Vang-2

Overview
NameVang-2 (ADZ58510.1)
Smed IDSMED30000196
Length (bp)2046
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vang-2 (SMED30000196) t-SNE clustered cells

Violin plots show distribution of expression levels for Vang-2 (SMED30000196) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vang-2 (SMED30000196) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vang-2 (SMED30000196) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000196

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000196SMESG000053210.1 HQ141794.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30000196SMESG000053210.1 HQ141794.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30000196SMESG000053210.1 HQ141794.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30000196SMESG000053210.1 HQ141794.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30000196SMESG000053210.1 HQ141794.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vang-2 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 194.897 bits (494), Expect = 6.249e-54
Identity = 153/469 (32.62%), Postives = 242/469 (51.60%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAEN--INGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             D    DC   +   +   LG++ F +PI  I+LP I    W   +  C T CE   + +  KL IL I +  LF R++    PRV VF+ +L++L+F+ +   WLFY +RIL   D+R  +++  +V ++ S+ D L+F HYL++V+LE+R L+  F ++VVRS DGESRFY +G++SIQ AA+ +L+ Y  DF +YN                  L +SK +   H +  +  N            V  P     ++ G               S  E  Y+E EHE+R+KKR+ RL+ + E++F  ++R    E Q+         + +   EAAQ I   +A+  QKYLR+ R Q       I  HL  C+  GM+ ++FLE ++S    L+  ++  ++ Q W +    ++  GL + + F+LK    SL+  V  +P   LSE+ ID +S KF+++  SETSV
Sbjct:   98 EDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPIL---WRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRIL---DSR-DRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYN---------------PNLLTASKFRAAKHMAGLKVYN------------VDGPSN---NATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPG------EVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQ-WRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 522          
BLAST of Vang-2 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 194.897 bits (494), Expect = 6.974e-54
Identity = 153/469 (32.62%), Postives = 242/469 (51.60%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAEN--INGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             D    DC   +   +   LG++ F +PI  I+LP I    W   +  C T CE   + +  KL IL I +  LF R++    PRV VF+ +L++L+F+ +   WLFY +RIL   D+R  +++  +V ++ S+ D L+F HYL++V+LE+R L+  F ++VVRS DGESRFY +G++SIQ AA+ +L+ Y  DF +YN                  L +SK +   H +  +  N            V  P     ++ G               S  E  Y+E EHE+R+KKR+ RL+ + E++F  ++R    E Q+         + +   EAAQ I   +A+  QKYLR+ R Q       I  HL  C+  GM+ ++FLE ++S    L+  ++  ++ Q W +    ++  GL + + F+LK    SL+  V  +P   LSE+ ID +S KF+++  SETSV
Sbjct:  100 EDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPIL---WRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRIL---DSR-DRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYN---------------PNLLTASKFRAAKHMAGLKVYN------------VDGPSN---NATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPG------EVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQ-WRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          
BLAST of Vang-2 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 194.897 bits (494), Expect = 6.974e-54
Identity = 153/469 (32.62%), Postives = 242/469 (51.60%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAEN--INGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             D    DC   +   +   LG++ F +PI  I+LP I    W   +  C T CE   + +  KL IL I +  LF R++    PRV VF+ +L++L+F+ +   WLFY +RIL   D+R  +++  +V ++ S+ D L+F HYL++V+LE+R L+  F ++VVRS DGESRFY +G++SIQ AA+ +L+ Y  DF +YN                  L +SK +   H +  +  N            V  P     ++ G               S  E  Y+E EHE+R+KKR+ RL+ + E++F  ++R    E Q+         + +   EAAQ I   +A+  QKYLR+ R Q       I  HL  C+  GM+ ++FLE ++S    L+  ++  ++ Q W +    ++  GL + + F+LK    SL+  V  +P   LSE+ ID +S KF+++  SETSV
Sbjct:  100 EDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPIL---WRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRIL---DSR-DRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYN---------------PNLLTASKFRAAKHMAGLKVYN------------VDGPSN---NATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPG------EVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQ-WRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          
BLAST of Vang-2 vs. Ensembl Human
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:HGNC Symbol;Acc:HGNC:15512])

HSP 1 Score: 194.897 bits (494), Expect = 6.974e-54
Identity = 153/469 (32.62%), Postives = 242/469 (51.60%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAEN--INGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             D    DC   +   +   LG++ F +PI  I+LP I    W   +  C T CE   + +  KL IL I +  LF R++    PRV VF+ +L++L+F+ +   WLFY +RIL   D+R  +++  +V ++ S+ D L+F HYL++V+LE+R L+  F ++VVRS DGESRFY +G++SIQ AA+ +L+ Y  DF +YN                  L +SK +   H +  +  N            V  P     ++ G               S  E  Y+E EHE+R+KKR+ RL+ + E++F  ++R    E Q+         + +   EAAQ I   +A+  QKYLR+ R Q       I  HL  C+  GM+ ++FLE ++S    L+  ++  ++ Q W +    ++  GL + + F+LK    SL+  V  +P   LSE+ ID +S KF+++  SETSV
Sbjct:  100 EDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPIL---WRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRIL---DSR-DRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYN---------------PNLLTASKFRAAKHMAGLKVYN------------VDGPSN---NATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPG------EVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQ-WRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          
BLAST of Vang-2 vs. Ensembl Human
Match: VANGL2 (VANGL planar cell polarity protein 2 [Source:HGNC Symbol;Acc:HGNC:15511])

HSP 1 Score: 124.02 bits (310), Expect = 2.813e-29
Identity = 83/212 (39.15%), Postives = 127/212 (59.91%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISK 1211
             D  P DC  ++       L ++SF +P+  ++LP +    W   +  C T CE   + +  KL IL + S  LF RR   + PRV V + +L++L+F+++   WLFY +RIL   D R  + +  VV F+ S+ D L+F HYL++V+LE+R L+ +F +KVVRS DG SRFY +G++SIQ  A+ IL+ Y  DFP+YN    +  KS ++K
Sbjct:   96 EDSVPLDCSRHLGVAAGATLALLSFLTPLAFLLLPPLL---WREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLVVSYWLFYGVRIL---DAR-ERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK 300          

HSP 2 Score: 96.6709 bits (239), Expect = 2.161e-20
Identity = 56/167 (33.53%), Postives = 93/167 (55.69%), Query Frame = 3
Query: 1479 STEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIST-PKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            + E++F  +KR  E E+Q+  N  ++    +   EAAQ I A +A+  QKYLR  + Q       I  HL  C+ + M+ ++FLE +++  P +    E    + WT+  +  +  GL + + F+LKR+  SL+ +   VP F LSE+ +D +S KF+++  SETSV
Sbjct:  362 AVEEAFTHIKRLQE-EEQK--NPREV----MDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-2 vs. Ensembl Celegans
Match: vang-1 (Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q95ZZ6])

HSP 1 Score: 159.844 bits (403), Expect = 9.549e-42
Identity = 134/458 (29.26%), Postives = 234/458 (51.09%), Query Frame = 3
Query:  639 LGVMSFASPIMMIILPNIK-IFGWS--GIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDN---VVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRE------SVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            L ++S  S  +M  LP I   FG+S   I C   CE  L  +  K   L IA  VL+ R+     PR+   +  L  L+  I+F  WLFY++RI+        + +DN   +VS+S S+ D L++THYLS+V+LE+R L  +F + +VR PDGE     +G  SIQ AA +IL+ Y   F  +N++  +  +++++K S     ++  K     ++ +   +E  S+   R  +++  +           R +  Y        E + +E++ EKRLKKR+ RL+A+ ED+F+ ++   E    +    N+     + ++ AAQN+   + +P  KYL+  RLQ + P   +  H+ +CL   +S ++FL+ F S    +   E +    W++ C  ++  G+ +    +LK         V L+CT+  +P F+L+E      ++KF +K ++E++V
Sbjct:  107 LCIISVVSAPIMCSLPIIAPRFGFSMPAIQCDVDCEGLLFLMAIKTIFLVIAIGVLYWRKAMADMPRLYFVRAALTFLVMFILFAFWLFYIVRIMF-------ERYDNYKYIVSYSTSLLDALLWTHYLSVVLLELRRLRAQFIVTIVRDPDGEMHTLNIGAGSIQEAATEILRFYTTRFSSFNIHLDNARQTAVAKQSGMQGGTAGFKM---YNIEQFGGQETVSEVNTRALMEAAAR-----------RRIGGYA-------EVMQEELDFEKRLKKRKYRLIAAAEDAFSHVQNTAESGTNQKPGINNQ----MDSLTAAQNVFTWIVRPLTKYLKTTRLQSRHPSGEVTRHIERCLTLKLSHRTFLQRFFSDR--IPQREIVGESKWSVICDEAVSSGVQHGTYLVLKSHNPDIDCGVQLVCTISSIPFFNLTEQA-KPGNEKFSLKISNESAV 529          
BLAST of Vang-2 vs. Ensembl Celegans
Match: vang-1 (Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q95ZZ6])

HSP 1 Score: 159.458 bits (402), Expect = 1.099e-41
Identity = 134/458 (29.26%), Postives = 234/458 (51.09%), Query Frame = 3
Query:  639 LGVMSFASPIMMIILPNIK-IFGWS--GIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDN---VVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRE------SVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            L ++S  S  +M  LP I   FG+S   I C   CE  L  +  K   L IA  VL+ R+     PR+   +  L  L+  I+F  WLFY++RI+        + +DN   +VS+S S+ D L++THYLS+V+LE+R L  +F + +VR PDGE     +G  SIQ AA +IL+ Y   F  +N++  +  +++++K S     ++  K     ++ +   +E  S+   R  +++  +           R +  Y        E + +E++ EKRLKKR+ RL+A+ ED+F+ ++   E    +    N+     + ++ AAQN+   + +P  KYL+  RLQ + P   +  H+ +CL   +S ++FL+ F S    +   E +    W++ C  ++  G+ +    +LK         V L+CT+  +P F+L+E      ++KF +K ++E++V
Sbjct:  110 LCIISVVSAPIMCSLPIIAPRFGFSMPAIQCDVDCEGLLFLMAIKTIFLVIAIGVLYWRKAMADMPRLYFVRAALTFLVMFILFAFWLFYIVRIMF-------ERYDNYKYIVSYSTSLLDALLWTHYLSVVLLELRRLRAQFIVTIVRDPDGEMHTLNIGAGSIQEAATEILRFYTTRFSSFNIHLDNARQTAVAKQSGMQGGTAGFKM---YNIEQFGGQETVSEVNTRALMEAAAR-----------RRIGGYA-------EVMQEELDFEKRLKKRKYRLIAAAEDAFSHVQNTAESGTNQKPGINNQ----MDSLTAAQNVFTWIVRPLTKYLKTTRLQSRHPSGEVTRHIERCLTLKLSHRTFLQRFFSDR--IPQREIVGESKWSVICDEAVSSGVQHGTYLVLKSHNPDIDCGVQLVCTISSIPFFNLTEQA-KPGNEKFSLKISNESAV 532          
BLAST of Vang-2 vs. Ensembl Fly
Match: Vang (gene:FBgn0015838 transcript:FBtr0088566)

HSP 1 Score: 190.274 bits (482), Expect = 3.953e-52
Identity = 151/486 (31.07%), Postives = 257/486 (52.88%), Query Frame = 3
Query:  579 ENDK-YPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSG-------------IVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRI-----LLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLET-AENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            E+DK + F C   +++     LG  +F SP+ M+++P +  F  +              + CS  C+  LV +  +L +L I    +F RR +   PR+ +++ ++++L+ I  F  WLFY++++     +++     + D+ ++V ++ +  D L+F HY+++V+LE+RH +  + IK++RSPDG SR Y +G +SIQ AA+ +LQ Y +DFP++N Y       S+SK       S +NK        E        Q    R V +     R S                 S  E+ Y+E E+E+R+KKRR RL+ + E++F  +KR          N+   ++  L   EAA  +   +A+  QKYLR+ R Q +     I  HL  CL++ +S ++FLE +++   V+++  E    Q W++ C   + + + N+ TF L +  VSLM TVH +P F+L+E+ +D +S KF++K NSETSV
Sbjct:  130 ESDKGFSFACRRYVESSFYFLLGCGAFFSPVAMVVMPYVGFFPSAFDHPEITQTVRTQLLACSEQCKGQLVSLAARLLLLAIGLWAVFMRRTSATMPRIFLYRALVLLLVTICTFAYWLFYIVQVTNGAKIVVETGGDAVDYKSLVGYATNFVDTLLFIHYVAVVLLELRHQQPCYYIKIIRSPDGVSRSYMLGQLSIQRAAVWVLQHYYVDFPIFNPYL-ERIPISVSK-------SQRNKISNSFKYYEVDGVSNSQQQSQSRAVLAANARRRDS-----------------SHNERFYEEHEYERRVKKRRARLITAAEEAFTHIKRIH--------NEPAPALP-LDPQEAASAVFPSMARALQKYLRVTRQQPRHTFESILKHLAHCLKHDLSPRAFLEPYLTESPVMQSEKERRWVQSWSLICDEIVSRPIGNECTFQLIQNDVSLMVTVHKLPHFNLAEEVVDPKSNKFVLKLNSETSV 581          
BLAST of Vang-2 vs. Ensembl Fly
Match: Vang (gene:FBgn0015838 transcript:FBtr0330624)

HSP 1 Score: 190.66 bits (483), Expect = 5.946e-52
Identity = 151/486 (31.07%), Postives = 257/486 (52.88%), Query Frame = 3
Query:  579 ENDK-YPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSG-------------IVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRI-----LLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLET-AENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            E+DK + F C   +++     LG  +F SP+ M+++P +  F  +              + CS  C+  LV +  +L +L I    +F RR +   PR+ +++ ++++L+ I  F  WLFY++++     +++     + D+ ++V ++ +  D L+F HY+++V+LE+RH +  + IK++RSPDG SR Y +G +SIQ AA+ +LQ Y +DFP++N Y       S+SK       S +NK        E        Q    R V +     R S                 S  E+ Y+E E+E+R+KKRR RL+ + E++F  +KR          N+   ++  L   EAA  +   +A+  QKYLR+ R Q +     I  HL  CL++ +S ++FLE +++   V+++  E    Q W++ C   + + + N+ TF L +  VSLM TVH +P F+L+E+ +D +S KF++K NSETSV
Sbjct:  130 ESDKGFSFACRRYVESSFYFLLGCGAFFSPVAMVVMPYVGFFPSAFDHPEITQTVRTQLLACSEQCKGQLVSLAARLLLLAIGLWAVFMRRTSATMPRIFLYRALVLLLVTICTFAYWLFYIVQVTNGAKIVVETGGDAVDYKSLVGYATNFVDTLLFIHYVAVVLLELRHQQPCYYIKIIRSPDGVSRSYMLGQLSIQRAAVWVLQHYYVDFPIFNPYL-ERIPISVSK-------SQRNKISNSFKYYEVDGVSNSQQQSQSRAVLAANARRRDS-----------------SHNERFYEEHEYERRVKKRRARLITAAEEAFTHIKRIH--------NEPAPALP-LDPQEAASAVFPSMARALQKYLRVTRQQPRHTFESILKHLAHCLKHDLSPRAFLEPYLTESPVMQSEKERRWVQSWSLICDEIVSRPIGNECTFQLIQNDVSLMVTVHKLPHFNLAEEVVDPKSNKFVLKLNSETSV 581          
BLAST of Vang-2 vs. Ensembl Zebrafish
Match: vangl2 (VANGL planar cell polarity protein 2 [Source:NCBI gene;Acc:245949])

HSP 1 Score: 186.422 bits (472), Expect = 4.772e-51
Identity = 138/420 (32.86%), Postives = 214/420 (50.95%), Query Frame = 3
Query:  720 CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            C T CE   V +  KL +L I+S  LF R      PR  VF+ +L+ L+F+ +   WLFY +R+L        +D+  +V ++ S+ D L+F  YL+LV+LE+RHL   FC+KVVR+ DG SRFY +G++SIQ AA+ +L  Y  DFP+YN    +  KS +SK  +     S  +++                            S  +S G               S  E  Y+E E ++R++KR+ RL+ + E++F  +KR    +D           + +   EAAQ I A +A+  QKYLR  R Q       I +HL  C+ + M+ ++FLE +++  P +    EN  G+ WT+  +  +   L   L F L+R   +L+ TV  +P  +L E+ ID +S KF+++  SETSV
Sbjct:  142 CGTPCEGLYVSLAFKLLVLLISSWALFLRPSRSTLPRFFVFRCLLMALVFLFVASYWLFYGVRVL----EPRERDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLRPAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDHYYTDFPVYNPALLNLPKSILSKKMSGFKVYSLGEEN----------------------------STNNSTGQSRAMIAAAARRRDNSHNEYYYEEAEMDRRVRKRKARLVVAVEEAFTHIKR---LQDDEAAASPKHPREVMDPREAAQAIFAPMARAMQKYLRTTRQQPYHSMESIISHLQFCITHNMTPKAFLERYLTPGPTMQYQRENGRGRQWTLVSEEPVTAALRQGLVFSLRRLDFALVVTVTPLPFLNLGEEFIDPKSHKFVMRLQSETSV 526          
BLAST of Vang-2 vs. Ensembl Zebrafish
Match: vangl1 (VANGL planar cell polarity protein 1 [Source:ZFIN;Acc:ZDB-GENE-040621-2])

HSP 1 Score: 165.236 bits (417), Expect = 1.981e-43
Identity = 134/427 (31.38%), Postives = 209/427 (48.95%), Query Frame = 3
Query:  717 VCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKD------SNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETA-ENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             C T CE   + +  KL IL +A   LF R    + PR+ VF+ +L +L  +++   WLF+ +RIL   D+    ++  +V F+ S+ D L+F HYL++V+LEIRHL+  F + VVRS DGE+  Y MG +SIQ AA+ IL+ Y  DF ++N    +  KS  +K        N D   S        +      R+RD+                                   S  E  Y+E EH++R++KR+ RL+ + E++F  ++R  + E ++           +   EAAQ I   +A+  QKYLR  R Q       I  HL  C+   M+ ++FLES+++    L+   E+   + WT+  + S+   L N   F LK    SL+ T   +P   LSE+ +  +S KF+++  SETSV
Sbjct:  146 TCGTACEGLFLSLAFKLLILLLAGWALFMRPTRASLPRIAVFRALLGLLTLLLLLSYWLFFGVRILDSQDD----NYQGIVQFAVSLVDALLFIHYLAVVLLEIRHLQPCFSLCVVRSTDGETHHYNMGQLSIQRAALVILEHYYKDFTVHNPALLTAAKSRAAKHLAGLKVYNVDGAGSDAATAQSRAKMAAAARQRDT-----------------------------------SHNELYYEEAEHDRRVRKRKARLVVAVEEAFTHVRRLQDEEKKKPPGDE------MDPREAAQAIFPSMARALQKYLRTTRQQHCHSMDSIQAHLAFCITNNMTPKAFLESYLTAGPTLQYGRESSQTRHWTLVSEASVTSPLRNGSEFQLKSSDFSLVVTSKTIPHLKLSEEYVHPKSHKFVLQLQSETSV 527          
BLAST of Vang-2 vs. Ensembl Xenopus
Match: krt12.2 (keratin 12, gene 2 [Source:Xenbase;Acc:XB-GENE-6492280])

HSP 1 Score: 139.813 bits (351), Expect = 1.237e-34
Identity = 87/211 (41.23%), Postives = 129/211 (61.14%), Query Frame = 3
Query:  585 DKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISK 1211
            D    DC  ++  VI   L ++SF +PI  ++LP I    W   +  C T CE   + +  KL IL + S  LF RR    FPRV VF+ +L++L+F+++   WLFY +RIL   D    K++  +V ++ S+ D L+F HYL++V+LE+R L+ +F +KVVRS DG SRFY +G++SIQ  A+ IL+ Y  DFP+YN    +  KS +SK
Sbjct:   97 DSAKLDCSRHLGVVIGGALALLSFLTPIAFMLLPQIL---WREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFVFRALLMVLVFLLVVSYWLFYGVRILESRD----KNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQFTVKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSK 300          

HSP 2 Score: 94.7449 bits (234), Expect = 9.621e-20
Identity = 55/169 (32.54%), Postives = 94/169 (55.62%), Query Frame = 3
Query: 1473 MASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            + + E++F  +KR  + EDQ+  N  +I    +   EAAQ I A +A+  QKYLR  + Q       I +HL  C+ + M+ ++FLE ++   P +    +    + WT+  +  +  GL + + F+LKR+  SL+ +   +P F LSE+ +D +S KF+++  SETSV
Sbjct:  360 VVAVEEAFTHIKRLQD-EDQK--NPREI----MDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILHHLEFCITHDMTPKAFLERYLGPGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-2 vs. Ensembl Mouse
Match: Vangl1 (VANGL planar cell polarity 1 [Source:MGI Symbol;Acc:MGI:2159344])

HSP 1 Score: 191.815 bits (486), Expect = 6.108e-53
Identity = 153/469 (32.62%), Postives = 243/469 (51.81%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAEN--INGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             D    DC   +   +   LG++ F +PI  I+LP I    W   +  C   CE  L+ +  KL IL I +  LF R++    PRV VF+ +L++L+F+ +   WLFY +RIL   D+R  +++ ++V ++ S+ D L+F HYL++V+LE+R L+  F ++VVRS DGESRFY +G++SIQ AA+ +L+ Y  DF +YN                  L +SK +   H +  +  N            V  P     ++ G               S  E  Y+E EHE+R+KKRR RL+ + E++F  ++R    E Q++        + +   EAAQ I   +A+  QKYLR  R Q       I  HL  C+   M+ ++FLE ++S    L+  ++  ++ Q W +  + ++  GL + + F+LK    SL+  V  +P   LSE+ ID +S KF+++  SETSV
Sbjct:  102 EDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPQIL---WREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRADVPRVFVFRALLLVLIFLFVVSYWLFYGVRIL---DSR-DQNYKDIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYN---------------PNLLTASKFRAAKHMAGLKVYN------------VDGP---SNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRRARLVVAVEEAFIHIQRLQAEEQQKSPG------EVMDPREAAQAIFPSMARALQKYLRTTRQQHYHSMESILQHLAFCITNSMTPKAFLERYLSAGPTLQYDKDRWLSTQ-WRLISEEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV 526          
BLAST of Vang-2 vs. Ensembl Mouse
Match: Vangl1 (VANGL planar cell polarity 1 [Source:MGI Symbol;Acc:MGI:2159344])

HSP 1 Score: 128.642 bits (322), Expect = 1.082e-31
Identity = 79/198 (39.90%), Postives = 123/198 (62.12%), Query Frame = 3
Query:  585 DKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYN 1172
            D    DC   +   +   LG++ F +PI  I+LP I    W   +  C   CE  L+ +  KL IL I +  LF R++    PRV VF+ +L++L+F+ +   WLFY +RIL   D+R  +++ ++V ++ S+ D L+F HYL++V+LE+R L+  F ++VVRS DGESRFY +G++SIQ AA+ +L+ Y  DF +YN
Sbjct:  103 DSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPQIL---WREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRADVPRVFVFRALLLVLIFLFVVSYWLFYGVRIL---DSR-DQNYKDIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYN 293          
BLAST of Vang-2 vs. Ensembl Mouse
Match: Vangl1 (VANGL planar cell polarity 1 [Source:MGI Symbol;Acc:MGI:2159344])

HSP 1 Score: 127.487 bits (319), Expect = 8.386e-31
Identity = 79/198 (39.90%), Postives = 123/198 (62.12%), Query Frame = 3
Query:  585 DKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYN 1172
            D    DC   +   +   LG++ F +PI  I+LP I    W   +  C   CE  L+ +  KL IL I +  LF R++    PRV VF+ +L++L+F+ +   WLFY +RIL   D+R  +++ ++V ++ S+ D L+F HYL++V+LE+R L+  F ++VVRS DGESRFY +G++SIQ AA+ +L+ Y  DF +YN
Sbjct:  103 DSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPQIL---WREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRADVPRVFVFRALLLVLIFLFVVSYWLFYGVRIL---DSR-DQNYKDIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYN 293          

HSP 2 Score: 69.3218 bits (168), Expect = 7.363e-12
Identity = 41/123 (33.33%), Postives = 67/123 (54.47%), Query Frame = 3
Query: 1614 KPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAEN--INGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            +  QKYLR  R Q       I  HL  C+   M+ ++FLE ++S    L+  ++  ++ Q W +  + ++  GL + + F+LK    SL+  V  +P   LSE+ ID +S KF+++  SETSV
Sbjct:  355 RALQKYLRTTRQQHYHSMESILQHLAFCITNSMTPKAFLERYLSAGPTLQYDKDRWLSTQ-WRLISEEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV 476          
BLAST of Vang-2 vs. Ensembl Mouse
Match: Vangl2 (VANGL planar cell polarity 2 [Source:MGI Symbol;Acc:MGI:2135272])

HSP 1 Score: 123.635 bits (309), Expect = 2.497e-29
Identity = 83/212 (39.15%), Postives = 127/212 (59.91%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISK 1211
             D  P DC  ++       L ++SF +P+  ++LP +    W   +  C T CE   + +  KL IL + S  LF RR   + PRV V + +L++L+F+++   WLFY +RIL   D R  + +  VV F+ S+ D L+F HYL++V+LE+R L+ +F +KVVRS DG SRFY +G++SIQ  A+ IL+ Y  DFP+YN    +  KS ++K
Sbjct:   96 EDSVPLDCSRHLGVAAGAILALLSFLTPLAFLLLPPLL---WREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLVISYWLFYGVRIL---DAR-ERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK 300          

HSP 2 Score: 96.6709 bits (239), Expect = 1.484e-20
Identity = 56/167 (33.53%), Postives = 93/167 (55.69%), Query Frame = 3
Query: 1479 STEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIST-PKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            + E++F  +KR  E E+Q+  N  ++    +   EAAQ I A +A+  QKYLR  + Q       I  HL  C+ + M+ ++FLE +++  P +    E    + WT+  +  +  GL + + F+LKR+  SL+ +   VP F LSE+ +D +S KF+++  SETSV
Sbjct:  362 AVEEAFTHIKRLQE-EEQK--NPREV----MDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-2 vs. Ensembl Mouse
Match: Vangl2 (VANGL planar cell polarity 2 [Source:MGI Symbol;Acc:MGI:2135272])

HSP 1 Score: 123.635 bits (309), Expect = 2.497e-29
Identity = 83/212 (39.15%), Postives = 127/212 (59.91%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISK 1211
             D  P DC  ++       L ++SF +P+  ++LP +    W   +  C T CE   + +  KL IL + S  LF RR   + PRV V + +L++L+F+++   WLFY +RIL   D R  + +  VV F+ S+ D L+F HYL++V+LE+R L+ +F +KVVRS DG SRFY +G++SIQ  A+ IL+ Y  DFP+YN    +  KS ++K
Sbjct:   96 EDSVPLDCSRHLGVAAGAILALLSFLTPLAFLLLPPLL---WREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLVISYWLFYGVRIL---DAR-ERSYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK 300          

HSP 2 Score: 96.6709 bits (239), Expect = 1.484e-20
Identity = 56/167 (33.53%), Postives = 93/167 (55.69%), Query Frame = 3
Query: 1479 STEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIST-PKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            + E++F  +KR  E E+Q+  N  ++    +   EAAQ I A +A+  QKYLR  + Q       I  HL  C+ + M+ ++FLE +++  P +    E    + WT+  +  +  GL + + F+LKR+  SL+ +   VP F LSE+ +D +S KF+++  SETSV
Sbjct:  362 AVEEAFTHIKRLQE-EEQK--NPREV----MDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-2 vs. UniProt/SwissProt
Match: sp|Q8TAA9|VANG1_HUMAN (Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 3.349e-53
Identity = 153/469 (32.62%), Postives = 242/469 (51.60%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAEN--INGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             D    DC   +   +   LG++ F +PI  I+LP I    W   +  C T CE   + +  KL IL I +  LF R++    PRV VF+ +L++L+F+ +   WLFY +RIL   D+R  +++  +V ++ S+ D L+F HYL++V+LE+R L+  F ++VVRS DGESRFY +G++SIQ AA+ +L+ Y  DF +YN                  L +SK +   H +  +  N            V  P     ++ G               S  E  Y+E EHE+R+KKR+ RL+ + E++F  ++R    E Q+         + +   EAAQ I   +A+  QKYLR+ R Q       I  HL  C+  GM+ ++FLE ++S    L+  ++  ++ Q W +    ++  GL + + F+LK    SL+  V  +P   LSE+ ID +S KF+++  SETSV
Sbjct:  100 EDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPIL---WRDELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRIL---DSR-DRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYN---------------PNLLTASKFRAAKHMAGLKVYN------------VDGPSN---NATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPG------EVMDPREAAQAIFPSMARALQKYLRITRQQNYHSMESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQ-WRLVSDEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV 524          
BLAST of Vang-2 vs. UniProt/SwissProt
Match: sp|Q80Z96|VANG1_MOUSE (Vang-like protein 1 OS=Mus musculus OX=10090 GN=Vangl1 PE=1 SV=2)

HSP 1 Score: 191.815 bits (486), Expect = 4.272e-52
Identity = 153/469 (32.62%), Postives = 243/469 (51.81%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAEN--INGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             D    DC   +   +   LG++ F +PI  I+LP I    W   +  C   CE  L+ +  KL IL I +  LF R++    PRV VF+ +L++L+F+ +   WLFY +RIL   D+R  +++ ++V ++ S+ D L+F HYL++V+LE+R L+  F ++VVRS DGESRFY +G++SIQ AA+ +L+ Y  DF +YN                  L +SK +   H +  +  N            V  P     ++ G               S  E  Y+E EHE+R+KKRR RL+ + E++F  ++R    E Q++        + +   EAAQ I   +A+  QKYLR  R Q       I  HL  C+   M+ ++FLE ++S    L+  ++  ++ Q W +  + ++  GL + + F+LK    SL+  V  +P   LSE+ ID +S KF+++  SETSV
Sbjct:  102 EDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPQIL---WREELKPCGAICEGLLISVSFKLLILLIGTWALFFRKQRADVPRVFVFRALLLVLIFLFVVSYWLFYGVRIL---DSR-DQNYKDIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVLENYYKDFTIYN---------------PNLLTASKFRAAKHMAGLKVYN------------VDGP---SNNATGQSRAMIAAAARRRDSSHNELYYEEAEHERRVKKRRARLVVAVEEAFIHIQRLQAEEQQKSPG------EVMDPREAAQAIFPSMARALQKYLRTTRQQHYHSMESILQHLAFCITNSMTPKAFLERYLSAGPTLQYDKDRWLSTQ-WRLISEEAVTNGLRDGIVFVLKCLDFSLVVNVKKIPFIVLSEEFIDPKSHKFVLRLQSETSV 526          
BLAST of Vang-2 vs. UniProt/SwissProt
Match: sp|Q8UVJ6|VANG2_DANRE (Vang-like protein 2 OS=Danio rerio OX=7955 GN=vangl2 PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 3.602e-50
Identity = 138/420 (32.86%), Postives = 214/420 (50.95%), Query Frame = 3
Query:  720 CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            C T CE   V +  KL +L I+S  LF R      PR  VF+ +L+ L+F+ +   WLFY +R+L        +D+  +V ++ S+ D L+F  YL+LV+LE+RHL   FC+KVVR+ DG SRFY +G++SIQ AA+ +L  Y  DFP+YN    +  KS +SK  +     S  +++                            S  +S G               S  E  Y+E E ++R++KR+ RL+ + E++F  +KR    +D           + +   EAAQ I A +A+  QKYLR  R Q       I +HL  C+ + M+ ++FLE +++  P +    EN  G+ WT+  +  +   L   L F L+R   +L+ TV  +P  +L E+ ID +S KF+++  SETSV
Sbjct:  142 CGTPCEGLYVSLAFKLLVLLISSWALFLRPSRSTLPRFFVFRCLLMALVFLFVASYWLFYGVRVL----EPRERDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLRPAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDHYYTDFPVYNPALLNLPKSILSKKMSGFKVYSLGEEN----------------------------STNNSTGQSRAMIAAAARRRDNSHNEYYYEEAEMDRRVRKRKARLVVAVEEAFTHIKR---LQDDEAAASPKHPREVMDPREAAQAIFAPMARAMQKYLRTTRQQPYHSMESIISHLQFCITHNMTPKAFLERYLTPGPTMQYQRENGRGRQWTLVSEEPVTAALRQGLVFSLRRLDFALVVTVTPLPFLNLGEEFIDPKSHKFVMRLQSETSV 526          
BLAST of Vang-2 vs. UniProt/SwissProt
Match: sp|Q90Z05|VNG2B_XENLA (Vang-like protein 2-B OS=Xenopus laevis OX=8355 GN=vangl2-b PE=1 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 2.840e-34
Identity = 88/211 (41.71%), Postives = 129/211 (61.14%), Query Frame = 3
Query:  585 DKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISK 1211
            D    DC  ++  VI   L ++SF +PI  ++LP I    W   +  C T CE   + +  KL IL + S  LF RR    FPRV VF+ +L++L+F+++   WLFY +RIL   D    K++  +V ++ S+ D L+F HYL++V+LE+R L+ +F IKVVRS DG SRFY +G++SIQ  A+ IL+ Y  DFP+YN    +  KS +SK
Sbjct:   97 DSAKLDCSRHLGVVIAGALALLSFLTPIAFMLLPQIL---WREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFVFRALLMVLVFLLVVSYWLFYGVRILESRD----KNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQFTIKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSK 300          

HSP 2 Score: 90.8929 bits (224), Expect = 9.096e-18
Identity = 53/169 (31.36%), Postives = 90/169 (53.25%), Query Frame = 3
Query: 1473 MASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            + + E++F  +KR    +D+   N  +I    +   EAAQ I A +A+  QKYLR  + Q       I  HL  C+ + M+ ++FLE ++   P +    +    + WT+  +  +  GL + + F LKR+  SL+ +   +P F LSE+ +D +S KF+++  SETSV
Sbjct:  360 VVAVEEAFTHIKRL---QDEDPKNPREI----MDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILQHLEFCITHDMTPKAFLERYLGPGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFELKRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-2 vs. UniProt/SwissProt
Match: sp|Q90X64|VNG2A_XENLA (Vang-like protein 2-A OS=Xenopus laevis OX=8355 GN=vangl2-a PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 4.459e-34
Identity = 88/211 (41.71%), Postives = 129/211 (61.14%), Query Frame = 3
Query:  585 DKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISK 1211
            D    DC  ++  VI   L ++SF +PI  ++LP I    W   +  C T CE   + +  KL IL + S  LF RR    FPRV VF+ +L++L+F+++   WLFY +RIL   D    K++  +V ++ S+ D L+F HYL++V+LE+R L+ +F IKVVRS DG SRFY +G++SIQ  A+ IL+ Y  DFP+YN    +  KS +SK
Sbjct:   97 DSAKLDCSRHLGVVIGGALALLSFLTPIAFMLLPQIL---WREDLEQCGTACEGLFISVAFKLLILLLGSWALFFRRPKAFFPRVFVFRALLMVLVFLLVVSYWLFYGVRILESRD----KNYQGIVQYAVSLVDALLFVHYLAVVLLELRQLQPQFTIKVVRSTDGASRFYNIGHLSIQRVAVWILENYYHDFPVYNPALLNLPKSILSK 300          

HSP 2 Score: 94.7449 bits (234), Expect = 5.142e-19
Identity = 55/169 (32.54%), Postives = 94/169 (55.62%), Query Frame = 3
Query: 1473 MASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            + + E++F  +KR  + EDQ+  N  +I    +   EAAQ I A +A+  QKYLR  + Q       I +HL  C+ + M+ ++FLE ++   P +    +    + WT+  +  +  GL + + F+LKR+  SL+ +   +P F LSE+ +D +S KF+++  SETSV
Sbjct:  360 VVAVEEAFTHIKRLQD-EDQK--NPREI----MDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESILHHLEFCITHDMTPKAFLERYLGPGPTIQYHKDRWLAKQWTLVSEEPVTNGLKDGVVFVLKRQDFSLVVSTKKIPFFKLSEEFVDPKSHKFVMRLQSETSV 521          
BLAST of Vang-2 vs. TrEMBL
Match: F2WMR3 (Vang-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1187.56 bits (3071), Expect = 0.000e+0
Identity = 625/628 (99.52%), Postives = 627/628 (99.84%), Query Frame = 3
Query:   93 MNYSTNNNTQLSYVNSPTKLKEIPAALFPIMSTGFNTYMSYPSPENMTNYTNSILLPQCSPPPIPKFNVDVTKPLSLSSFDKLEESDSNQETKDGNIIFNSSVSQMKTDFLDSTSGREDWTEDMGMEMMHDNDRTNQSTHLFSQTINTDXXXXXXXXXXXXYENDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            MNYSTNNNTQLSYVNSPTKLKEIPAALFPIMSTGFNTYMSYPSPENMTNYTNSILLPQCSPPPIPKFNVDVTKPLSLSSFDKLEESDSNQETKDGNIIFNSSVSQMKTDFLDSTSGREDWTEDMGMEMMHDNDRTNQSTHLFSQT+NTDKSSKVSNCSSVNYENDK+PFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFI CKLCILCIASLVLFCRRKTYAFPRVLVFKLVLIMLLFIIIFGLWLFYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEKRLKKRRLRLMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV
Sbjct:    1 MNYSTNNNTQLSYVNSPTKLKEIPAALFPIMSTGFNTYMSYPSPENMTNYTNSILLPQCSPPPIPKFNVDVTKPLSLSSFDKLEESDSNQETKDGNIIFNSSVSQMKTDFLDSTSGREDWTEDMGMEMMHDNDRTNQSTHLFSQTLNTDKSSKVSNCSSVNYENDKFPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFIWCKLCILCIASLVLFCRRKTYAFPRVLVFKLVLIMLLFIIIFGLWLFYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEKRLKKRRLRLMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 628          
BLAST of Vang-2 vs. TrEMBL
Match: A0A0L8FGX6 (Vang-like protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22021207mg PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 6.384e-66
Identity = 155/470 (32.98%), Postives = 255/470 (54.26%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDS----NTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAENING-QIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            +D   FDC   + T +   L +  FASPI+M+ILP + I  W    C   CE  L+    KL IL + ++ LF R      PRV VF+ V++ L+F++ F  WLFY +RI    D +T  ++ N+V FS S+ D L+F HYLS++VLEIR L+ ++ +KVVRSPDG S+ Y +G +SIQ AA+ +L+ Y  DFP++N Y  +  K S    S    + D  ++   +    ++  P +R RD+                                   S  E+ Y+E E+E+R++KR+ RL+ S +++F  +KR          ++   +I  +   EAAQ +   +A+  QKYLR+ R Q ++    +  HL  C+ + +S ++F+E +++   V+   ++  G + W + C   L + + + + F L++  +SL+C+VH +P FSL+E+ ID +  KF+++ NSETSV
Sbjct:  120 DDSIGFDCTRYVGTALATFLSLFGFASPIIMVILPKLGIMTWDAGPCKPECEGLLISFTFKLIILLMGTMALFFRHPKATMPRVYVFRAVVLFLVFVLTFAFWLFYGVRIFKRKDAKT--EYYNIVQFSVSLVDALLFIHYLSIIVLEIRQLQPQYVVKVVRSPDGLSQNYNIGILSIQRAAVSVLENYYKDFPVFNPYLENVHKRSSKVTSLKIYDVDGVNTSGPQGRQRAVFAPNSRRRDT-----------------------------------SHNERFYEEQEYERRVRKRKARLIMSADEAFTHIKRMQ--------DEQGPAIP-MDPYEAAQAVFPSMARALQKYLRVTRQQPRYTMEAVLQHLATCISHDVSPKAFVEKYLTQGAVIMNEKDYKGLEKWVLVCDHLLTREIEHGIVFQLRQGELSLLCSVHKLPHFSLTEEVIDPKHNKFVLRLNSETSV 543          
BLAST of Vang-2 vs. TrEMBL
Match: A0A0F6N0Q3 (Vang-like protein OS=Terebratalia transversa OX=34513 GN=str PE=2 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 3.152e-64
Identity = 160/484 (33.06%), Postives = 258/484 (53.31%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGW----------------SGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERD--SQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAENIN-GQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            +D   FDC   + +V+   LG ++F SPI+M++LP + I GW                +G  C   CE  L+ +  KL IL I +  LF R+     PR+ +F+  ++ L+F++ F  WLFY +RIL     +  KD+ +++SF+ S+ D L+F HYLS+++LEIR ++  + ++VVRSPDGESR Y +G +SIQ AA+ IL+ Y  DFP+YN Y  S   SS  K+  T+         TH +   P  R R   + +  RR           S  D+F                  Y+E E+E+RL+KRR RL+ + +++F  ++R  E        +   +I  +   EAAQ I   +A+  QKYLR+ R Q ++    I  HL  CL + MS +SF+E ++S   V+    +    Q W + C   L + + +   F L++  ++++C+V  +P F+++E+ I+ +  KF+++ NSETSV
Sbjct:  101 DDSMGFDCARYIGSVLAAILGFLAFVSPIVMVLLPKLNIDGWETVPCEASCIVDTKTDTGSNCEPKCEGLLISLAFKLLILLIGTWALFFRKPKATMPRIFIFRAAILFLVFVLTFAFWLFYAVRIL----QKKEKDYYSIISFAVSLADSLLFIHYLSIILLEIRQMQPMYVVRVVRSPDGESRSYNIGQLSIQRAAVTILEQYYKDFPVYNPYLDSIPGSSRRKNL-TNFKFYDVDGVTHQT---PHGRSRAIFAAAAHRRD---------RSHNDRF------------------YEEQEYERRLRKRRARLIVAADEAFTHIRRLHE--------EQGPAIP-MDPQEAAQAIFPSMARALQKYLRVTRQQPRYSMENILEHLAACLSHDMSPRSFIERYMSQGNVIHNDRDHRPTQTWVLICDTLLSRAVEDGTLFQLRQGDIAILCSVRKIPHFNITEEVINPKDNKFVLRLNSETSV 540          
BLAST of Vang-2 vs. TrEMBL
Match: B7PN71 (Vang-like protein OS=Ixodes scapularis OX=6945 GN=8050805 PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 4.742e-64
Identity = 153/465 (32.90%), Postives = 256/465 (55.05%), Query Frame = 3
Query:  597 FDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFD----NVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAENING-QIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            F C     TV+T  L + +F SP++M+ LP +++F W    C   C+  L+    KL IL +AS  LF R+     PR+ + + V++ ++F+  F  WLF+ +R+      +  +D++    ++V F+ S+ D L+F HYL+++++E+R L+ +F +K+VRSPDG+SR Y +G +SIQ AA+ +L  Y  DFP+YN Y   T  S   K        S  K   +D      + + D     + TV   R   RS   D+F                  Y+E E+E+R++KR+ RL+++ ED+F  +KR  +   Q T  +  I    +   EAAQ I   +A+  QKYLR+ R Q +     I +HL +CL Y +S ++FLE ++ +  VL+    +   Q W + C V L + L   ++F+L++  +SL+ +VH +P F+++E+ +D +S +F+++ NSETSV
Sbjct:  138 FRCHMWAGTVLTGVLSLTAFLSPVVMVALPRVEMFEWKVQKCGPECDGLLISFAFKLLILAVASWALFLRKPRATMPRIFILRAVVLAMVFVFTFSYWLFFSVRVF----EKRHQDYELTYLSIVQFALSLVDALLFIHYLAVILVEVRQLQPQFYVKIVRSPDGQSRSYAVGQLSIQRAAVWMLHKYYQDFPIYNPYL-DTLPSRHRKQQQQLQQQSAFK--VYDVDGGAMDEDGDIPPRNQTTVLPAR---RSGHNDRF------------------YEEHEYERRVRKRKARLVSAAEDAFTHIKRMHDENGQGT--RPAIP---MDPTEAAQAIFPSMARALQKYLRITRQQPRHTMQGILDHLAECLHYDLSPRAFLEKYLVSAPVLQDDREVRPVQTWALVCDVLLSRPLKPGVSFLLRQGEISLLVSVHALPHFNVTEEIVDPKSNRFVLRLNSETSV 569          
BLAST of Vang-2 vs. TrEMBL
Match: A0A267F6F3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014477g1 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.180e-63
Identity = 158/479 (32.99%), Postives = 252/479 (52.61%), Query Frame = 3
Query:  597 FDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDS--------NTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISI--------KFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAENING---QIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            FDC   M TV+++ LG+ +F SP++M++LP    F W    CS  CE  L+ +  +L IL +A+  LF RR   + PRV +F+++++ L+F+I F  WLFY +R+          D+ ++V F+  +TD L+F HYL +V+LEIRHL+ ++ IKV+RSPDGES  Y +G +SIQ AA+ +LQ Y +DF  +N Y      S+ ++ +        + D  S  N        N          S  R   +                       GS S  ++ Y E E+E+RL+KRR RL+ + E++F  ++R    E     +              K ++  EAAQ +   + +  QKYLR+ + Q ++    + +HL  C+ YG+SA++F+E +++   V+E      G   Q WT+ C     + L + + F L++  VSL CTV  +P FSL E+  D++  KF+++ NSETSV
Sbjct:  171 FDCGRAMATVLSVTLGLAAFISPLVMVVLPKAGAFTWELKECSVACEGKLISLAFRLLILLVATWCLFFRRGRASMPRVYIFRVLILFLIFVITFAFWLFYGVRVW----QYQESDYSSIVEFAVGLTDALLFVHYLGVVLLEIRHLQARYAIKVLRSPDGESHIYPVGELSIQRAAVLVLQQYAVDFNAFNPYLEQAYASARNRSAHRRSYRFYDVDQGSQANGSAAAGGDNGGGGNGGGHSSSGRHQRRGSAAG-------------GGGGGGSRSAADRFYDECEYERRLRKRRARLVTAAEEAFAHVRRATNSELMGPQHLPQHMPQQQQQPIGKPMSAYEAAQTVFPTMLRALQKYLRITKQQPRYTTDMVLHHLTNCIHYGLSAKAFIERYLTQGPVVEDPRAPAGRKRQTWTLLCDCMPSRSLDDGVQFCLRQGDVSLFCTVKRIPFFSLGEEVFDNKRHKFVLRLNSETSV 632          
BLAST of Vang-2 vs. Ensembl Cavefish
Match: vangl2 (VANGL planar cell polarity protein 2 [Source:NCBI gene;Acc:103047256])

HSP 1 Score: 191.815 bits (486), Expect = 4.389e-53
Identity = 143/420 (34.05%), Postives = 218/420 (51.90%), Query Frame = 3
Query:  720 CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            C T CE   V +  KL +L I+S  LF R      PR  VF+ +L+ L+F+ +   WLFY +R+L        KD+  +V ++ S+ D L+F  YL+LV+LE+RHL   FC+KVVR+ DG SRFY +G++SIQ AA+ +L  Y  DFP+YN    +  KS +SK  +     S  +++                            S  +S G               S  E  Y+E E ++R++KR+ RL+ + E++F  +KR  E ++Q T  K+   +  +   EAAQ I A +A+  QKYLR  R Q       I  HL  C+ + M+ ++FLE +++  P +    EN  G+ WT+  +  +   L   L F L+R   SL+ TV  +P  +L E+ ID +S KF+++  SETSV
Sbjct:  140 CGTPCEGLYVSLAFKLLVLLISSWALFLRPPRATLPRFFVFRCLLMALVFLFVASYWLFYGVRVL----EPKEKDYRGIVGYAVSLVDALLFIQYLALVLLEVRHLRPAFCLKVVRTTDGASRFYNVGHLSIQRAAVWVLDQYYSDFPVYNPALLNLPKSILSKKMSGFKVYSLGEEN----------------------------STNNSTGQSRAMIAAAARRRDNSHNEYYYEEAEMDRRVRKRKARLVVAVEEAFTHIKRLQE-DEQATSPKHPREV--MDPREAAQAIFAPMARAMQKYLRTTRQQPYHSMESIIAHLQFCITHNMTPKAFLERYLTPGPTMQYQRENGRGRQWTLVSEEPVTSALRQGLVFSLRRLDFSLVVTVTSLPFLNLGEEFIDPKSHKFVMRLQSETSV 524          
BLAST of Vang-2 vs. Ensembl Cavefish
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:NCBI gene;Acc:103034531])

HSP 1 Score: 179.489 bits (454), Expect = 1.310e-48
Identity = 146/466 (31.33%), Postives = 232/466 (49.79%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETA-ENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            +D    DC   +    ++ LG++   +P+  ++LP++ ++     VC T CE   + +  KL IL +A   LF R      PR+ VF+ +L  L+F+ +   WLFY +RI    D    +D+  +V ++ S+ D L+F HYL++V+LE+R L+  F + V RS DGE+R Y +G +SIQ AA+ +L+ Y  DFP++N    +  KS  +K     L   K         N        SQS       + R+                      S  E  Y+E EHE+R++KR+ RL+ + E++F  ++R  E E +++        + +   EAAQ I   +A+  QKYLR  R Q       I  HL  C+ + M+ ++FLES++     L+   E      WT+  + S+  GL     F+LK    SL+ T   +P   LSE+ ID +S KF+++  SETSV
Sbjct:   99 DDSVGLDCKHYLSVSFSVILGLLVLLTPLAFLVLPHL-LWPERLRVCGTACEGLFISVAFKLLILLLAVWALFFRPPRAGMPRIFVFRALLSTLVFLFVLSYWLFYGVRIFDTKD----EDYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPCFSLCVTRSTDGETRHYNLGQLSIQRAAVAVLENYYRDFPVHNPALLTASKSRAAK----HLAGLKVYNVDGPGGNNAAAGIAQSQSRAMIAAAARRR--------------------DTSHNELYYEEAEHERRVRKRKARLVVAVEEAFTHIRRLQEEEQKKSPG------EIMDPREAAQAIFPSMARALQKYLRTTRQQHCHSMESIQQHLAFCITHNMTPKAFLESYLMPGPTLQYGRERWLAHQWTLISEASVTSGLKEGTVFLLKCIDFSLVVTTKKIPYIKLSEEFIDPKSHKFVLRLQSETSV 529          
BLAST of Vang-2 vs. Ensembl Cavefish
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:103036576])

HSP 1 Score: 169.859 bits (429), Expect = 4.599e-45
Identity = 136/427 (31.85%), Postives = 216/427 (50.59%), Query Frame = 3
Query:  717 VCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKD------SNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETA-ENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             C T CE   + +  KL IL +A   +F RR   A PR+ +FK +L +L  +++   WLF+ +RIL    +   +++  +V F+ S+ D L+FTHYL++V+LE+RHL+  FC+ V+RS DGE R Y +G +SIQ AA+ +L+ Y  DF ++N    +  KS  +K        N D   +K K    D    P +    SQS  +    +  +    S                    E  Y+E +HE+R++KRR RL+ + E++F  ++R  E E ++     D+    +   EAAQ I   +A+  QKYLR  R Q       I  HL  C+   M+ ++FLES++S+   L+   E      WT+  + ++   L +   F LK    SL+ +   +P   +SE  +  +S KF++   SETSV
Sbjct:  143 ACGTACEGLFLSLAFKLLILLLAGWAVFLRRPRAALPRLAIFKALLALLTLLLLLSYWLFFGVRIL----DSQDENYQGIVQFAVSLVDALLFTHYLAVVLLEVRHLQPCFCLCVIRSTDGERRHYNLGQLSIQRAAVVVLEQYYKDFSVHNAALLTAAKSRTAKHLAALKVYNVDAFKAKLKTYLSDC---PGSDGGASQSRAKMAAAARHKDTSHS--------------------ELYYEEADHERRVRKRRARLVVAVEEAFTHVQRLQEEEKKKP--PGDV----MDPREAAQAIFPSMARALQKYLRTTRQQHCHTMDSIQTHLAFCITNNMTPKAFLESYLSSGPTLQYGRECWQALQWTLVSEAAVTSPLRDGTEFQLKNADFSLVVSTKSIPHLKISEVYVHPKSHKFVLLLQSETSV 536          
BLAST of Vang-2 vs. Ensembl Cavefish
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:103036576])

HSP 1 Score: 167.933 bits (424), Expect = 1.472e-44
Identity = 133/421 (31.59%), Postives = 216/421 (51.31%), Query Frame = 3
Query:  717 VCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETA-ENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             C T CE   + +  KL IL +A   +F RR   A PR+ +FK +L +L  +++   WLF+ +RIL    +   +++  +V F+ S+ D L+FTHYL++V+LE+RHL+  FC+ V+RS DGE R Y +G +SIQ AA+ +L+ Y  DF ++N    +  KS  +K     L + K       +++ P +    SQS  +    +  +    S                    E  Y+E +HE+R++KRR RL+ + E++F  ++R  E E ++     D+    +   EAAQ I   +A+  QKYLR  R Q       I  HL  C+   M+ ++FLES++S+   L+   E      WT+  + ++   L +   F LK    SL+ +   +P   +SE  +  +S KF++   SETSV
Sbjct:  143 ACGTACEGLFLSLAFKLLILLLAGWAVFLRRPRAALPRLAIFKALLALLTLLLLLSYWLFFGVRIL----DSQDENYQGIVQFAVSLVDALLFTHYLAVVLLEVRHLQPCFCLCVIRSTDGERRHYNLGQLSIQRAAVVVLEQYYKDFSVHNAALLTAAKSRTAK----HLAALKVY-----NVDGPGSDGGASQSRAKMAAAARHKDTSHS--------------------ELYYEEADHERRVRKRRARLVVAVEEAFTHVQRLQEEEKKKP--PGDV----MDPREAAQAIFPSMARALQKYLRTTRQQHCHTMDSIQTHLAFCITNNMTPKAFLESYLSSGPTLQYGRECWQALQWTLVSEAAVTSPLRDGTEFQLKNADFSLVVSTKSIPHLKISEVYVHPKSHKFVLLLQSETSV 524          
BLAST of Vang-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010728.1 (pep scaffold:Pmarinus_7.0:GL486594:2920:5521:1 gene:ENSPMAG00000009715.1 transcript:ENSPMAT00000010728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 1.019e-19
Identity = 53/167 (31.74%), Postives = 83/167 (49.70%), Query Frame = 3
Query: 1479 STEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIST-PKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            + E++F  ++R  E E+QR      +  +     EAAQ I   +A+  QKYLR  + Q       I  HL  C+ + M+A++FLE ++S  P V    +      W +     +   L +   F L R  + L+ TV   P F+LSE  +D +S KF+++  SETSV
Sbjct:    5 AAEEAFTHVRRLQE-EEQRAGTGLTMDPQ-----EAAQAIFPSMARALQKYLRATKQQPFHSMEGILKHLAHCIAHDMTARAFLEKYLSPGPTVQYEPDKWLSSQWRLLSAEPVTSALRDGTAFSLARADLCLVVTVSRAPRFTLSETFLDPKSHKFVLRLQSETSV 165          
BLAST of Vang-2 vs. Ensembl Nematostella
Match: EDO38357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD40])

HSP 1 Score: 200.29 bits (508), Expect = 3.959e-57
Identity = 145/467 (31.05%), Postives = 242/467 (51.82%), Query Frame = 3
Query:  579 ENDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLE-TAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            E     F    +   +    + +++ ASPI+ +++P   +  W   +C   C+   + +  K  IL +    L+ R+     PRV V ++ +++L F+++   WLFY LRI+     +  +DF  ++ F+ ++ D L+F HYLS++VL +R  E  F +KV+RS DG ++FY +G +SIQ AAI +L+ Y  DFP YN Y  S    S +K  +T      + K   +S   P+ R   + S         R++P   + D+F                  Y+E E E++LK+R+ RL+A+ E++F  +KR           +   S+  +   E AQ++    A+P QKYLR  +   +     I  HL  CL + MS ++FLE +++    +E T  ++  Q W++ C+  +  GL+N   F LK E +SL+ TV+++P F + ED  D E+ KF++K NSETSV
Sbjct:   33 EKKGLAFGVCRHFKLIPAAIISLIALASPILFLVIP---VVLWKPPMCGIECDGLFLSLAVKELILVVGIWALYFRKSRVTMPRVFVLRVGVLVLAFLVLVCYWLFYGLRII----AKRGQDFGEILKFAVTLVDSLLFLHYLSVIVLWLRQSEPMFTLKVIRSTDGVNKFYNVGLLSIQRAAIYVLEQYYKDFPEYNPYMMSVPARSSAKQFSTLKFYDIDGKLQDNSKVNPRTRAIITAS------SQGRRNP--GRNDRF------------------YEEAEFERKLKRRKARLVATCEEAFGHIKRVQL--------ERGPSVP-MDPEETAQSLFPSFARPLQKYLRTVKQHHRHNMDAILKHLAHCLTFDMSPKAFLERYLNDQPCIEYTGASVGPQSWSLVCEEQVTSGLSNSTVFQLKTEVLSLVVTVNNIPHFVVDEDEFDFENNKFVLKLNSETSV 457          
BLAST of Vang-2 vs. Ensembl Nematostella
Match: EDO27076 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA95])

HSP 1 Score: 103.219 bits (256), Expect = 5.543e-26
Identity = 51/133 (38.35%), Postives = 79/133 (59.40%), Query Frame = 3
Query: 1581 EAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLE-TAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            E AQ++    A+P QKYLR  +   +     I  HL  CL + MS ++FLE +++    +E T  ++  Q W++ C+  +  GL+N   F LK E +SL+ TV+++P F + ED  D E+ KF++K NSETSV
Sbjct:    5 ETAQSLFPSFARPLQKYLRTVKQHHRHNMDAILKHLAHCLTFDMSPKAFLERYLNDQPCIEYTGASVGPQSWSLVCEEQVTSGLSNSTVFQLKTEVLSLVVTVNNIPHFVVDEDEFDFENNKFVLKLNSETSV 137          
BLAST of Vang-2 vs. Ensembl Medaka
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:NCBI gene;Acc:101165035])

HSP 1 Score: 191.045 bits (484), Expect = 9.773e-53
Identity = 146/469 (31.13%), Postives = 233/469 (49.68%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSK-NKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             D    +C   +  ++ + LGV+   +P+  ++LP++    W   +  C T CE   + I  KL IL +A   LF R    + PRV  F+ +L +L+ + +   WLFY +RIL   D     D+  +V ++ S+ D L+F HYL++V+LE+R L+  F + V RS DGE+R Y +G +SIQ AA+ I++ Y  DFP++N    S  KS  +K     L   K    D     N P      SQS       +                         S  E  Y+E EHE+R++KR+ RL+ + E++F  +KR  E E +++    D+    +   EAAQ I   + +  QKYLR  + Q       I  HL  C+   M+ ++FLES+++  P +  + +    + WT+  + S+  GL +   F+LK    SL+     +P   +SE+ ID +S KF+++  SETSV
Sbjct:   98 EDSVGLNCRRYLTRILAVILGVLVLLTPLAFLVLPHLL---WPDKLQNCGTACEGLYISIAFKLLILLLAVWGLFFRPPRASLPRVFAFRALLSVLVLLFVISYWLFYAVRILEAQD----ADYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPCFSVCVTRSTDGETRHYNLGQLSIQQAALAIIEHYYSDFPVHNPALLSASKSRAAK----HLAGLKVYNVDGPGPGNNPAAGLAHSQSRAMIAAAA--------------------RRRDTSHNELYYEEAEHERRVRKRKARLVVAVEEAFTHIKRMQEEEQKKS--PGDV----MDPREAAQAIFPSMTRALQKYLRTTKQQHCHSMESIQQHLAFCITNNMTPKAFLESYLTPGPTLQYSRDRWLARQWTLISEASVTSGLRDGTVFLLKCVDFSLVIAAKKIPFVQMSEEYIDPKSHKFVLRLQSETSV 529          
BLAST of Vang-2 vs. Ensembl Medaka
Match: VANGL1 (VANGL planar cell polarity protein 1 [Source:NCBI gene;Acc:101165035])

HSP 1 Score: 191.045 bits (484), Expect = 6.174e-52
Identity = 146/469 (31.13%), Postives = 232/469 (49.47%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSK-NKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             D    +C   +  ++ + LGV+   +P+  ++LP++    W   +  C T CE   + I  KL IL +A   LF R    + PRV  F+ +L +L+ + +   WLFY +RIL   D     D+  +V ++ S+ D L+F HYL++V+LE+R L+  F + V RS DGE+R Y +G +SIQ AA+ I++ Y  DFP++N    S  KS  +K     L   K    D     N P      SQS                                 S  E  Y+E EHE+R++KR+ RL+ + E++F  +KR  E E +++    D+    +   EAAQ I   + +  QKYLR  + Q       I  HL  C+   M+ ++FLES+++  P +  + +    + WT+  + S+  GL +   F+LK    SL+     +P   +SE+ ID +S KF+++  SETSV
Sbjct:  206 EDSVGLNCRRYLTRILAVILGVLVLLTPLAFLVLPHLL---WPDKLQNCGTACEGLYISIAFKLLILLLAVWGLFFRPPRASLPRVFAFRALLSVLVLLFVISYWLFYAVRILEAQD----ADYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPCFSVCVTRSTDGETRHYNLGQLSIQQAALAIIEHYYSDFPVHNPALLSASKSRAAK----HLAGLKVYNVDGPGPGNNPAAGLAHSQSRA--------------------MIAAAARRRDTSHNELYYEEAEHERRVRKRKARLVVAVEEAFTHIKRMQEEEQKKS--PGDV----MDPREAAQAIFPSMTRALQKYLRTTKQQHCHSMESIQQHLAFCITNNMTPKAFLESYLTPGPTLQYSRDRWLARQWTLISEASVTSGLRDGTVFLLKCVDFSLVIAAKKIPFVQMSEEYIDPKSHKFVLRLQSETSV 637          
BLAST of Vang-2 vs. Ensembl Medaka
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:101170632])

HSP 1 Score: 186.422 bits (472), Expect = 5.144e-51
Identity = 145/460 (31.52%), Postives = 230/460 (50.00%), Query Frame = 3
Query:  624 VITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKD------SNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             + +C+G++  A+P++ ++LP +    W   +  C   CE   + I  KL IL +A   LF R      PRV V++  L  L  ++    WLFY +RIL   D    +DF  +  F+ S+ D  +F HYL++V+LE+RHL+  + + V+RS DGE+R Y MG +SIQ AA+ IL+ Y  DFP++N    S  K   +K        N D   S     T +           +QS  R TV +  +   S+  + +                  Y+E ++E+R++KRR RL+ + E++F  ++R  + ED+     + + ++     EAA  +   +A+  QKYLR  R Q       I  HL  CL   MS ++FLE+++S  P +   +E      WT+  + S+  GL +   F+LK    SL   V  +P   LSE+ +D +S KF++   SETSV
Sbjct:  124 AVGLCVGLLVLATPLVFLLLPAVM---WPDRLQACGAACEGLFLSISFKLLILMVAIWALFLRPGRACLPRVCVYRAFLTTLTLLLTMSYWLFYGVRILDAQD----EDFYGIAQFAVSLVDSQLFVHYLAVVLLELRHLQPCYSVCVIRSTDGETRHYNMGQLSIQRAALSILEYYYRDFPLHNPSILSAAKHRAAKHLAGLKVYNVDAPGSTAAAQTSNG----------NQS--RATVAAAAKRKDSAHNELY------------------YEEADYERRVRKRRARLVVAVEEAFTHVRRMTK-EDENAPPSDIMDVR-----EAALAVFPSMARSLQKYLRTTRRQHCHSMESIQKHLAFCLVNNMSPKAFLEAYLSPGPTLQYGSERWMADQWTLVSEASVTSGLKDGAEFLLKCLDFSLAVVVKGIPYIRLSEEYVDPKSHKFILLLQSETSV 540          
BLAST of Vang-2 vs. Ensembl Medaka
Match: vangl1 (vang-like protein 1 [Source:NCBI gene;Acc:101170632])

HSP 1 Score: 186.422 bits (472), Expect = 5.144e-51
Identity = 145/460 (31.52%), Postives = 230/460 (50.00%), Query Frame = 3
Query:  624 VITICLGVMSFASPIMMIILPNIKIFGWSGIV--CSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKD------SNTDLCSSKNKKDTHDSLNEPKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
             + +C+G++  A+P++ ++LP +    W   +  C   CE   + I  KL IL +A   LF R      PRV V++  L  L  ++    WLFY +RIL   D    +DF  +  F+ S+ D  +F HYL++V+LE+RHL+  + + V+RS DGE+R Y MG +SIQ AA+ IL+ Y  DFP++N    S  K   +K        N D   S     T +           +QS  R TV +  +   S+  + +                  Y+E ++E+R++KRR RL+ + E++F  ++R  + ED+     + + ++     EAA  +   +A+  QKYLR  R Q       I  HL  CL   MS ++FLE+++S  P +   +E      WT+  + S+  GL +   F+LK    SL   V  +P   LSE+ +D +S KF++   SETSV
Sbjct:  124 AVGLCVGLLVLATPLVFLLLPAVM---WPDRLQACGAACEGLFLSISFKLLILMVAIWALFLRPGRACLPRVCVYRAFLTTLTLLLTMSYWLFYGVRILDAQD----EDFYGIAQFAVSLVDSQLFVHYLAVVLLELRHLQPCYSVCVIRSTDGETRHYNMGQLSIQRAALSILEYYYRDFPLHNPSILSAAKHRAAKHLAGLKVYNVDAPGSTAAAQTSNG----------NQS--RATVAAAAKRKDSAHNELY------------------YEEADYERRVRKRRARLVVAVEEAFTHVRRMTK-EDENAPPSDIMDVR-----EAALAVFPSMARSLQKYLRTTRRQHCHSMESIQKHLAFCLVNNMSPKAFLEAYLSPGPTLQYGSERWMADQWTLVSEASVTSGLKDGAEFLLKCLDFSLAVVVKGIPYIRLSEEYVDPKSHKFILLLQSETSV 540          
BLAST of Vang-2 vs. Ensembl Medaka
Match: VANGL2 (VANGL planar cell polarity protein 2 [Source:NCBI gene;Acc:101163605])

HSP 1 Score: 131.724 bits (330), Expect = 4.631e-32
Identity = 84/233 (36.05%), Postives = 130/233 (55.79%), Query Frame = 3
Query:  582 NDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSG--IVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNE 1274
             D  P  C   +  V+  CL   +  +P+  +ILP +    W     VC T CE   V +  KL +L I+S  LF R      PR  VF+ +L++L+F+ +   WLFY +R+L        +D+  +V ++ S+ D L+F  YL+LV+LE+RHL+  FC+KVVR+ DG S+FY +G++SIQ AA+ +L  Y  DFP+YN    +  KS +SK        S ++  T++S  +
Sbjct:   97 EDSTPLQCKRFIGPVLGGCLSFFALITPLAFLILPQVL---WRDDLEVCGTPCEGLYVSLAFKLLVLLISSWALFLRPPRATLPRFFVFRCLLMVLVFLFVASYWLFYGVRVL----EPRERDYRGIVEYAASLVDALLFIQYLALVLLEVRHLQPAFCLKVVRTADGASKFYNVGHLSIQRAAVWVLDRYYSDFPVYNPALLNLPKSILSKKITGFKVYSLDENTTNNSTGQ 322          

HSP 2 Score: 89.7373 bits (221), Expect = 2.075e-18
Identity = 55/171 (32.16%), Postives = 89/171 (52.05%), Query Frame = 3
Query: 1473 MASTEDSFNRLKRF--DEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFIS-TPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            + + E++F  +KR   DE        + ++  +     EAAQ I A +A+  QKYLR  R Q       I +HL  C+ + M+ ++FLE +++  P +    +N  G+ WT+  +  +   L   L F L+R   SL+ TV  +P   L E+ ID +S KF+++  SETSV
Sbjct:  360 VVAVEEAFTHIKRLHKDEATSSPKHPREEMDPR-----EAAQAIFAPMARAMQKYLRTTRQQAFHSMESIISHLQFCITHNMTPKAFLERYLTPGPTMQYQQQNGGGRQWTLVSEEPVTSALRQGLVFSLRRLDFSLVVTVTPLPFLRLGEEFIDPKSHKFVMRLQSETSV 525          
BLAST of Vang-2 vs. Planmine SMEST
Match: SMESG000053210.1 (SMESG000053210.1)

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 393/396 (99.24%), Postives = 396/396 (100.00%), Query Frame = 3
Query:   93 MNYSTNNNTQLSYVNSPTKLKEIPAALFPIMSTGFNTYMSYPSPENMTNYTNSILLPQCSPPPIPKFNVDVTKPLSLSSFDKLEESDSNQETKDGNIIFNSSVSQMKTDFLDSTSGREDWTEDMGMEMMHDNDRTNQSTHLFSQTINTDXXXXXXXXXXXXYENDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPK 1280
            MNYSTNNNTQLSYVNSPTKLKEIPAALFPIMSTGFNTYMSYPSPENMTNYTNSILLPQCSPPPIPKFNVDVTKPLSLSSFDKLEESDSNQETKDGNIIFNSSVSQMKTDFLDSTSGREDWTEDMGMEMMHDNDRTNQSTHLFSQT+NTDKSSKVSNCSSVNYENDK+PFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRVLVFKLVLIMLLFIIIFGLWLFYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSIS+DSNTDLCSSKNKKDTHDSLNEPK
Sbjct:    1 MNYSTNNNTQLSYVNSPTKLKEIPAALFPIMSTGFNTYMSYPSPENMTNYTNSILLPQCSPPPIPKFNVDVTKPLSLSSFDKLEESDSNQETKDGNIIFNSSVSQMKTDFLDSTSGREDWTEDMGMEMMHDNDRTNQSTHLFSQTLNTDKSSKVSNCSSVNYENDKFPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRVLVFKLVLIMLLFIIIFGLWLFYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISRDSNTDLCSSKNKKDTHDSLNEPK 396          
BLAST of Vang-2 vs. Planmine SMEST
Match: SMESG000029281.1 (SMESG000029281.1)

HSP 1 Score: 223.016 bits (567), Expect = 1.624e-63
Identity = 165/481 (34.30%), Postives = 263/481 (54.68%), Query Frame = 3
Query:  597 FDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNE-PKNRERDSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEI-GSISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETA--------ENINGQ------IWTIYCKVSLCKGLTNKLTFMLKR-----ESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            FDC+  +   I I L ++S ASPI M++LPNIK+  W    C+  CE  L+ +  KL IL + +  LF RRK ++  RV +F+  ++ + F+I+F  WLFY +RIL    ++  KDF  +V FS S+ D L+F HYL+LV+LE+  ++  + IKV RSPDG SRFY++G +SIQ+AAI +LQ YVIDFP YN Y    C   + +       + +N    H++ N+ P  + +     +         +  ++  +       Q  I G      +LY+E E EK+ +KR++RL+ + E++F+ +  ++  ++ R  N+    ++ +  +EAA+ IL  + KP QK LR++R  + +    +  H+ +CL Y +S +  ++ F  +  V+++         E +N Q       W + C   L K L N +TF LK      E + LMCTVH VP FSL E   +  + +F +  NSETSV
Sbjct:  175 FDCIRIIGNSIFIILCIISIASPIAMLVLPNIKLMEWEITNCNPACEGQLISLVSKLIILIVGTWALFFRRKQHSVTRVSLFRAFILFIAFVIVFAYWLFYSVRIL----DKKFKDFYGIVLFSVSLVDTLLFVHYLALVMLEVYQMQMFYYIKVTRSPDGISRFYRVGRLSIQSAAIHVLQNYVIDFPEYN-YDLVQC---LKRKCYKRYQARQNHGSNHNTPNDTPDKKTKYKVYNIDNEGNPGENNDNNNNNNSGNLISNQNTIKGGTGTSARLYEESEWEKKFRKRQMRLLVAVEEAFSHVHVYEGSDEVRVGNQ----MRNMGVLEAAETILPAIMKPLQKLLRVSRRHLSYSSGIVVTHIAQCLSYRLSPKYLVQQFSPSVTVMDSLILSNAKPNEKLNNQPKDLHLSWILICNKLLSKALDNDITFQLKPRDCHVEDLCLMCTVHKVPFFSLEEKMFNESNCRFTLHTNSETSV 643          
BLAST of Vang-2 vs. Planmine SMEST
Match: SMESG000046194.1 (SMESG000046194.1)

HSP 1 Score: 187.963 bits (476), Expect = 7.290e-51
Identity = 166/571 (29.07%), Postives = 267/571 (46.76%), Query Frame = 3
Query:  576 YENDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNIKIFGWSGIVCSTTCESYLVFICCKLCILCIAS--------LVLFCRRKT-----------------------------------YAFPRXXXXXXXXXXXXXXXXXXXXXXYVLRILLIIDNRTSKDFDNVVSFSNSVTDILMFTHYLSLVVLEIRHLETK-FCIKVVRSPDGESRFYQMGNISIQAAAIKILQVYVIDFPMYNVY--------ARSTCKSSISKDSNTDLCSS----------KNKKDTHDSLNEPKNRERDSQSPV-------RRTVKSP------------RQSPRSSKGDKFPRS--VTQYEIG-------------SISLREKLYKEIEHEXXXXXXXXXXMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQNILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFISTPKVLETAE-----NINGQI---WTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHHVPMFSLSEDTIDHESQKFLIKFNSETSV 1976
            +++  + FDC     T I ICL +++F SP  M+ LP  ++  W  I C+  CES L+ +  KL ++  A+        L  FCR+K+                                      PR+   +  L+ L+FII    WLFY +R+L   +N   + + + V  ++ +TD L+  HYL LV++ +R +  +   +KV+R PDGE++ Y+    S+Q AAIKIL+ Y++DF +YN +        A S    S    S T   SS          +        L + K  + D  +P+       +R++ SP            + +   S G +  RS  + +   G             + S  ++ Y+E+E+EKR+ KRR+RLM ++ED+F  L R+DE        +N+ + K L   EAAQ I + L KP QK+LR  R Q +F    +  HL  CL Y +  ++FLE F+S   VLE         I+ ++   W +Y    + + + +   F L +  +SL CTV  +P F+L+E+    +  KF+ K +SETSV
Sbjct:   94 FDHISHRFDCALTTGTGIAICLSLIAFFSPAAMVTLPVTRLIEWPNIKCNVDCESQLISLTIKLILIGAAAYLTFLRNHLCTFCRKKSSYDPLSGLAISQSGTPSNIGIEAGIHYRHHRNYSHTTLPRLTFLRSFLLFLIFIITIVFWLFYGIRML---ENSNQRQYSSSVMLASRMTDCLLLVHYLGLVIIFLREMNNETLAVKVLRCPDGETKIYKFKKTSVQLAAIKILKNYLVDFKVYNPFIEAPPRRRAGSRGGQSSRVSSQTGGVSSLPPGNGIGPYQPPPGALGGLAKYKFYDVDGPAPMSNLAPLSKRSLGSPSSLTKCTSHIRRKTASLKSAGTRSQRSCPIMKSTTGRNSNQHNRKANSHTNSNNDRYYEEVEYEKRVAKRRVRLMLASEDAFRNLFRYDEN------CRNNSNAKLLGAYEAAQAIFSTLLKPLQKFLRTTRQQPRFSMEWVIGHLRNCLNYDLGYRAFLEPFLSQGPVLEDPGYQQQLYIDDEVVTSWILYSDRLVSRNIGDGTVFHLCQGDISLFCTVKSLPNFNLTEEIFPEKCNKFIFKLDSETSV 655          
The following BLAST results are available for this feature:
BLAST of Vang-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VANGL16.249e-5432.62VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL16.974e-5432.62VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL16.974e-5432.62VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL16.974e-5432.62VANGL planar cell polarity protein 1 [Source:HGNC ... [more]
VANGL22.813e-2939.15VANGL planar cell polarity protein 2 [Source:HGNC ... [more]
back to top
BLAST of Vang-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vang-19.549e-4229.26Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
vang-11.099e-4129.26Vang-like protein [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
back to top
BLAST of Vang-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vang3.953e-5231.07gene:FBgn0015838 transcript:FBtr0088566[more]
Vang5.946e-5231.07gene:FBgn0015838 transcript:FBtr0330624[more]
back to top
BLAST of Vang-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vangl24.772e-5132.86VANGL planar cell polarity protein 2 [Source:NCBI ... [more]
vangl11.981e-4331.38VANGL planar cell polarity protein 1 [Source:ZFIN;... [more]
back to top
BLAST of Vang-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
krt12.21.237e-3441.23keratin 12, gene 2 [Source:Xenbase;Acc:XB-GENE-649... [more]
back to top
BLAST of Vang-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vangl16.108e-5332.62VANGL planar cell polarity 1 [Source:MGI Symbol;Ac... [more]
Vangl11.082e-3139.90VANGL planar cell polarity 1 [Source:MGI Symbol;Ac... [more]
Vangl18.386e-3139.90VANGL planar cell polarity 1 [Source:MGI Symbol;Ac... [more]
Vangl22.497e-2939.15VANGL planar cell polarity 2 [Source:MGI Symbol;Ac... [more]
Vangl22.497e-2939.15VANGL planar cell polarity 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Vang-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TAA9|VANG1_HUMAN3.349e-5332.62Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VAN... [more]
sp|Q80Z96|VANG1_MOUSE4.272e-5232.62Vang-like protein 1 OS=Mus musculus OX=10090 GN=Va... [more]
sp|Q8UVJ6|VANG2_DANRE3.602e-5032.86Vang-like protein 2 OS=Danio rerio OX=7955 GN=vang... [more]
sp|Q90Z05|VNG2B_XENLA2.840e-3441.71Vang-like protein 2-B OS=Xenopus laevis OX=8355 GN... [more]
sp|Q90X64|VNG2A_XENLA4.459e-3441.71Vang-like protein 2-A OS=Xenopus laevis OX=8355 GN... [more]
back to top
BLAST of Vang-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F2WMR30.000e+099.52Vang-2 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A0L8FGX66.384e-6632.98Vang-like protein OS=Octopus bimaculoides OX=37653... [more]
A0A0F6N0Q33.152e-6433.06Vang-like protein OS=Terebratalia transversa OX=34... [more]
B7PN714.742e-6432.90Vang-like protein OS=Ixodes scapularis OX=6945 GN=... [more]
A0A267F6F31.180e-6332.99Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Vang-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
vangl24.389e-5334.05VANGL planar cell polarity protein 2 [Source:NCBI ... [more]
VANGL11.310e-4831.33VANGL planar cell polarity protein 1 [Source:NCBI ... [more]
vangl14.599e-4531.85vang-like protein 1 [Source:NCBI gene;Acc:10303657... [more]
vangl11.472e-4431.59vang-like protein 1 [Source:NCBI gene;Acc:10303657... [more]
back to top
BLAST of Vang-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010728.11.019e-1931.74pep scaffold:Pmarinus_7.0:GL486594:2920:5521:1 gen... [more]
back to top
BLAST of Vang-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vang-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO383573.959e-5731.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270765.543e-2638.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vang-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VANGL19.773e-5331.13VANGL planar cell polarity protein 1 [Source:NCBI ... [more]
VANGL16.174e-5231.13VANGL planar cell polarity protein 1 [Source:NCBI ... [more]
vangl15.144e-5131.52vang-like protein 1 [Source:NCBI gene;Acc:10117063... [more]
vangl15.144e-5131.52vang-like protein 1 [Source:NCBI gene;Acc:10117063... [more]
VANGL24.631e-3236.05VANGL planar cell polarity protein 2 [Source:NCBI ... [more]
back to top
BLAST of Vang-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000053210.10.000e+099.24SMESG000053210.1[more]
SMESG000029281.11.624e-6334.30SMESG000029281.1[more]
SMESG000046194.17.290e-5129.07SMESG000046194.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000196
GenBankADZ58510.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000196 ID=SMED30000196|Name=Vang-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2046bp
GTATTTTTTATGAATGAAAATTATTTTATGAAAGTTATTTGAATTGTTAA
GTAGAAATCATCAAAAAATTTAACTAATAATTACACAGTCAAATGAATTA
TAGCACAAATAATAATACTCAACTGTCATACGTTAATTCACCGACTAAAC
TCAAAGAAATTCCAGCTGCTTTATTTCCAATTATGTCAACTGGATTTAAT
ACTTATATGTCTTATCCAAGTCCAGAAAATATGACAAATTATACAAATTC
AATTCTTTTGCCTCAGTGTTCTCCTCCACCAATTCCAAAATTCAATGTCG
ATGTCACAAAGCCCTTATCACTGAGTTCCTTTGATAAACTCGAAGAATCT
GACTCCAATCAGGAAACAAAGGACGGGAATATAATTTTCAATTCTAGCGT
ATCTCAAATGAAAACAGATTTTCTTGACAGTACTTCGGGTCGAGAAGATT
GGACGGAAGATATGGGAATGGAGATGATGCATGATAATGACAGAACCAAC
CAATCGACTCATCTGTTTTCACAAACAATAAATACTGACAAAAGTTCAAA
AGTGTCCAACTGCTCGTCTGTGAATTATGAAAACGATAAATATCCGTTTG
ATTGTGTTGGCAATATGGATACGGTTATTACAATTTGCTTGGGTGTCATG
TCGTTTGCCAGTCCAATCATGATGATAATCCTTCCCAACATCAAGATTTT
TGGCTGGTCGGGAATCGTCTGTTCGACAACTTGCGAATCATATCTCGTGT
TTATTTGTTGTAAACTCTGCATACTCTGTATTGCGTCTCTCGTTCTCTTC
TGCCGCCGGAAAACCTACGCGTTCCCGAGAGTTTTAGTTTTTAAACTTGT
TTTAATCATGCTGCTTTTTATAATCATTTTCGGTCTCTGGCTATTTTACG
TCTTAAGGATTTTGTTGATAATTGACAACAGGACAAGTAAAGATTTCGAT
AATGTCGTCTCGTTTTCTAATAGTGTCACGGATATTCTCATGTTTACTCA
TTATTTATCCCTTGTCGTTCTTGAAATCCGACATTTGGAAACTAAGTTTT
GCATCAAGGTTGTCAGATCTCCAGATGGTGAAAGTCGATTCTATCAGATG
GGAAATATTTCTATTCAAGCAGCAGCAATCAAAATTCTCCAAGTTTACGT
GATAGATTTTCCAATGTACAACGTTTACGCTCGTTCGACTTGCAAGTCTT
CGATTTCCAAGGACAGCAATACAGATTTATGTTCATCGAAAAATAAGAAG
GATACTCATGACAGTCTAAATGAGCCAAAAAATCGAGAAAGGGATAGTCA
GTCACCTGTCAGGCGAACTGTGAAATCTCCACGGCAATCTCCTCGGTCGA
GCAAAGGGGACAAATTTCCTAGATCTGTTACACAATACGAAATCGGATCG
ATCAGTTTGCGTGAAAAATTATATAAAGAAATTGAACATGAAAAGCGACT
AAAAAAACGTCGACTTCGTTTAATGGCTTCAACTGAAGACTCGTTTAATA
GACTCAAACGGTTTGATGAATTTGAAGATCAAAGAACCTGGAATAAAAAT
GATATTTCTATTAAATTTCTAACGAATGTTGAAGCCGCTCAAAACATCCT
AGCACAACTTGCGAAACCTTTTCAAAAATATCTAAGATTAGCTCGATTAC
AAATTCAATTTCCAAAGTCGAGAATCCACAACCACTTGGTCAAATGTCTC
CAATATGGAATGTCTGCCCAATCATTTCTTGAGAGTTTCATTTCAACTCC
CAAGGTTTTAGAGACTGCTGAAAACATAAACGGGCAAATTTGGACTATCT
ATTGCAAAGTGTCCCTTTGCAAAGGCCTGACAAATAAGCTGACATTTATG
CTGAAACGGGAGAGTGTATCATTGATGTGCACCGTTCACCATGTGCCGAT
GTTTTCACTGAGTGAGGACACCATAGATCATGAATCTCAAAAGTTTCTCA
TTAAATTCAATTCAGAAACATCTGTTTGAATGAACTCTTTTTTTGCAAGT
GTAAATAGTTTTTATTTCGTTTTCAGATTTTTATGGTTTAGTTGTT
back to top

protein sequence of SMED30000196-orf-1

>SMED30000196-orf-1 ID=SMED30000196-orf-1|Name=SMED30000196-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=629bp
MNYSTNNNTQLSYVNSPTKLKEIPAALFPIMSTGFNTYMSYPSPENMTNY
TNSILLPQCSPPPIPKFNVDVTKPLSLSSFDKLEESDSNQETKDGNIIFN
SSVSQMKTDFLDSTSGREDWTEDMGMEMMHDNDRTNQSTHLFSQTINTDK
SSKVSNCSSVNYENDKYPFDCVGNMDTVITICLGVMSFASPIMMIILPNI
KIFGWSGIVCSTTCESYLVFICCKLCILCIASLVLFCRRKTYAFPRVLVF
KLVLIMLLFIIIFGLWLFYVLRILLIIDNRTSKDFDNVVSFSNSVTDILM
FTHYLSLVVLEIRHLETKFCIKVVRSPDGESRFYQMGNISIQAAAIKILQ
VYVIDFPMYNVYARSTCKSSISKDSNTDLCSSKNKKDTHDSLNEPKNRER
DSQSPVRRTVKSPRQSPRSSKGDKFPRSVTQYEIGSISLREKLYKEIEHE
KRLKKRRLRLMASTEDSFNRLKRFDEFEDQRTWNKNDISIKFLTNVEAAQ
NILAQLAKPFQKYLRLARLQIQFPKSRIHNHLVKCLQYGMSAQSFLESFI
STPKVLETAENINGQIWTIYCKVSLCKGLTNKLTFMLKRESVSLMCTVHH
VPMFSLSEDTIDHESQKFLIKFNSETSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000136whole organism
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR009539VANGL
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane