAST of Transformer 2 alpha homolog vs. Ensembl Nematostella
Match: EDO44802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUS7])

HSP 1 Score: 98.5969 bits (244), Expect = 7.512e-24
Identity = 49/114 (42.98%), Postives = 71/114 (62.28%), Query Frame = 2
Query:  182 LSSRSK---NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITN 514
            LS+R +   N   P PS C+G+FGLS  T+ER L   F  +G ++++ ++ D  T  S GF F+ YE+   A  A + T G+ LD + +RVDYS+TK+A+TPTPG  Y GK + 
Sbjct:   78 LSNRKRHQGNRDNPSPSRCLGVFGLSLYTTERDLRPVFEKYGPVEAIQIVYDHQTGRSRGFGFVYYEDTKDAEVAKERTTGIELDGRRIRVDYSVTKRAHTPTPGV-YMGKASQ 190          
BLAST of Transformer 2 alpha homolog vs. Ensembl Nematostella
Match: EDO39952 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8K1])

HSP 1 Score: 59.6918 bits (143), Expect = 1.282e-10
Identity = 28/89 (31.46%), Postives = 50/89 (56.18%), Query Frame = 2
Query:  185 SSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDY 451
             +R +  +  + S+ + +  LS  TSE+ +++ FG  G++K + + +DK  K   GF F+ Y     A NA++  NG  LD +++R DY
Sbjct:   14 GTRQELESRLETSSTLYVGNLSFYTSEQQIYELFGRAGELKKIIMGLDKVRKTPCGFCFVEYYTRPDAENAMRYINGTRLDQRIIRTDY 102          
BLAST of Transformer 2 alpha homolog vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 57.7658 bits (138), Expect = 3.924e-9
Identity = 30/84 (35.71%), Postives = 48/84 (57.14%), Query Frame = 2
Query:  203 NTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYS 454
            N T D  T + I  +    S+  + K FG  G + S  LI D+ T +SLG+AF+NY+  + A  A++E NG  L +K ++V ++
Sbjct:    3 NGTSDERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFA 86          
BLAST of Transformer 2 alpha homolog vs. Ensembl Nematostella
Match: EDO29519 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3E7])

HSP 1 Score: 52.7582 bits (125), Expect = 2.693e-8
Identity = 31/98 (31.63%), Postives = 51/98 (52.04%), Query Frame = 2
Query:  185 SSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTP 478
            ++R      PD S    I+ L ++ ++  L +TF  FG + S  + +DK T  S  F F++Y+ + SA NAI+  NG  + +K ++V     K A  P
Sbjct:   62 TARQPQKEGPDGSNLF-IYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQLKRPKDANRP 158          
BLAST of Transformer 2 alpha homolog vs. Ensembl Nematostella
Match: EDO35846 (Eukaryotic translation initiation factor 3 subunit G [Source:UniProtKB/Swiss-Prot;Acc:A7SKE9])

HSP 1 Score: 53.5286 bits (127), Expect = 8.108e-8
Identity = 31/96 (32.29%), Postives = 49/96 (51.04%), Query Frame = 2
Query:  167 DGSNNLSSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYS 454
            DG+N       + +  D +  I +  LS++T E  L + F   G I  + L  DKFT +S GFAFIN+     A  AI+  +G   D  ++ V+++
Sbjct:  193 DGANRRGETMPSRSQRDETATIRVTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINFVHREDAARAIEVLSGFGYDHLILNVEWA 288          
BLAST of Transformer 2 alpha homolog vs. Ensembl Medaka
Match: tra2a (transformer-2 protein homolog alpha [Source:NCBI gene;Acc:101157868])

HSP 1 Score: 114.39 bits (285), Expect = 2.864e-28
Identity = 54/113 (47.79%), Postives = 78/113 (69.03%), Query Frame = 2
Query:  182 LSSRSKNNTT---PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKIT 511
            +SSR ++  T   PDPSTC+G+FGL+  T+ER L + F  +G++  ++++ D+ T  S GFAFI +E L  A  AI+ TNGM +D + +RVDYSITK+ +TPTPG  Y G+ T
Sbjct:   92 MSSRRRHTGTRENPDPSTCLGVFGLNLSTTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEHTNGMNMDGRQIRVDYSITKRPHTPTPGI-YMGRPT 203          
BLAST of Transformer 2 alpha homolog vs. Ensembl Medaka
Match: tra2b (transformer 2 beta homolog [Source:NCBI gene;Acc:100049285])

HSP 1 Score: 103.219 bits (256), Expect = 3.668e-24
Identity = 44/96 (45.83%), Postives = 64/96 (66.67%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            N   PDP+ C+G+FGLS  T+ER L   F  +G +  VS++ D+ ++ S GFAF+ +E    A  A ++ NGM LD + +RVD+SITK+ +TPTPG
Sbjct:  114 NRANPDPNACLGVFGLSLYTTERDLKDVFSKYGPLADVSIVYDQQSRRSRGFAFVYFENTPDAKEAKEKANGMELDGRRIRVDFSITKRPHTPTPG 209          
BLAST of Transformer 2 alpha homolog vs. Ensembl Medaka
Match: tra2a (transformer 2a [Source:NCBI gene;Acc:100049284])

HSP 1 Score: 102.834 bits (255), Expect = 4.758e-24
Identity = 44/96 (45.83%), Postives = 66/96 (68.75%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            N   PDPS C+G+FGLS  T+ER L + F  +G +  V+++ D+ ++ S GFAF+ +E    +  A ++ NGM LD + +RVD+SITK+A+TPTPG
Sbjct:  107 NRGNPDPSCCLGVFGLSLYTTERDLREVFSKYGPLSEVNIVYDQQSRRSRGFAFVYFENSEDSKEAKEQANGMELDGRRIRVDFSITKRAHTPTPG 202          
BLAST of Transformer 2 alpha homolog vs. Ensembl Medaka
Match: tra2b (transformer 2 beta homolog [Source:NCBI gene;Acc:100049285])

HSP 1 Score: 102.834 bits (255), Expect = 5.898e-24
Identity = 44/96 (45.83%), Postives = 64/96 (66.67%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            N   PDP+ C+G+FGLS  T+ER L   F  +G +  VS++ D+ ++ S GFAF+ +E    A  A ++ NGM LD + +RVD+SITK+ +TPTPG
Sbjct:  123 NRANPDPNACLGVFGLSLYTTERDLKDVFSKYGPLADVSIVYDQQSRRSRGFAFVYFENTPDAKEAKEKANGMELDGRRIRVDFSITKRPHTPTPG 218          
BLAST of Transformer 2 alpha homolog vs. Ensembl Medaka
Match: tra2b (transformer 2 beta homolog [Source:NCBI gene;Acc:100049285])

HSP 1 Score: 102.064 bits (253), Expect = 1.032e-23
Identity = 44/96 (45.83%), Postives = 64/96 (66.67%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPG 487
            N   PDP+ C+G+FGLS  T+ER L   F  +G +  VS++ D+ ++ S GFAF+ +E    A  A ++ NGM LD + +RVD+SITK+ +TPTPG
Sbjct:  109 NRANPDPNACLGVFGLSLYTTERDLKDVFSKYGPLADVSIVYDQQSRRSRGFAFVYFENTPDAKEAKEKANGMELDGRRIRVDFSITKRPHTPTPG 204          
BLAST of Transformer 2 alpha homolog vs. Planmine SMEST
Match: SMESG000052838.1 (SMESG000052838.1)

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 392/395 (99.24%), Postives = 394/395 (99.75%), Query Frame = 2
Query:   47 MTADWNYXXXXXXXXXXXXXXXXXXXXXXXXPESKVLSGIDGSNNLSSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITNRGARDTKRTFXXXXXXXXXXXXXXXXXXAMKYLSSRHSPVAPMHFTDKRDSFRRYESRRYSPEPRFEMHYASHSNARGYSPMNREPRGFSPSRDDTRSYYSDRPIYPTRNVSRNYSPPRDSNRGYSPRNDLRGISPFKTKYSEFCPNQDMRIGFQPMRNDLNDFSVRQVREFSPDRNGGYSYSPVKTFRPVSPLRKNVRVYSPTREISPVRYGYRQYSPVRVEKYKDRSMVDDNQQFFY 1231
            MTADWNYDSDDDQKKNNSSSTSRRKLDSSKSPESKVLSGIDGSNNLSSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEEL+SATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITNRGARDTKRTFKRKYSPRPRSRS SRKRSAMKYLSSRHSPVAPMHFTDKRDSFRRYESRR+SPEPRFEMHYASHSNARGYSPMNREPRGFSPSRDDTRSYYSDRPIYPTRNVSRNYSPPRDSNRGYSPRNDLRGISPFKTKYSEFCPNQDMRIGFQPMRNDLNDFSVRQVREFSPDRNGGYSYSPVKTFRPVSPLRKNVRVYSPTREISPVRYGYRQYSPVRVEKYKDRSMVDDNQQFFY
Sbjct:    1 MTADWNYDSDDDQKKNNSSSTSRRKLDSSKSPESKVLSGIDGSNNLSSRSKNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELDSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITNRGARDTKRTFKRKYSPRPRSRSSSRKRSAMKYLSSRHSPVAPMHFTDKRDSFRRYESRRHSPEPRFEMHYASHSNARGYSPMNREPRGFSPSRDDTRSYYSDRPIYPTRNVSRNYSPPRDSNRGYSPRNDLRGISPFKTKYSEFCPNQDMRIGFQPMRNDLNDFSVRQVREFSPDRNGGYSYSPVKTFRPVSPLRKNVRVYSPTREISPVRYGYRQYSPVRVEKYKDRSMVDDNQQFFY 395          
BLAST of Transformer 2 alpha homolog vs. Planmine SMEST
Match: SMESG000052829.1 (SMESG000052829.1)

HSP 1 Score: 149.828 bits (377), Expect = 2.682e-41
Identity = 66/102 (64.71%), Postives = 84/102 (82.35%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITNR 517
            P+P  CIG+FGL+K+T E+ LW+TF  FG+I SV LI+DK+ +ESLG+ FINYE+L SAT A+KE +GM LD KV+RVDYSITKKA+TPTPG  Y GK++NR
Sbjct:   73 PEPCKCIGVFGLNKRTEEKILWETFEKFGRIASVKLIMDKYHQESLGYGFINYEDLGSATRAVKEASGMNLDGKVIRVDYSITKKAHTPTPGY-YMGKVSNR 173          
BLAST of Transformer 2 alpha homolog vs. Planmine SMEST
Match: SMESG000052833.1 (SMESG000052833.1)

HSP 1 Score: 149.443 bits (376), Expect = 3.383e-41
Identity = 70/106 (66.04%), Postives = 88/106 (83.02%), Query Frame = 2
Query:  200 NNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITNR 517
            NN  P+P +CIG+FGLSK+T ER L +TF  FG+IK+V+LI+DK+  ESLG+ FINYE+L+SAT AIKE NGM +D K +RVDYSITKKA+TPTPG+ YKGK +NR
Sbjct:   66 NNENPEPCSCIGVFGLSKRTDERELRETFEKFGRIKTVTLIMDKYQHESLGYGFINYEDLDSATRAIKEGNGMNIDGKDIRVDYSITKKAHTPTPGT-YKGKTSNR 170          
BLAST of Transformer 2 alpha homolog vs. Planmine SMEST
Match: SMESG000031644.1 (SMESG000031644.1)

HSP 1 Score: 123.635 bits (309), Expect = 5.082e-32
Identity = 58/107 (54.21%), Postives = 75/107 (70.09%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITNRGARDT 532
            P PSTCIG+FGLS KT E+ L++ F  +G+IK V L++D +T  S GF FI YEE+ SA NA    +G+ +D +VVR+DYSIT+KA+TPTPG     K T RG  DT
Sbjct:   83 PKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKSTRRGVMDT 189          
BLAST of Transformer 2 alpha homolog vs. Planmine SMEST
Match: SMESG000031644.1 (SMESG000031644.1)

HSP 1 Score: 123.635 bits (309), Expect = 5.213e-32
Identity = 58/107 (54.21%), Postives = 75/107 (70.09%), Query Frame = 2
Query:  212 PDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKESLGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGYKGKITNRGARDT 532
            P PSTCIG+FGLS KT E+ L++ F  +G+IK V L++D +T  S GF FI YEE+ SA NA    +G+ +D +VVR+DYSIT+KA+TPTPG     K T RG  DT
Sbjct:   84 PKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKSTRRGVMDT 190          
The following BLAST results are available for this feature:
BLAST of Transformer 2 alpha homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRA2A1.791e-2647.52transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2A1.839e-2647.52transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2A1.839e-2647.52transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2B7.198e-2646.15transformer 2 beta homolog [Source:HGNC Symbol;Acc... [more]
TRA2A1.801e-2547.52transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsp-85.438e-1840.86SR Protein (Splicing factor) [Source:UniProtKB/Tr... [more]
rsp-85.438e-1840.86SR Protein (Splicing factor) [Source:UniProtKB/Tr... [more]
rbmx-23.082e-837.66RBMX2 ortholog [Source:UniProtKB/TrEMBL;Acc:Q1831... [more]
etr-15.580e-836.59ELAV-Type RNA binding-protein family [Source:UniP... [more]
etr-15.580e-836.59ELAV-Type RNA binding-protein family [Source:UniP... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra23.379e-2240.21gene:FBgn0003742 transcript:FBtr0089616[more]
tra25.757e-2240.21gene:FBgn0003742 transcript:FBtr0089615[more]
tra25.757e-2240.21gene:FBgn0003742 transcript:FBtr0089619[more]
tra27.061e-2240.21gene:FBgn0003742 transcript:FBtr0089620[more]
tra27.061e-2240.21gene:FBgn0003742 transcript:FBtr0089621[more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a6.163e-2648.91transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a6.163e-2648.91transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a9.387e-2647.52transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a1.408e-2547.52transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2b1.521e-2342.59transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg56.920e-2644.74pleckstrin homology and RhoGEF domain containing G... [more]
rit13.792e-2445.83Ras-like without CAAX 1 [Source:Xenbase;Acc:XB-GEN... [more]
adat16.371e-1132.00adenosine deaminase, tRNA-specific 1 [Source:Xenba... [more]
trerf13.155e-1035.48transcriptional regulating factor 1 [Source:Xenbas... [more]
trerf13.737e-1035.48transcriptional regulating factor 1 [Source:Xenbas... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tra2b4.941e-2646.15transformer 2 beta [Source:MGI Symbol;Acc:MGI:1060... [more]
Tra2a1.188e-2547.52transformer 2 alpha [Source:MGI Symbol;Acc:MGI:193... [more]
Tra2a1.237e-2547.52transformer 2 alpha [Source:MGI Symbol;Acc:MGI:193... [more]
Tra2b2.237e-2546.88transformer 2 beta [Source:MGI Symbol;Acc:MGI:1060... [more]
Gm292893.966e-1445.33predicted gene 29289 [Source:MGI Symbol;Acc:MGI:55... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PFR5|TRA2A_MOUSE8.478e-2547.52Transformer-2 protein homolog alpha OS=Mus musculu... [more]
sp|Q13595|TRA2A_HUMAN8.650e-2547.52Transformer-2 protein homolog alpha OS=Homo sapien... [more]
sp|P62997|TRA2B_RAT1.565e-2446.88Transformer-2 protein homolog beta OS=Rattus norve... [more]
sp|P62996|TRA2B_MOUSE1.565e-2446.88Transformer-2 protein homolog beta OS=Mus musculus... [more]
sp|P62995|TRA2B_HUMAN1.565e-2446.88Transformer-2 protein homolog beta OS=Homo sapiens... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B3CGK93.259e-2548.57Transformer 2 alpha homolog OS=Oryzias melastigma ... [more]
A0A437CW163.646e-2548.57RRM domain-containing protein OS=Oryzias javanicus... [more]
A0A3P9K3F47.441e-2547.79Transformer 2 alpha homolog OS=Oryzias latipes OX=... [more]
A0A3B3H7T67.608e-2547.79Transformer 2 alpha homolog OS=Oryzias latipes OX=... [more]
A0A3P9I3E47.739e-2547.79Transformer 2 alpha homolog OS=Oryzias latipes OX=... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034164.14.292e-2644.95pep primary_assembly:Astyanax_mexicanus-2.0:12:654... [more]
tra2a1.103e-2542.48transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a2.000e-2546.53transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2b2.592e-2343.27transformer-2 protein homolog alpha-like [Source:N... [more]
rbmx2.414e-1240.54RNA binding motif protein X-linked [Source:NCBI ge... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a2.048e-2445.74transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2b8.201e-2343.48transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GE... [more]
rbmx9.058e-1134.38RNA binding motif protein X-linked [Source:NCBI ge... [more]
srsf2b1.364e-931.65serine and arginine rich splicing factor 2b [Sourc... [more]
ENSPMAT00000008236.12.210e-830.68pep scaffold:Pmarinus_7.0:GL481499:15174:17509:-1 ... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
CBC24.316e-734.21Small subunit of the heterodimeric cap binding com... [more]
SNP15.607e-731.86Component of U1 snRNP required for mRNA splicing v... [more]
RIE16.770e-634.18Putative RNA binding protein; localizes to stress ... [more]
PAB17.566e-623.96Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448027.512e-2442.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399521.282e-1031.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348793.924e-935.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295192.693e-831.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358468.108e-832.29Eukaryotic translation initiation factor 3 subunit... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a2.864e-2847.79transformer-2 protein homolog alpha [Source:NCBI g... [more]
tra2b3.668e-2445.83transformer 2 beta homolog [Source:NCBI gene;Acc:1... [more]
tra2a4.758e-2445.83transformer 2a [Source:NCBI gene;Acc:100049284][more]
tra2b5.898e-2445.83transformer 2 beta homolog [Source:NCBI gene;Acc:1... [more]
tra2b1.032e-2345.83transformer 2 beta homolog [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Transformer 2 alpha homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052838.10.000e+099.24SMESG000052838.1[more]
SMESG000052829.12.682e-4164.71SMESG000052829.1[more]
SMESG000052833.13.383e-4166.04SMESG000052833.1[more]
SMESG000031644.15.082e-3254.21SMESG000031644.1[more]
SMESG000031644.15.213e-3254.21SMESG000031644.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000198 ID=SMED30000198|Name=Transformer 2 alpha homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=1638bp
TTAAAAATTAATATTGAAGTATAAAATTAAAAAATATAAATTAAATATGA
CTGCCGACTGGAATTATGACTCTGATGATGATCAAAAGAAAAATAATTCA
TCTAGTACTTCACGGAGAAAGTTAGATTCAAGTAAATCTCCTGAATCAAA
GGTTTTATCAGGTATTGATGGTTCAAACAATTTATCTAGCCGTTCCAAAA
ATAATACAACTCCTGATCCATCAACTTGTATTGGAATATTCGGATTATCG
AAAAAAACTAGCGAGCGCACATTATGGAAAACCTTTGGAAATTTTGGTAA
GATTAAAAGTGTATCACTTATTGTAGATAAGTTCACGAAAGAATCACTTG
GATTTGCGTTCATTAATTATGAAGAGCTAAATTCCGCGACAAATGCTATA
AAAGAAACAAATGGAATGACTTTAGATTCTAAAGTTGTTCGAGTTGATTA
TAGCATAACAAAAAAGGCTTATACACCAACTCCTGGTAGTGGTTATAAAG
GAAAAATTACCAACCGAGGAGCTAGAGATACTAAAAGAACTTTTAAAAGA
AAATATTCACCGCGACCTCGATCTAGAAGTTTAAGCAGAAAGCGGTCAGC
AATGAAATATTTAAGTTCAAGACATTCACCCGTTGCTCCTATGCATTTTA
CAGACAAGAGAGATTCATTTAGAAGGTATGAATCTAGAAGATACTCCCCA
GAACCTCGTTTCGAAATGCATTATGCATCACATAGTAATGCTAGAGGCTA
TTCTCCAATGAATAGAGAACCCAGGGGCTTTTCTCCAAGTAGAGATGATA
CAAGAAGTTATTACTCTGATAGACCGATTTATCCCACAAGAAATGTAAGC
AGAAATTATTCTCCTCCAAGAGATTCCAATCGGGGATATTCTCCAAGAAA
TGACTTAAGAGGTATCTCACCATTCAAAACTAAATATAGTGAGTTTTGTC
CCAATCAAGATATGAGGATTGGTTTTCAGCCTATGCGTAATGACTTAAAC
GATTTCTCTGTTAGACAAGTGAGGGAGTTTTCTCCTGACAGAAATGGGGG
ATATTCCTATTCACCAGTTAAAACTTTCAGGCCTGTCAGCCCATTGAGAA
AAAATGTTAGAGTTTATTCTCCGACAAGGGAGATAAGCCCAGTTAGGTAT
GGGTATAGACAATATTCTCCAGTTAGAGTTGAGAAATACAAAGATCGTTC
CATGGTTGACGATAATCAGCAATTTTTTTACTGAGTTTGATTTGAAATTG
TTAATTTGACAATTGTAATTTAAAGTTGTGGTGGAGAATATAAATTAAAA
TATGATGCTCAATAAATATTAGTTGTATGTTTCGATGTAATTAGTTTTCT
CATATTAACAAGATAATCGATGAAAAATTATAATGCAAAAACTTGCGGAA
TATTGGAAAATTTTGGTTTATATTTATTTTGCATTTTATGAACATTTGTG
TGATTGTCAGGAACTATAAATAAGTGCAAGAAATTATAAAGATCAAAAAT
GAACAAATTAAAGCTGGAATGATAAATCAAGAAATAAGTTTTAGGCAATT
GTTTATTTTTATATAAATTACAAACAAATGAATTTCAGTGCTGTTGGATC
TTAAATATAAATAAATCACAGTATTTATTAGTAAACGC
back to top

protein sequence of SMED30000198-orf-1

>SMED30000198-orf-1 ID=SMED30000198-orf-1|Name=SMED30000198-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=396bp
MTADWNYDSDDDQKKNNSSSTSRRKLDSSKSPESKVLSGIDGSNNLSSRS
KNNTTPDPSTCIGIFGLSKKTSERTLWKTFGNFGKIKSVSLIVDKFTKES
LGFAFINYEELNSATNAIKETNGMTLDSKVVRVDYSITKKAYTPTPGSGY
KGKITNRGARDTKRTFKRKYSPRPRSRSLSRKRSAMKYLSSRHSPVAPMH
FTDKRDSFRRYESRRYSPEPRFEMHYASHSNARGYSPMNREPRGFSPSRD
DTRSYYSDRPIYPTRNVSRNYSPPRDSNRGYSPRNDLRGISPFKTKYSEF
CPNQDMRIGFQPMRNDLNDFSVRQVREFSPDRNGGYSYSPVKTFRPVSPL
RKNVRVYSPTREISPVRYGYRQYSPVRVEKYKDRSMVDDNQQFFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 61..134
e-value: 2.0E-19
score: 80.6
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 64..132
e-value: 1.1E-16
score: 60.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 60..138
score: 15.545
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 2..144
e-value: 4.0E-26
score: 93.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 32..55
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 155..288
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 198..223
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..55
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 259..279
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 7..31
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 162..188
NoneNo IPR availablePANTHERPTHR15241:SF3TRANSFORMER-2 PROTEIN HOMOLOG ALPHAcoord: 44..158
NoneNo IPR availablePANTHERPTHR15241TRANSFORMER-2-RELATEDcoord: 44..158
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 53..160