Transposon Ty3-I Gag-Pol polyprotein

Overview
NameTransposon Ty3-I Gag-Pol polyprotein
Smed IDSMED30000193
Length (bp)4534
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30000193) t-SNE clustered cells

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30000193) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30000193) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30000193) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000193

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000193 Contig2157GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neuronSMED30000193SMESG000037107.1 dd_Smed_v4_6031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000193SMESG000037107.1 dd_Smed_v4_6031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30000193SMESG000016220.1 SMESG000016219.1 Contig41799newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000193SMESG000016220.1 SMESG000016219.1 Contig41799uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30000193 Contig2157GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
early male germ cellSMED30000193SMESG000016220.1 Contig3340_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30000193SMESG000016220.1 Contig3340_WUSTLGPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A0K8TGD4 (Uncharacterized protein (Fragment) OS=Lygus hesperus OX=30085 PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.600e-12
Identity = 38/91 (41.76%), Postives = 52/91 (57.14%), Query Frame = 3
Query: 3930 SDSKNRPSTTVNVQLRIIKDGQPISQKFCKLFGERLQPTKMEFIRLLEDNIRQASNNSWE*PLVVVK*RDGSWRPCCDYRLLNSITIPDKY 4202
            S ++  P  T NV   I   G P   +  +L  ++LQ  K EF  ++E  I Q S + W  PL +VK ++G WRPC DYR LNS T+PD+Y
Sbjct:    2 SSARKTPLKTPNVHHHITTRGSPCFARPRQLPPDKLQAAKAEFSFMMEQGICQPSKSPWSSPLHLVKKKNGDWRPCGDYRKLNSQTVPDRY 92          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4C1SF59 (Retrovirus-related Pol polyprotein from transposon opus OS=Eumeta variegata OX=151549 GN=pol PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.192e-11
Identity = 53/138 (38.41%), Postives = 73/138 (52.90%), Query Frame = 3
Query: 3822 QTKLISNSSAL--EFDQRYGKNSEINNIP--TEKYDPISSSDSKNRPSTTV-----NVQLRIIKDGQPISQKFCKLFGERLQPTKMEFIRLLEDNIRQASNNSWE*PLVVVK*RDGSWRPCCDYRLLNSITIPDKYLL 4208
            + KLI N + L   F  +     EI  +   T  ++ I    +   PSTT      NVQ  I   G P++ K  +L  E+L+  K EF  +LE  I   S ++W  PL +VK ++G WRPC DYR LN+ITIPD+Y L
Sbjct:   69 EKKLIDNKTGLNSSFFVKKAYPLEIKTVSNSTPYHELIVQFPNITNPSTTAAKQKHNVQHFIETKGLPVTSKARRLSPEQLESAKCEFKYMLEQGICFPSKSNWSSPLHMVKKKNGQWRPCGDYRRLNAITIPDRYPL 206          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4Y2FGU5 (Uncharacterized protein (Fragment) OS=Araneus ventricosus OX=182803 GN=AVEN_22242_1 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.458e-11
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query: 3975 RIIKDGQPISQKFCKLFGERLQPTKMEFIRLLEDNIRQASNNSWE*PLVVVK*RDGSWRPCCDYRLLNSITIPDKY 4202
             +I+ G P+  K  +L  ++L   K EF  L+   I   S + W  PLV+VK  DGSWRPC DYR LN+ TIPDKY
Sbjct:   84 HVIQKGPPVGAKARRLAPDKLIAAKQEFQNLIHKGICSPSTSCWASPLVMVKKSDGSWRPCGDYRALNAQTIPDKY 159          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A0A9XRU0 (Transposon Ty3-I Gag-Pol polyprotein (Fragment) OS=Lygus hesperus OX=30085 GN=TY3B-I_58 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.622e-11
Identity = 38/93 (40.86%), Postives = 54/93 (58.06%), Query Frame = 3
Query: 3924 SSSDSKNRPSTTVNVQLRIIKDGQPISQKFCKLFGERLQPTKMEFIRLLEDNIRQASNNSWE*PLVVVK*RDGSWRPCCDYRLLNSITIPDKY 4202
            ++S ++  P  T NV   I   G P   +  +L  ++LQ  K EF  ++E  I Q S + W  PL +VK ++G WRPC DYR LNS T+PD+Y
Sbjct:   37 ANSSARKTPLKTPNVHHHITTRGSPCFARPRQLPPDKLQAAKAEFSFMMEQGICQPSKSPWSSPLHLVKKKNGDWRPCGDYRKLNSQTVPDRY 129          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A4Y2FIR9 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_233297_1 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.979e-11
Identity = 36/76 (47.37%), Postives = 46/76 (60.53%), Query Frame = 3
Query: 3975 RIIKDGQPISQKFCKLFGERLQPTKMEFIRLLEDNIRQASNNSWE*PLVVVK*RDGSWRPCCDYRLLNSITIPDKY 4202
             +I+ G P+  K  +L  ++L   K EF  L+   I   S + W  PLV+VK  DGSWRPC DYR LN+ TIPDKY
Sbjct:  125 HVIQKGPPVGAKARRLAPDKLIAAKQEFQNLIHKGICSPSTSCWASPLVMVKKSDGSWRPCGDYRALNAQTIPDKY 200          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000045141.1 (pep primary_assembly:ASM223467v1:23:22495254:22500491:-1 gene:ENSORLG00000029628.1 transcript:ENSORLT00000045141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 5.992e-6
Identity = 28/74 (37.84%), Postives = 38/74 (51.35%), Query Frame = 3
Query: 3987 DGQPISQKFCKLFGERLQPTKMEFIRLLEDNIRQASNNSWE*PLVVVK*RDGSWRPCCDYRLLNSITIPDKYLL 4208
            D  PI Q+  ++  +  Q  K     L+   I + S + W  P V+V  +DGS R CCDYR LN +T  D Y L
Sbjct:  716 DAPPIKQRHRRVPPQVFQEFKKHVHELVSQGILKESTSPWASPAVIVIKKDGSVRFCCDYRRLNQVTCKDAYPL 789          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000016220.1 (SMESG000016220.1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.015e-127
Identity = 202/202 (100.00%), Postives = 202/202 (100.00%), Query Frame = 1
Query: 2680 MRIPDHIFSHAINSDCSASSAFNNVKYLQKFDNYRHTKSDYEILKICQGDNISYANKVPTAETFGKENGRMXXXXXXXXXXXVEPNTSSTVSDLAGGSFLSKNSMDASTDTEQLLPIFVSEKASNFDSGMLLDTLKNQQCCSYQCFTKLKFIEKTLKKVEQRQKTIKSQLNFSVAFGATGILLKFLLIYFDRFYPKSGIWFD 3285
            MRIPDHIFSHAINSDCSASSAFNNVKYLQKFDNYRHTKSDYEILKICQGDNISYANKVPTAETFGKENGRMKKKAKSSKLGKVEPNTSSTVSDLAGGSFLSKNSMDASTDTEQLLPIFVSEKASNFDSGMLLDTLKNQQCCSYQCFTKLKFIEKTLKKVEQRQKTIKSQLNFSVAFGATGILLKFLLIYFDRFYPKSGIWFD
Sbjct:    1 MRIPDHIFSHAINSDCSASSAFNNVKYLQKFDNYRHTKSDYEILKICQGDNISYANKVPTAETFGKENGRMKKKAKSSKLGKVEPNTSSTVSDLAGGSFLSKNSMDASTDTEQLLPIFVSEKASNFDSGMLLDTLKNQQCCSYQCFTKLKFIEKTLKKVEQRQKTIKSQLNFSVAFGATGILLKFLLIYFDRFYPKSGIWFD 202          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000079891.1 (SMESG000079891.1)

HSP 1 Score: 65.855 bits (159), Expect = 2.650e-11
Identity = 43/102 (42.16%), Postives = 62/102 (60.78%), Query Frame = 3
Query: 3819 LQTKLISNSSALEFDQRYGK--NSEINNIPTEKYDPISSSDSKNRPSTTVNVQLRIIKDGQPISQKFCKLFGERLQPTKMEFIRLLEDNIRQASNNSWE*PL 4118
             +T+ ISN    EF Q + K  N  +++I  E YD I  +  ++  ++  +VQL+I+ + + ISQ   KLFGERL  TK EF RLL++ I Q +NNSW  PL
Sbjct:  117 FKTRQISNIKTSEFAQGHSKASNLTVHSIFFE-YDDIIFNSQESHINSKPDVQLKIVTEWEEISQNSRKLFGERLTATKAEFDRLLKEIIIQTNNNSWASPL 217          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000074961.1 (SMESG000074961.1)

HSP 1 Score: 66.2402 bits (160), Expect = 3.121e-11
Identity = 34/75 (45.33%), Postives = 44/75 (58.67%), Query Frame = 3
Query: 3978 IIKDGQPISQKFCKLFGERLQPTKMEFIRLLEDNIRQASNNSWE*PLVVVK*RDGSWRPCCDYRLLNSITIPDKY 4202
            II +G P   K  +L   +L  TK  F  LLE+ I Q SN+ W   L+  +  +  WR C DYR+LN+ITIPDKY
Sbjct:  191 IITNGNPFHAKVRQLDNSKLNITKQIFNDLLENKIMQHSNSKWSSALMFKEKPNNEWRACGDYRILNNITIPDKY 265          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000011773.1 (SMESG000011773.1)

HSP 1 Score: 50.8322 bits (120), Expect = 6.664e-6
Identity = 26/69 (37.68%), Postives = 41/69 (59.42%), Query Frame = 3
Query: 3996 PISQKFCKLFGERLQPTKMEFIRLLEDNIRQASNNSWE*PLVVVK*RDGSWRPCCDYRLLNSITIPDKY 4202
            PI     +L  +R    + EF++L + +I + S++ W  P+ ++  +DGS R C DYR +N ITIPD Y
Sbjct:  222 PIRHHQRELAQDRSIAAEKEFLQLEKQDIIRRSSSPWAAPIQIITKKDGSLRICGDYRSVNKITIPDSY 290          
The following BLAST results are available for this feature:
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K8TGD43.600e-1241.76Uncharacterized protein (Fragment) OS=Lygus hesper... [more]
A0A4C1SF591.192e-1138.41Retrovirus-related Pol polyprotein from transposon... [more]
A0A4Y2FGU51.458e-1147.37Uncharacterized protein (Fragment) OS=Araneus vent... [more]
A0A0A9XRU02.622e-1140.86Transposon Ty3-I Gag-Pol polyprotein (Fragment) OS... [more]
A0A4Y2FIR92.979e-1147.37Uncharacterized protein OS=Araneus ventricosus OX=... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000045141.15.992e-637.84pep primary_assembly:ASM223467v1:23:22495254:22500... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000016220.11.015e-127100.00SMESG000016220.1[more]
SMESG000079891.12.650e-1142.16SMESG000079891.1[more]
SMESG000074961.13.121e-1145.33SMESG000074961.1[more]
SMESG000011773.16.664e-637.68SMESG000011773.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000193 ID=SMED30000193|Name=Transposon Ty3-I Gag-Pol polyprotein|organism=Schmidtea mediterranea sexual|type=transcript|length=4534bp
GTATTAGCAGCAGGCATTTATTTTCCGATGGAGGTGATGTTGTGAATCCT
TATCCAGGTGTGGACGGGTGTGAGAGCACGCGCATCCTGGCACGTTGCAA
CTGATGGAGTGTGATTATGATTGTATATGCGATCCTATCCGATCCTATCT
GATCCGATCCGATCCGATCCGATCATATCCGATGTATAAATTGCCAAATG
TGTTGAGTGCAAATATGTACAAGATGATCTGTGCTGGGAGAATTCCCCAG
TAATTATGTGTATAATAATCCCCTAGAGTATTCTTTCTATTTGTTTGTTT
AATTTTTTATTTATTTTGTCAGAAAATATTTATTTTTCCATGCGTCGTCT
AGTGTTGTTGTAATAATCACATATATATACATATACAATATTTTATTGCT
GGTTTTGTATGATGCTGCCGTCACCGCCGCCGCCGCCGCCGCCGCCATCG
GCTGCTTCTGTGTGTAAATATTTTGTAACAATACTATTTAATGGCATCGA
GAGGCCTGCTTGCTCCCCTCAGCAGGTTTCCTTCTATTATATCACTAACC
AACCAGCTGGCCTCTGTTTATCAGAGATTTGATGCGGACCATTGCTATGT
AGAATTTCTTTTATTTGATATATTTTCTCTTTGATCAAGGAGATTCGTGT
GTTACAGATTTCATTTCATTGATTATTATTATTATTTATTATTATTATTT
ATTATTATGATTTGTTATTATTTGTTTTTATTATTTTATATTTATTTAAT
TAATAATTATAATTTCAATATAATCATTATTATTATTTATTACATGATGT
GCTGATGGTGGTGTTGGTGGCGTGAGTATTTTCGGTATTTGTAATCGGTT
GGTAACTTTTGTATTATTTTGATCCCGTTGTAAATGATTCCATTCTGCTA
TTCAGTTACTGTAGAATCCTATCCCATTTATTATTCATTTGATGGGATCC
CATTTTCGGTTGTATTCGTGCTATATCAGAGTTGTATTGCTAAAATAATC
TGTTCGATTTGATGTTCTGTCATCCTCTATTTGCTGTCGCTGCCGCCGGG
CGCGATTGTAACTGACGGAATCAACGAGCGAGTTTATAGCGATGTTATGC
GAATGCGATAATGATACTTTACATTTCACCCATTAAGGGGAGTCATGATT
TTGTTATTTCGATTGTCGTAGATTTCTGTTCTAATTATTTTTAATTTTTG
GATCAATTATAGTGTTTTAGTTTTTCATGTTGATTTGATCCTGGACTGTG
AATTGCTATTTGTAAATGTTGATTTGGATTATCAGTTGCGACATTGCGTT
GCACTAGATGATGGGAGAATTATCGTAACCAGATCGAGTAATGTATTTCA
ATCCTTTATATTTTGCAACGCGTTACGTGAGAGTTTATCGGGTACCCCTA
AATTAATGAAAACAAAAAGTAGTTTCAACAGAACTTGTAATTATACTGCG
TAACAAAGCGATCGGTGATTTGCAACGTGATCAAGGGCAGAATTACATTT
ATTTGCCACTTCATTTCAATGACACCACTCCGAATAATGCACGACGATAT
TTATACAACTTCCAAATATCTTCAACAATCTACTGGAAGTTCGCAAACCT
TTAATGTTTTGTGGTCTAAGCTATTGTCAATCGCCTTCCAACTTTATATA
CTTCTCAAAAAACATATACGTATACATTTATGCACGCATCTCGCTACTCT
GCACTTATAAACTTCCTAAATGAAAAGGTGGACATCGTGAGTGGCTGTTA
TAGACTAATAACATTTATCTGCATAAGTTCAATAGATACTGAGAGGCCTT
TACCAAGTTTCTGATATCTTTTACCGTACAGGATATCTAAGTATAACATT
TGAAAGAAGACCTAGTAAACTGAACTACTATTCTAAATCAAAGAGATGAA
GCAATCAGAAATTTATTCATATTCGTTAAAAGAGCCTCACTTTTGTGAGA
TACTTTTGAGGTACATTTCATGTACCGTATCTGATACACAGATAAGGCAA
GAATGATTTAGAAATTTTTATCTGATGTTCAGCTGACATCACGTCTCTGT
ATCCCTTGAATTCTATGCGTTACGTAGGGAGGTCATTTGGAGAAAACGGA
CTTAGCAATCGCAATGAGTACAGATTCATGGAGATTTATACCCCCATATT
ACCCAAACTCGGAAAAACGAAAGCATGTTAAATTGTAAATCATTTTAGCG
AGAAAATCAAAGTTATTTATCTTCATCTTGCAACGAATCATCATTCGATA
ATTACTTGTAGAGATTTCTTTGATTTTCCCCTTAACGATGCGTTAGTCAC
ATTAATAACGATTCTAATTATTTCCTAGGAGCTCGTGCTTTCCCCTTCGT
GAATTGCAAAGGATATCCTATGAGCTGCGGATAACAAATTTCCGAAAACA
ATAAATCTTGAAAAATATGAACTCGAATCTCTGAAGATTCTCCAGTTTCA
CCTCGAAGTATCTTCATACAAAACATTTATTTGGTGATAGACGAATACTT
AATGTGTTTGAAAAACTGAAATAATCCGTTGCGACAATTCAAACAATGAA
TAAATGGAAAGTTAATAAAAATAATAAACGACCAACGACAAAAAGAATCA
AAACCGACCGAGTTTCAGCACGATTTTCCCCATCAACAACAACTACGAGC
TGCAGTTCTCCACGACGGTCCACAAGAAAATGCGAATTCCTGACCACATT
TTCAGTCACGCCATCAACAGCGACTGTTCCGCCAGCTCAGCGTTCAACAA
TGTCAAGTACCTTCAGAAGTTCGACAATTACCGGCATACAAAAAGCGATT
ATGAAATCCTGAAAATTTGTCAAGGAGATAACATTAGCTATGCTAACAAA
GTCCCAACGGCGGAAACATTTGGAAAAGAAAATGGTCGAATGAAAAAGAA
AGCCAAGTCATCTAAGCTGGGAAAAGTCGAGCCGAATACTTCAAGCACAG
TGTCAGATTTAGCGGGAGGCAGCTTCCTGAGCAAGAATTCAATGGACGCA
TCAACTGATACTGAGCAGCTGCTGCCGATTTTTGTTTCCGAGAAGGCATC
GAATTTCGACAGCGGCATGCTACTGGACACACTGAAGAATCAGCAGTGCT
GCTCCTATCAATGTTTCACCAAGCTGAAATTCATAGAGAAAACTCTGAAA
AAAGTCGAACAGCGCCAAAAAACAATAAAATCCCAGCTGAATTTTTCAGT
GGCTTTCGGAGCTACTGGAATCCTGTTAAAATTTCTTTTGATTTATTTCG
ATAGATTTTATCCTAAATCTGGAATTTGGTTTGATTAGTTCTTGAGTCGG
CATTTTGTTTGCAGTGATTTCGAGCGTATTCATTTCTAATGTAAGGGCCC
CATTGTCGCACTATATAGAATAACTTGATATAAATATACATTCACTATTC
AATGCTCGTATTTATTGCCCATTGGATCCTGTTGCGATTGCGGGCGCTGT
AATTATTGAATAATACAAATATCTCCGGTGTTGGACTTCTTGGGATCAAA
ATGGAGTCGCTAGGGACATTCCAGGCTCTCTGACCTTTATTGCCGCAAAA
CAATTTCTACAGCTCAATTTATATCCAAAGTTATTTGGACAACAACATTA
TTGCAGACTTGGTGCAGATGCGAGTTTTTTGAAGCTGATAAGTTCCTGGG
AGGAAACCGGACACTAGGCAGCCCAAATAATTCAATTATAAATTACTATG
AAGGACAAGGAAATCAAACTTGAAATTGAAGGTTTTCGATTGCCTTTTAA
ATGGATATTTGCCGTTGCAAATACTATTATCGGTGCGGATTTCTCGTCTC
GCTCAACCTATCAGTCAACTGCAAACAAAGCTCATTTCAAATTCCTCGGC
GTTGGAATTTGACCAAAGGTATGGCAAAAACTCCGAAATTAATAATATTC
CCACAGAAAAATATGACCCAATATCCAGCTCTGATTCAAAGAATAGACCT
TCAACAACTGTCAATGTTCAACTCAGAATTATTAAAGATGGACAACCAAT
CTCTCAAAAATTCTGCAAACTATTCGGAGAACGGCTGCAGCCAACTAAGA
TGGAGTTTATCAGATTACTGGAAGATAACATCAGGCAAGCAAGCAACAAC
AGTTGGGAATAACCACTGGTGGTAGTAAAGTAACGTGATGGCTCTTGGAG
ACCCTGTTGTGATTACAGACTACTGAACAGTATCACAATACCAGACAAAT
ATCTACTTATTTGACACTTTGAATTTCAGTTTATTTTTTGAATTTTTGCT
AACTTTACGATTTACAGCGATTATTGGACTTCATTTTTATTTGTACTCTT
TTTGGTACAAATCCAACAAATTGCGTACCGGTAAGCACAACTGGGAAATT
TTATAAAGTTTTCTCTGTTTTTTCACAGGCTATAGTCACATTAATTATTT
TGCTCCTCCGAGCCAGATCAACAATAACCCAAAATTTCAGTGATATCTCT
GAACGAGTGAATATTAATTTTTTTCTACTGACAGCTGCTGTTTGTCATGC
TCGGAGATTTGCGTTTCCAATAGAAATGATTAAT
back to top

protein sequence of SMED30000193-orf-1

>SMED30000193-orf-1 ID=SMED30000193-orf-1|Name=SMED30000193-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MDICRCKYYYRCGFLVSLNLSVNCKQSSFQIPRRWNLTKGMAKTPKLIIF
PQKNMTQYPALIQRIDLQQLSMFNSELLKMDNQSLKNSANYSENGCSQLR
WSLSDYWKITSGKQATTVGNNHWW*
back to top

protein sequence of SMED30000193-orf-2

>SMED30000193-orf-2 ID=SMED30000193-orf-2|Name=SMED30000193-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=203bp
MRIPDHIFSHAINSDCSASSAFNNVKYLQKFDNYRHTKSDYEILKICQGD
NISYANKVPTAETFGKENGRMKKKAKSSKLGKVEPNTSSTVSDLAGGSFL
SKNSMDASTDTEQLLPIFVSEKASNFDSGMLLDTLKNQQCCSYQCFTKLK
FIEKTLKKVEQRQKTIKSQLNFSVAFGATGILLKFLLIYFDRFYPKSGIW
FD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002030early male germ cell
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: molecular function
TermDefinition
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 149..169
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 66..88
NoneNo IPR availableTMHMMTMhelixcoord: 168..190