ankyrin and armadillo repeat-containing protein

Overview
Nameankyrin and armadillo repeat-containing protein
Smed IDSMED30000192
Length (bp)2855
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ankyrin and armadillo repeat-containing protein (SMED30000192) t-SNE clustered cells

Violin plots show distribution of expression levels for ankyrin and armadillo repeat-containing protein (SMED30000192) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ankyrin and armadillo repeat-containing protein (SMED30000192) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ankyrin and armadillo repeat-containing protein (SMED30000192) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000192

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30000192SMESG000068683.1 dd_Smed_v4_10062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000192SMESG000068683.1 dd_Smed_v4_10062_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000192SMESG000068683.1 dd_Smed_v4_10062_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Human
Match: ANKAR (ankyrin and armadillo repeat containing [Source:HGNC Symbol;Acc:HGNC:26350])

HSP 1 Score: 205.682 bits (522), Expect = 1.238e-53
Identity = 132/471 (28.03%), Postives = 248/471 (52.65%), Query Frame = 1
Query: 1099 FMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNI--DIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDP-YLMKVIMFYNKENKIDPEFMEGWQHYKR-VGLPKIDLNR 2499
            F+ +++  L    +  +A++  +N + Q     +G    ++ L + K   +++    A+ +LA  N   Q   ++K+  K   L+       I V E+ + ALW+LAG T   +  MA  IG   +I+ L +PS  +Q +G EA+  +S      ++ I + NGI PLV LL+   I    +LS IR++  +C+ + + ++  +Q LV+       L+ L+R++    ++VE A+++A + + N+    +LH N  F Y  +L  ++S+   I L AG +L  FA+NN  +Q  I + G +     + FL S  E EK M+AFQ+++L++VI D +    +  G+  L+++L   + S +   G + +  L H++AGI  A  + G +  LC  L S ++ V+   + A+ YL++   + R +L++CR  P   +++    +++  I+P F++ +Q  +  VGLP + L +
Sbjct:  873 FLSSDSDVLKAVSSAAIAEVGRDNKEIQDAIAMEGAIPPLVALFKGKQISVQMKGAMAVESLASHNALIQKAFLEKSLTK--YLLKLLKAFQIDVKEQGAVALWALAGQTLKQQKYMAEQIGYSFIINMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGNGIAPLVRLLRISTIAEGTLLSVIRAVGSICIGVAHTSNPVSQQLVVDENAFPVLIQLLRNHPSPNIKVEVAFSLACIVLGNDVLQKDLHENEGFEYADVLYLLHSTEKDICLRAGYALTLFAFNNRFQQYLILESGIMTISIFERFLESTVETEKAMAAFQIVVLAKVIRDMDHITLSARGVTILVDSLYSVQTSTIVLTG-NLIASLAHSRAGIPEAFTTLGTIQRLCYHLYSGIEEVRAACSSALGYLTYNANAFRILLKECRNKPNQFIRIKNNISRDASINPAFLKEFQMQQTLVGLPSLSLEK 1340          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Human
Match: ANKAR (ankyrin and armadillo repeat containing [Source:HGNC Symbol;Acc:HGNC:26350])

HSP 1 Score: 205.682 bits (522), Expect = 1.238e-53
Identity = 132/471 (28.03%), Postives = 248/471 (52.65%), Query Frame = 1
Query: 1099 FMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNI--DIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDP-YLMKVIMFYNKENKIDPEFMEGWQHYKR-VGLPKIDLNR 2499
            F+ +++  L    +  +A++  +N + Q     +G    ++ L + K   +++    A+ +LA  N   Q   ++K+  K   L+       I V E+ + ALW+LAG T   +  MA  IG   +I+ L +PS  +Q +G EA+  +S      ++ I + NGI PLV LL+   I    +LS IR++  +C+ + + ++  +Q LV+       L+ L+R++    ++VE A+++A + + N+    +LH N  F Y  +L  ++S+   I L AG +L  FA+NN  +Q  I + G +     + FL S  E EK M+AFQ+++L++VI D +    +  G+  L+++L   + S +   G + +  L H++AGI  A  + G +  LC  L S ++ V+   + A+ YL++   + R +L++CR  P   +++    +++  I+P F++ +Q  +  VGLP + L +
Sbjct:  873 FLSSDSDVLKAVSSAAIAEVGRDNKEIQDAIAMEGAIPPLVALFKGKQISVQMKGAMAVESLASHNALIQKAFLEKSLTK--YLLKLLKAFQIDVKEQGAVALWALAGQTLKQQKYMAEQIGYSFIINMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGNGIAPLVRLLRISTIAEGTLLSVIRAVGSICIGVAHTSNPVSQQLVVDENAFPVLIQLLRNHPSPNIKVEVAFSLACIVLGNDVLQKDLHENEGFEYADVLYLLHSTEKDICLRAGYALTLFAFNNRFQQYLILESGIMTISIFERFLESTVETEKAMAAFQIVVLAKVIRDMDHITLSARGVTILVDSLYSVQTSTIVLTG-NLIASLAHSRAGIPEAFTTLGTIQRLCYHLYSGIEEVRAACSSALGYLTYNANAFRILLKECRNKPNQFIRIKNNISRDASINPAFLKEFQMQQTLVGLPSLSLEK 1340          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Human
Match: ANKAR (ankyrin and armadillo repeat containing [Source:HGNC Symbol;Acc:HGNC:26350])

HSP 1 Score: 78.9518 bits (193), Expect = 3.138e-14
Identity = 57/199 (28.64%), Postives = 100/199 (50.25%), Query Frame = 1
Query: 1099 FMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNI--DIVLSCIRSLRQLCVKLGYL 1689
            F+ +++  L    +  +A++  +N + Q     +G    ++ L + K   +++    A+ +LA  N   Q   ++K+  K   L+       I V E+ + ALW+LAG T   +  MA  IG   +I+ L +PS  +Q +G EA+  +S      ++ I + NGI PLV LL+   I    +LS IR++  +C+  GYL
Sbjct:  802 FLSSDSDVLKAVSSAAIAEVGRDNKEIQDAIAMEGAIPPLVALFKGKQISVQMKGAMAVESLASHNALIQKAFLEKSLTK--YLLKLLKAFQIDVKEQGAVALWALAGQTLKQQKYMAEQIGYSFIINMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGNGIAPLVRLLRISTIAEGTLLSVIRAVGSICI--GYL 996          

HSP 2 Score: 75.8702 bits (185), Expect = 2.852e-13
Identity = 61/225 (27.11%), Postives = 106/225 (47.11%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQ-NVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQ-GYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVE 798
            +  GW  IH AAF   +  +  L  K P  LE     E + TPLLLA  SG L+T+Q L  +GA     + +G+ II L+ L    ++L Y ++ N+ E   PVW  LV+ +     +  + A   +  I + N        Y +  + A  +  +I ++K ++   +CK  ++ +L++   ++    + +E GG+  ++ LL        +R  V + DI   E
Sbjct:  529 EKRGWMPIHFAAFYDNVCIIIALCRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFSIGANWRKTDIKGNNIIHLSVLTFHTEVLKYIIKLNIPE--LPVWKTLVEMLQCESYKRRMMAVMSLEVICLAND------QYWRCILDAGTIPALINLLKSSKIKLQCK--TVGLLSNISTHKSAVHALVEAGGIPSLINLLVCDEPEVHSRCAVILYDIAQCE 743          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Human
Match: ANKAR (ankyrin and armadillo repeat containing [Source:HGNC Symbol;Acc:HGNC:26350])

HSP 1 Score: 76.6406 bits (187), Expect = 1.420e-13
Identity = 61/225 (27.11%), Postives = 106/225 (47.11%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQ-NVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQ-GYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVE 798
            +  GW  IH AAF   +  +  L  K P  LE     E + TPLLLA  SG L+T+Q L  +GA     + +G+ II L+ L    ++L Y ++ N+ E   PVW  LV+ +     +  + A   +  I + N        Y +  + A  +  +I ++K ++   +CK  ++ +L++   ++    + +E GG+  ++ LL        +R  V + DI   E
Sbjct:  364 EKRGWMPIHFAAFYDNVCIIIALCRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFSIGANWRKTDIKGNNIIHLSVLTFHTEVLKYIIKLNIPE--LPVWKTLVEMLQCESYKRRMMAVMSLEVICLAND------QYWRCILDAGTIPALINLLKSSKIKLQCK--TVGLLSNISTHKSAVHALVEAGGIPSLINLLVCDEPEVHSRCAVILYDIAQCE 578          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Zebrafish
Match: ankar (ankyrin and armadillo repeat containing [Source:ZFIN;Acc:ZDB-GENE-030616-533])

HSP 1 Score: 263.077 bits (671), Expect = 1.730e-72
Identity = 210/795 (26.42%), Postives = 383/795 (48.18%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQ-NVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVI-KGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDI-ARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNID--IVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMF-YNKENKIDPEFMEGWQHYKRVGLPKIDLN 2496
            D  GW  IH AAF G +  ++ L  K P  LE+ T  E  S+PLLL+  SG++E +  L+  GA     +S+G+  + L  L    D+L + +Q N+D    PVW  LV+ +   D +       C+  + +N +       + ++ + A  V  ++ ++    Q  +C   +  VL H      V E  +  G + +++ LL     P++ +R  V + D+        S++  H  +I DL  +    ++VV     N  T                    SD    D+L    +    L    P  Q ++    G    +  L ++++  +L  E    +A+L+  + +NQ    + G   +++   R +   +++ A  A+ +LA  N   Q   ++++A K LL +L  +   + V E+ + ALW+LAG + + +  MA  +G  +++D L +PSD +Q +G  A+  +S      ++   ++NG+ PLV LL+        +LS I +L  LC+ +    +  +Q  V   + +  L+ L++++  + ++V+ A T+A V + N++   E     +F+Y  I+E + + N  I L AG +L+ FAYN+   QK I + GGI  K  + FL S++E EK  +AFQ ++L+RVI   +    T  G+  L+E L   +++ V  +    +  L H +AGI +A++S G  + L   L S  + V+     A+ YL+F   + RQ++ KCR+ P++  ++M     + +I   F   ++  +R+G P + L 
Sbjct:  599 DKRGWMAIHFAAFYGQVACIQVLCRKDPTLLEMKTPAEYGSSPLLLSATSGSVEALDFLLSTGANWREEDSKGNNCVHLAALYFHTDVLKHLIQLNLDG--LPVWKILVEMLQIEDFKRMEKTLGCLEALCVNTE------SFSEDILDAGGVPVLVSLLCSDRQVVQCMATA--VLCHMTENSQVCEELVHHGAVPILIKLLSV-HQPELDSRCAVILADL-----AAHSKQ--HQSLIADLGGV----ALVV-----NLLT--------------------SDL--QDVLVNGVRCIRTLCVRSPHNQTAVAHAGGVPHLIQILAVDSD--TLQEEACLALAELSRGHRENQALICEAGAVGALVQALRHRKISVKVKAASALESLASHNSAIQQCFLRQSAPKYLLQLL--TVFQLDVREQGAIALWALAGQSLNQQKLMAEQMGYSVILDLLLSPSDKIQYVGCRAVIALSRDSRIHQNGFCRENGVPPLVRLLRGSRTGQKTLLSVIEALGCLCIGVALTTNKNSQKTVYREQAIPTLLELLKAHKSQEIKVQVAQTLACVLLGNQKLQREFWEQEDFSYENIVELLNAENKNISLDAGHALSLFAYNSKAHQKAIRQLGGIPGKIYETFLNSDNETEKAKAAFQTVVLARVISGSDEVTLTARGVTILVELLQSDQSTTVI-ITAQLLASLAHMRAGITDAIVSMGATEHLSAHLDSEDEEVRTACTSALGYLTFNRYAHRQLMTKCRKSPHIYDLLMKNLAPDARISQLFTAEFERQRRIGFPSLSLG 1339          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Zebrafish
Match: ankar (ankyrin and armadillo repeat containing [Source:ZFIN;Acc:ZDB-GENE-030616-533])

HSP 1 Score: 206.838 bits (525), Expect = 7.411e-56
Identity = 136/489 (27.81%), Postives = 256/489 (52.35%), Query Frame = 1
Query: 1039 PTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNID--IVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMF-YNKENKIDPEFMEGWQHYKRVGLPKIDLN 2496
            P  Q ++    G    +  L ++++  +L  E    +A+L+  + +NQ    + G   +++   R +   +++ A  A+ +LA  N   Q   ++++A K LL +L  +   + V E+ + ALW+LAG + + +  MA  +G  +++D L +PSD +Q +G  A+  +S      ++   ++NG+ PLV LL+        +LS I +L  LC+ +    +  +Q  V   + +  L+ L++++  + ++V+ A T+A V + N++   E     +F+Y  I+E + + N  I L AG +L+ FAYN+   QK I + GGI  K  + FL S++E EK  +AFQ ++L+RVI   +    T  G+  L+E L   +++ V  +    +  L H +AGI +A++S G  + L   L S  + V+     A+ YL+F   + RQ++ KCR+ P++  ++M     + +I   F   ++  +R+G P + L 
Sbjct:  141 PHNQTAVAHAGGVPHLIQILAVDSD--TLQEEACLALAELSRGHRENQALICEAGAVGALVQALRHRKISVKVKAASALESLASHNSAIQQCFLRQSAPKYLLQLL--TVFQLDVREQGAIALWALAGQSLNQQKLMAEQMGYSVILDLLLSPSDKIQYVGCRAVIALSRDSRIHQNGFCRENGVPPLVRLLRGSRTGQKTLLSVIEALGCLCIGVALTTNKNSQKTVYREQAIPTLLELLKAHKSQEIKVQVAQTLACVLLGNQKLQREFWEQEDFSYENIVELLNAENKNISLDAGHALSLFAYNSKAHQKAIRQLGGIPGKIYETFLNSDNETEKAKAAFQTVVLARVISGSDEVTLTARGVTILVELLQSDQSTTVI-ITAQLLASLAHMRAGITDAIVSMGATEHLSAHLDSEDEEVRTACTSALGYLTFNRYAHRQLMTKCRKSPHIYDLLMKNLAPDARISQLFTAEFERQRRIGFPSLSLG 624          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Xenopus
Match: gsg1lr (GSG1-like related [Source:Xenbase;Acc:XB-GENE-5832503])

HSP 1 Score: 258.07 bits (658), Expect = 1.057e-70
Identity = 214/803 (26.65%), Postives = 373/803 (46.45%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQ-NVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNI--DIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMF-YNKENKIDPEFMEGWQHYKRVGLPKIDLNRPFLTTRKEI 2526
            D+ GW  IH AAF G IP +  L    P  LE+ T  + + TPLLL   +G L+ +  L+ +GA    ++S G+ II+L  L    ++L Y +  N+ E    VW  L   V  +    S+H    I  ++    L+ D+ P    C+   I+S I                            V  + ++ G ++V++ LL        +R  V + DI  ++ N          VI +++ I    S +V   Y+ +E                           D+L         L   +   Q ++ ++ G +  L   F+  ++  L+   T  +A+LA +N   Q    K+G+  S+I++ R ++  +++ A   I  L   N   Q + + K+  K +  +L+     + V E+ ST LW+LAG T   +  MA  IG   +ID L +PSD +Q IG EAI  +       +  I + NGI PLV LL+S  +    ++  I++L  +C+ + ++ +   Q  ++    +  L+ L+++     V+ E A T+A + +RN    D L    +  Y  IL+ +Y+S+  I L AG +L+ FAY++ ++Q  I + GGI+    +PFL S+ E E+ ++AFQ+++L++VI D +       G+  L E L  +KN     L  + +  L H + GI  A+ + G V  LC  L S  + V+   A A+ YL+F   + R +L +CR  P L  +++   +++ ++   F + ++  K++GLP + L +     R  I
Sbjct:  600 DNRGWMAIHFAAFYGAIPCIRALYRNDPNLLEMETTAQYQCTPLLLTAAAGELDALHYLLSVGANWKQKDSLGNNIIDLAVLYFHTNILKYIIDLNIPE--LHVWQQLAGKVRKM----SLHFVCTIPSLV--ELLHSDQVPL--KCLALGILSNISN-----------------------NNPVSRALVKSGAIQVLVHLLHSRQPELQSRCSVLLSDIAQIDSN--------QNVIAEMDGI----SPLVHLLYEKYE---------------------------DVLVNAVNCIRVLCIKNTANQKAV-RDLGAIPSLVE-FLTAKSDILVSAATDVIAELARDNKAIQDAVTKEGVIESLISILRVRNINIQVKAAMTIEALCDHNPAVQKEFLTKSVTKHISKLLKVF--QLEVREQGSTTLWALAGQTRKQQKAMAEYIGYKCIIDMLLSPSDKMQYIGGEAIIALCKDSRHYQCQICEGNGIGPLVRLLRSPKVANGTLIRIIKALGIMCIGVAFINNPVAQEKIVEENAIPTLLHLLKTQNSLHVKAEVACTLACIVLRNSNLQDSLKEMEDVKYSDILDLLYASDKAICLRAGYALSLFAYSSTMQQFNILENGGIKISIYEPFLQSDIEPERALAAFQIVVLAKVISDMDQITLCTKGVTVLTELLQ-SKNPTTLVLTGELLATLAHIRTGIPEAITTLGTVKCLCNHLYSPDEEVRIACANALGYLTFNRTASRHLLAECRTRPCLYNLLISNLSEDARMSKTFTDEFKIQKQIGLPSLRLVKQVFCHRVTI 1325          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Mouse
Match: Ankar (ankyrin and armadillo repeat containing [Source:MGI Symbol;Acc:MGI:2442559])

HSP 1 Score: 252.677 bits (644), Expect = 5.213e-69
Identity = 211/801 (26.34%), Postives = 383/801 (47.82%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQ-NVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGV-----IVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQP-IGSQHSDWFTHDLLKEIFQF-FGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNI--DIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDP-YLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNR 2499
            +  GW  IH AAF   I  L  L  K P  LE     E + TPLLLA  SG L+T+Q L  LGA     +++G+ II L+ L    ++L Y ++ N+ E   PVW  LV+ +     +  + A   +  I + N    DR  Y Q  + A  +  ++ ++K  Q  + + +++ +L++   +  +  + +E GG+  ++ LL        +R  + + D+   E      +  +SG+     ++ LNK     +V+   +      +S+ +++ ++   Q  I    SD    D+LK +       +A  +   Q++I KE G +  L TLF + +  S+ ++    V  LAN N   Q+EF++  +   ++ L +A   +++     A+  LA   ++ Q  + ++                                            IG +L+I  L +PS  +Q +G EA+  +S      ++ I +  GI PLV LL+ + I    +LS IR++  +C+ + + ++  +Q  V+    L  L+ L+R++    ++VE A+++A + + N     EL  +  F Y  +L  ++S + ++ L AG +L  FA+N+  +Q  I + G I     +PFL S  E E+ M+AFQ+IIL++ I D E     G GI+ L ++L+      +   G + +  L H++AGI  A +S G V  LC  L +  + V+   + A+ YL++   + R +L +CR  P   +++    +K+ KI+P F++ +Q  +R+GLP + L R
Sbjct:  613 EKRGWMPIHFAAFYDNICILIALCRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFSLGANWRKTDTKGNNIIHLSVLAFHTEVLKYIIELNIPE--LPVWETLVEMLQCESSKRRMMAVMSLEVICLAN----DR--YWQCILDAGTIPALVNLLKSPQ-IKLQYKTVGLLSNISTHVSIVHAIVEAGGIPAVINLLTSDEPELHSRCAIILYDVAKCENKDVIAK--YSGIPALINLLSLNKESVLVNVMNCIRVLCMGNESNQQSMKDNNGIQYLIQFLSSD---SDVLKALSSATIAEVARDNKEVQDAIAKE-GAIPPLVTLF-KGKQLSVQVKGAMAVESLANCNPLIQKEFLERELTKDLLKLLQAFQIDVKEQGAIALWALAGQTLKQQKYMAEQ--------------------------------------------IGYNLIISMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGKGIAPLVRLLRINKIPEGTLLSVIRAVGSICIGVAHTSNPMSQQFVVEENALPVLIQLLRNHPSINIRVEVAFSLACIVLGNNSLKKELQNDEGFEYSDVLYLLHSKDKEVCLKAGYALTLFAFNDRFQQHLILETGLITVSIFEPFLQSSVETERAMAAFQIIILAKAIIDVEHVTLYGRGIQILADSLNSVHAPTIALTG-NIIASLAHSRAGIPEAFVSLGTVQRLCYHLYARSEEVRTACSCALGYLTYNAHAFRLLLTECRNKPNQFLRITNNISKDAKINPAFLKEFQLQQRMGLPSLSLER 1352          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Mouse
Match: Ankar (ankyrin and armadillo repeat containing [Source:MGI Symbol;Acc:MGI:2442559])

HSP 1 Score: 251.906 bits (642), Expect = 6.305e-69
Identity = 211/801 (26.34%), Postives = 383/801 (47.82%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQ-NVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGV-----IVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQP-IGSQHSDWFTHDLLKEIFQF-FGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNI--DIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDP-YLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNR 2499
            +  GW  IH AAF   I  L  L  K P  LE     E + TPLLLA  SG L+T+Q L  LGA     +++G+ II L+ L    ++L Y ++ N+ E   PVW  LV+ +     +  + A   +  I + N    DR  Y Q  + A  +  ++ ++K  Q  + + +++ +L++   +  +  + +E GG+  ++ LL        +R  + + D+   E      +  +SG+     ++ LNK     +V+   +      +S+ +++ ++   Q  I    SD    D+LK +       +A  +   Q++I KE G +  L TLF + +  S+ ++    V  LAN N   Q+EF++  +   ++ L +A   +++     A+  LA   ++ Q  + ++                                            IG +L+I  L +PS  +Q +G EA+  +S      ++ I +  GI PLV LL+ + I    +LS IR++  +C+ + + ++  +Q  V+    L  L+ L+R++    ++VE A+++A + + N     EL  +  F Y  +L  ++S + ++ L AG +L  FA+N+  +Q  I + G I     +PFL S  E E+ M+AFQ+IIL++ I D E     G GI+ L ++L+      +   G + +  L H++AGI  A +S G V  LC  L +  + V+   + A+ YL++   + R +L +CR  P   +++    +K+ KI+P F++ +Q  +R+GLP + L R
Sbjct:  395 EKRGWMPIHFAAFYDNICILIALCRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFSLGANWRKTDTKGNNIIHLSVLAFHTEVLKYIIELNIPE--LPVWETLVEMLQCESSKRRMMAVMSLEVICLAN----DR--YWQCILDAGTIPALVNLLKSPQ-IKLQYKTVGLLSNISTHVSIVHAIVEAGGIPAVINLLTSDEPELHSRCAIILYDVAKCENKDVIAK--YSGIPALINLLSLNKESVLVNVMNCIRVLCMGNESNQQSMKDNNGIQYLIQFLSSD---SDVLKALSSATIAEVARDNKEVQDAIAKE-GAIPPLVTLF-KGKQLSVQVKGAMAVESLANCNPLIQKEFLERELTKDLLKLLQAFQIDVKEQGAIALWALAGQTLKQQKYMAEQ--------------------------------------------IGYNLIISMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGKGIAPLVRLLRINKIPEGTLLSVIRAVGSICIGVAHTSNPMSQQFVVEENALPVLIQLLRNHPSINIRVEVAFSLACIVLGNNSLKKELQNDEGFEYSDVLYLLHSKDKEVCLKAGYALTLFAFNDRFQQHLILETGLITVSIFEPFLQSSVETERAMAAFQIIILAKAIIDVEHVTLYGRGIQILADSLNSVHAPTIALTG-NIIASLAHSRAGIPEAFVSLGTVQRLCYHLYARSEEVRTACSCALGYLTYNAHAFRLLLTECRNKPNQFLRITNNISKDAKINPAFLKEFQLQQRMGLPSLSLER 1134          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Mouse
Match: Ankar (ankyrin and armadillo repeat containing [Source:MGI Symbol;Acc:MGI:2442559])

HSP 1 Score: 252.292 bits (643), Expect = 7.842e-69
Identity = 211/801 (26.34%), Postives = 383/801 (47.82%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQ-NVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGV-----IVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQP-IGSQHSDWFTHDLLKEIFQF-FGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNI--DIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDP-YLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNR 2499
            +  GW  IH AAF   I  L  L  K P  LE     E + TPLLLA  SG L+T+Q L  LGA     +++G+ II L+ L    ++L Y ++ N+ E   PVW  LV+ +     +  + A   +  I + N    DR  Y Q  + A  +  ++ ++K  Q  + + +++ +L++   +  +  + +E GG+  ++ LL        +R  + + D+   E      +  +SG+     ++ LNK     +V+   +      +S+ +++ ++   Q  I    SD    D+LK +       +A  +   Q++I KE G +  L TLF + +  S+ ++    V  LAN N   Q+EF++  +   ++ L +A   +++     A+  LA   ++ Q  + ++                                            IG +L+I  L +PS  +Q +G EA+  +S      ++ I +  GI PLV LL+ + I    +LS IR++  +C+ + + ++  +Q  V+    L  L+ L+R++    ++VE A+++A + + N     EL  +  F Y  +L  ++S + ++ L AG +L  FA+N+  +Q  I + G I     +PFL S  E E+ M+AFQ+IIL++ I D E     G GI+ L ++L+      +   G + +  L H++AGI  A +S G V  LC  L +  + V+   + A+ YL++   + R +L +CR  P   +++    +K+ KI+P F++ +Q  +R+GLP + L R
Sbjct:  612 EKRGWMPIHFAAFYDNICILIALCRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFSLGANWRKTDTKGNNIIHLSVLAFHTEVLKYIIELNIPE--LPVWETLVEMLQCESSKRRMMAVMSLEVICLAN----DR--YWQCILDAGTIPALVNLLKSPQ-IKLQYKTVGLLSNISTHVSIVHAIVEAGGIPAVINLLTSDEPELHSRCAIILYDVAKCENKDVIAK--YSGIPALINLLSLNKESVLVNVMNCIRVLCMGNESNQQSMKDNNGIQYLIQFLSSD---SDVLKALSSATIAEVARDNKEVQDAIAKE-GAIPPLVTLF-KGKQLSVQVKGAMAVESLANCNPLIQKEFLERELTKDLLKLLQAFQIDVKEQGAIALWALAGQTLKQQKYMAEQ--------------------------------------------IGYNLIISMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGKGIAPLVRLLRINKIPEGTLLSVIRAVGSICIGVAHTSNPMSQQFVVEENALPVLIQLLRNHPSINIRVEVAFSLACIVLGNNSLKKELQNDEGFEYSDVLYLLHSKDKEVCLKAGYALTLFAFNDRFQQHLILETGLITVSIFEPFLQSSVETERAMAAFQIIILAKAIIDVEHVTLYGRGIQILADSLNSVHAPTIALTG-NIIASLAHSRAGIPEAFVSLGTVQRLCYHLYARSEEVRTACSCALGYLTYNAHAFRLLLTECRNKPNQFLRITNNISKDAKINPAFLKEFQLQQRMGLPSLSLER 1351          
BLAST of ankyrin and armadillo repeat-containing protein vs. UniProt/SwissProt
Match: sp|A2RT91|ANKAR_MOUSE (Ankyrin and armadillo repeat-containing protein OS=Mus musculus OX=10090 GN=Ankar PE=2 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 3.647e-68
Identity = 211/801 (26.34%), Postives = 383/801 (47.82%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQ-NVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGV-----IVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQP-IGSQHSDWFTHDLLKEIFQF-FGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNI--DIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDP-YLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNR 2499
            +  GW  IH AAF   I  L  L  K P  LE     E + TPLLLA  SG L+T+Q L  LGA     +++G+ II L+ L    ++L Y ++ N+ E   PVW  LV+ +     +  + A   +  I + N    DR  Y Q  + A  +  ++ ++K  Q  + + +++ +L++   +  +  + +E GG+  ++ LL        +R  + + D+   E      +  +SG+     ++ LNK     +V+   +      +S+ +++ ++   Q  I    SD    D+LK +       +A  +   Q++I KE G +  L TLF + +  S+ ++    V  LAN N   Q+EF++  +   ++ L +A   +++     A+  LA   ++ Q  + ++                                            IG +L+I  L +PS  +Q +G EA+  +S      ++ I +  GI PLV LL+ + I    +LS IR++  +C+ + + ++  +Q  V+    L  L+ L+R++    ++VE A+++A + + N     EL  +  F Y  +L  ++S + ++ L AG +L  FA+N+  +Q  I + G I     +PFL S  E E+ M+AFQ+IIL++ I D E     G GI+ L ++L+      +   G + +  L H++AGI  A +S G V  LC  L +  + V+   + A+ YL++   + R +L +CR  P   +++    +K+ KI+P F++ +Q  +R+GLP + L R
Sbjct:  613 EKRGWMPIHFAAFYDNICILIALCRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFSLGANWRKTDTKGNNIIHLSVLAFHTEVLKYIIELNIPE--LPVWETLVEMLQCESSKRRMMAVMSLEVICLAN----DR--YWQCILDAGTIPALVNLLKSPQ-IKLQYKTVGLLSNISTHVSIVHAIVEAGGIPAVINLLTSDEPELHSRCAIILYDVAKCENKDVIAK--YSGIPALINLLSLNKESVLVNVMNCIRVLCMGNESNQQSMKDNNGIQYLIQFLSSD---SDVLKALSSATIAEVARDNKEVQDAIAKE-GAIPPLVTLF-KGKQLSVQVKGAMAVESLANCNPLIQKEFLERELTKDLLKLLQAFQIDVKEQGAIALWALAGQTLKQQKYMAEQ--------------------------------------------IGYNLIISMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGKGIAPLVRLLRINKIPEGTLLSVIRAVGSICIGVAHTSNPMSQQFVVEENALPVLIQLLRNHPSINIRVEVAFSLACIVLGNNSLKKELQNDEGFEYSDVLYLLHSKDKEVCLKAGYALTLFAFNDRFQQHLILETGLITVSIFEPFLQSSVETERAMAAFQIIILAKAIIDVEHVTLYGRGIQILADSLNSVHAPTIALTG-NIIASLAHSRAGIPEAFVSLGTVQRLCYHLYARSEEVRTACSCALGYLTYNAHAFRLLLTECRNKPNQFLRITNNISKDAKINPAFLKEFQLQQRMGLPSLSLER 1352          
BLAST of ankyrin and armadillo repeat-containing protein vs. UniProt/SwissProt
Match: sp|Q7Z5J8|ANKAR_HUMAN (Ankyrin and armadillo repeat-containing protein OS=Homo sapiens OX=9606 GN=ANKAR PE=2 SV=3)

HSP 1 Score: 205.682 bits (522), Expect = 5.945e-53
Identity = 132/471 (28.03%), Postives = 248/471 (52.65%), Query Frame = 1
Query: 1099 FMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNI--DIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDP-YLMKVIMFYNKENKIDPEFMEGWQHYKR-VGLPKIDLNR 2499
            F+ +++  L    +  +A++  +N + Q     +G    ++ L + K   +++    A+ +LA  N   Q   ++K+  K   L+       I V E+ + ALW+LAG T   +  MA  IG   +I+ L +PS  +Q +G EA+  +S      ++ I + NGI PLV LL+   I    +LS IR++  +C+ + + ++  +Q LV+       L+ L+R++    ++VE A+++A + + N+    +LH N  F Y  +L  ++S+   I L AG +L  FA+NN  +Q  I + G +     + FL S  E EK M+AFQ+++L++VI D +    +  G+  L+++L   + S +   G + +  L H++AGI  A  + G +  LC  L S ++ V+   + A+ YL++   + R +L++CR  P   +++    +++  I+P F++ +Q  +  VGLP + L +
Sbjct:  873 FLSSDSDVLKAVSSAAIAEVGRDNKEIQDAIAMEGAIPPLVALFKGKQISVQMKGAMAVESLASHNALIQKAFLEKSLTK--YLLKLLKAFQIDVKEQGAVALWALAGQTLKQQKYMAEQIGYSFIINMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGNGIAPLVRLLRISTIAEGTLLSVIRAVGSICIGVAHTSNPVSQQLVVDENAFPVLIQLLRNHPSPNIKVEVAFSLACIVLGNDVLQKDLHENEGFEYADVLYLLHSTEKDICLRAGYALTLFAFNNRFQQYLILESGIMTISIFERFLESTVETEKAMAAFQIVVLAKVIRDMDHITLSARGVTILVDSLYSVQTSTIVLTG-NLIASLAHSRAGIPEAFTTLGTIQRLCYHLYSGIEEVRAACSSALGYLTYNANAFRILLKECRNKPNQFIRIKNNISRDASINPAFLKEFQMQQTLVGLPSLSLEK 1340          
BLAST of ankyrin and armadillo repeat-containing protein vs. UniProt/SwissProt
Match: sp|Q4I1B1|VAC8_GIBZE (Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) OX=229533 GN=VAC8 PE=3 SV=4)

HSP 1 Score: 57.3806 bits (137), Expect = 4.938e-7
Identity = 56/232 (24.14%), Postives = 114/232 (49.14%), Query Frame = 1
Query: 1144 CVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIG-VDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYT---IASVTMRNE 1827
            C+  LA    +N+ +  + G    +  L +++D  ++  A  A++N+   + E + QL+   A   L+ +L  S  ++ V    +TAL ++A   S+ +    S    V  L++ + + S  +Q   + A+  ++     Q D++ + NG+ PL+ LL+S  + ++LS +  +R + +      H  N+  ++ T  L  LV L+ S  +E +Q  A  T   +A+ + RN+
Sbjct:  151 CITNLATHE-ENKAKIARSGALGPLTRLAKSRDMRVQRNATGALLNMTHSD-ENRQQLVNAGAIPVLVQLL--SSPDVDVQYYCTTALSNIAVDASNRRKLAQSEPKLVQSLVNLMDSTSPKVQCQAALALRNLASDEKYQLDIV-RANGLHPLLRLLQSSYLPLILSAVACIRNISI------HPMNESPIIETNFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNK 371          
BLAST of ankyrin and armadillo repeat-containing protein vs. TrEMBL
Match: A0A1S3JCJ7 (ankyrin and armadillo repeat-containing protein OS=Lingula unguis OX=7574 GN=LOC106172077 PE=4 SV=1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 323/822 (39.29%), Postives = 498/822 (60.58%), Query Frame = 1
Query:  115 TMHQFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSE---RIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNRPFLTTRKEIDLFKDLNEKQITLFS 2571
            TM++ D NGW +IH AAF+GFI S+E+ +  + ++LEL T DE RSTPLLLAV +GN ETV+ LI LGA+++  N+Q HG++EL+  +  I++L++FL+   E+  PVW  L++++ S  ++E+  A  C+ + L      G   P  +  +    V  I+KVIK   G   K E+L  L + I   VV+E     GG+  ++ LL+  +N      +VQ+   ++ E +  +E   +   +G I +L K+++                    TV +                 ++L E     G +AE    +Q +IG   GC+  L     E +N+ LL+ LT  ++K+A  N  NQ   +++G    II LT  K+++++L AVDAI  LA+ N   Q  + ++ A  PL  +L+KS R   V EK + ALW+ AG   + +  MAS+IGV  LI+FL T S+ L LIGSEA+ V+S G  +++  IG  NGI  LV LL+SD   IVLS IR+LR LCV +GY+ H+ NQ+ +   +G+ FLV LM    +EL++VEAA T+  V + NEE + E+ +N  F+YV IL  MYS +P +RLLAGA+LAAFA+N++ +Q++IA+ GG+RF C +PFL S DE+ +C +AFQ+++LSR+IPDEE AVS+  GIK L++ +  +++  +Q L  DC+ RL HT+AG+  A++S   VD+LC L++   + V+G AA+A+ YLS   ++ RQ+L +CR+DPYLMK + +Y  + ++ P F+EGW HYK VGLP I+  RP L + + + + +  + + +T+ S
Sbjct:   25 TMNEKDENGWYHIHHAAFRGFIKSIERFVNANKDQLELETEDEYRSTPLLLAVTNGNKETVECLISLGAKVNAINNQNHGVVELSANKHFIEILDFFLEKNFED-LPVWKRLLNYLSSEVEDEAESAGKCL-RTLTQGSSEG-MHPNWKAVVDNGGVPIIVKVIKSQIGDRAKTEALHCLINLIPEDVVKEQVASSGGIPALVRLLKSSNN-----FIVQLAATVLKEVSRITELADQAAQAGAIPNLVKVIQ--------------------TVRDP----------------EVLVECVYCLGFIAEAGEAHQGTIGNTSGCVQALVGHLEEAQNQDLLMALTISISKIACNNKNNQNAIVEEGGAAHIITLTGLKNRDLQLSAVDAIRYLAENNSSTQKTIKEEGALIPLNNLLKKS-RAERVQEKTAAALWAEAGDYIEEQRSMASIIGVQTLIEFLSTGSEKLHLIGSEALGVLSRGALNKQTEIGNANGIHSLVRLLRSDKEHIVLSAIRTLRYLCVGVGYVPHLPNQNSLSQARGIKFLVALMVHPENELIKVEAAQTLGCVCLGNEEVMKEIQSNVEFSYVRILRMMYSQDPLVRLLAGAALAAFAFNSVTQQREIAEQGGVRFNCFEPFLVSVDEFFRCNAAFQVVVLSRIIPDEEQAVSSAKGIKLLVDLIQESQSETIQSLAADCLARLAHTRAGVPAAIVSIHAVDLLCNLMLVDAELVQGCAAVALGYLSHNHDAERQLLNRCRKDPYLMKALKYYCSKARLSPSFIEGWHHYKTVGLPPIEEGRPSLVSTRNLYVPEKASGRPMTMLS 801          
BLAST of ankyrin and armadillo repeat-containing protein vs. TrEMBL
Match: A0A1S3KBH8 (ankyrin and armadillo repeat-containing protein-like OS=Lingula unguis OX=7574 GN=LOC106180413 PE=4 SV=1)

HSP 1 Score: 556.214 bits (1432), Expect = 0.000e+0
Identity = 322/821 (39.22%), Postives = 497/821 (60.54%), Query Frame = 1
Query:  118 MHQFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSE---RIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNRPFLTTRKEIDLFKDLNEKQITLFS 2571
            M++ D NGW +IH AAF+GFI S+E+ +  + ++LEL T DE RSTPLLLAV +GN ETV+ LI LGA+++  N+Q HG++EL+  +  I++L++FL+   E+  PVW  L++++ S  ++E+  A  C+ + L      G   P  +  +    V  I+KVIK   G   K E+L  L + I   VV+E     GG+  ++ LL+  +N      +VQ+   ++ E +  +E   +   +G I +L K+++                    TV +                 ++L E     G +AE    +Q +IG   GC+  L     E +N+ LL+ LT  ++K+A  N  NQ   +++G    II LT  K+++++L AVDAI  LA+ N   Q  + ++ A  PL  +L+KS R   V EK + ALW+ AG   + +  MAS+IGV  LI+FL T S+ L LIGSEA+ V+S G  +++  IG  NGI  LV LL+SD   IVLS IR+LR LCV +GY+ H+ NQ+ +   +G+ FLV LM    +EL++VEAA T+  V + NEE + E+ +N  F+YV IL  MYS +P +RLLAGA+LAAFA+N++ +Q++IA+ GG+RF C +PFL S DE+ +C +AFQ+++LSR+IPDEE AVS+  GIK L++ +  +++  +Q L  DC+ RL HT+AG+  A++S   VD+LC L++   + V+G AA+A+ YLS   ++ RQ+L +CR+DPYLMK + +Y  + ++ P F+EGW HYK VGLP I+  RP L + + + + +  + + +T+ S
Sbjct:    1 MNEKDENGWYHIHHAAFRGFIKSIERFVNANKDQLELETEDEYRSTPLLLAVTNGNKETVECLISLGAKVNAINNQNHGVVELSANKHFIEILDFFLEKNFED-LPVWKRLLNYLSSEVEDEAESAGKCL-RTLTQGSSEG-MHPNWKAVVDNGGVPIIVKVIKSQIGDRAKTEALHCLINLIPEDVVKEQVASSGGIPALVRLLKSSNN-----FIVQLAATVLKEVSRITELADQAAQAGAIPNLVKVIQ--------------------TVRDP----------------EVLVECVYCLGFIAEAGEAHQGTIGNTSGCVQALVGHLEEAQNQDLLMALTISISKIACNNKNNQNAIVEEGGAAHIITLTGLKNRDLQLSAVDAIRYLAENNSSTQKTIKEEGALIPLNNLLKKS-RAERVQEKTAAALWAEAGDYIEEQRSMASIIGVQTLIEFLSTGSEKLHLIGSEALGVLSRGALNKQTEIGNANGIHSLVRLLRSDKEHIVLSAIRTLRYLCVGVGYVPHLPNQNSLSQARGIKFLVALMVHPENELIKVEAAQTLGCVCLGNEEVMKEIQSNVEFSYVRILRMMYSQDPLVRLLAGAALAAFAFNSVTQQREIAEQGGVRFNCFEPFLVSVDEFFRCNAAFQVVVLSRIIPDEEQAVSSAKGIKLLVDLIQESQSETIQSLAADCLARLAHTRAGVPAAIVSIHAVDLLCNLMLVDAELVQGCAAVALGYLSHNHDAERQLLNRCRKDPYLMKALKYYCSKARLSPSFIEGWHHYKTVGLPPIEEGRPSLVSTRNLYVPEKASGRPMTMLS 776          
BLAST of ankyrin and armadillo repeat-containing protein vs. TrEMBL
Match: K1QD73 (Ankyrin and armadillo repeat-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10008512 PE=4 SV=1)

HSP 1 Score: 533.487 bits (1373), Expect = 2.447e-172
Identity = 292/792 (36.87%), Postives = 466/792 (58.84%), Query Frame = 1
Query:  124 QFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNR 2499
            +FD++GW  IH AA +G++ S++  ++  P  LEL T D    TP L AV  G +E V ++I+LG++I   NSQ HG +E+  ++  ID+LNYF++   E + PVW +L+ FV S  DEE+  A   +  +   ++ +G   P  ++      V  IIKV K + G E K  + + L + I  + V+E  +  GG+   + LL+  +N  + ++  +IL  +    + ++E I  +  I  L K+L+                                + H+     ++L ++    GN+AE    YQ+ +G++ GC+  +  L    +++  L    + V K+   N  NQ  F+       ++ +TR ++K++++ AV+ I  +A  N   Q Q+ Q +  + LLL L  + R+  V EK + ALW++AG   D K  +A  +GV  L++F+ + S+ L  IGSE + V++ GP S    I   NGI PL  L++S+   IVLS IR++R LC+ +GY+ H  NQ+ ++  +G+  +V LM    ++++QVEAA T+ASV++ N+  LD++H+N +F+YV IL+ MYS +P +RLLAG +LA FAYNN+ +QK+IA  GG+RF C  PFL SEDEY +C++AFQ+++L+R+IPDEE A+S+  GIK L++ L  + N++   L  DC+ RL HT+AG+  AMIS  +++ L  LLVS  + V+G+AA+A+ YLS+     RQ+L KCR DPYLM++++ Y K +KI P F+E WQHYK+VGLP I   R
Sbjct:   17 EFDASGWAQIHQAANRGYLKSIQFFVKDDPSLLELETTDGKNLTPFLCAVDGGKIEAVHQMIELGSKIDAINSQNHGAVEMCAMKSYIDLLNYFIEKDFEKI-PVWKNLLRFVTSESDEEAEAAGKSLRTLTQGSQADGIN-PNWKSFYDHGGVPVIIKVAKSSIGEEAKIPAFQTLLNIIEREEVKEQVLSSGGIPTFIKLLKS-TNHFLIQLSAEILKEMATVTD-YAEAISQNNGIQSLIKVLQ--------------------------------TIHNP----EVLVQVLDCLGNVAEHDKKYQDLVGQQQGCVQTIVQLLEYEKDKDFLNSACRTVGKVCYNNETNQNSFVDASAIPHVLAVTRLRNKDIQVTAVECIRKVAANNPYSQKQM-QTDQVQELLLKLLGTTRSEVVKEKTALALWAIAGREFDVKRLIAERMGVGTLVEFINSMSEDLNFIGSEGLGVLAQGPLSYHSDIANANGIAPLGRLIRSEKEYIVLSVIRAIRFLCLGVGYVPHKKNQNTIMTIRGIKLIVALMVHSRNQMIQVEAALTLASVSLGNQAILDDIHSNIDFSYVRILKMMYSMDPDVRLLAGLALATFAYNNVNQQKEIADQGGVRFNCFCPFLQSEDEYYRCLAAFQVVVLARIIPDEEQALSSAAGIKLLVDLLQDSSNNETLSLAADCIARLAHTRAGVPAAMISINVIEHLSKLLVSTAEQVRGSAAIALGYLSYNHTGERQLLNKCRTDPYLMRILLHYTKRSKISPCFLEAWQHYKKVGLPPIPEGR 767          
BLAST of ankyrin and armadillo repeat-containing protein vs. TrEMBL
Match: C3ZBA2 (ANK_REP_REGION domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_118772 PE=4 SV=1)

HSP 1 Score: 533.102 bits (1372), Expect = 4.100e-172
Identity = 277/812 (34.11%), Postives = 487/812 (59.98%), Query Frame = 1
Query:  118 MHQFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNRPFLTTRKEIDLFKDLNEK 2553
            M++ D  GW ++H AAF G++ S+E+ +    ++LE TT D L STPLL A MSGN+E +Q+L+ LGAQI  ++++ HG++E+   +  ++ L YF++ ++    PVW +L+ F+ S +D+E+  A+  + +IL     +G   P ++  + +D V  I+KVI G  G E K ++  VL + I    V++  ++ GG+   + LL+  +   +  ++V + ++   +   +++ +  +G I  + K+ +                    TV+++                D+  +     GN+AE  P ++ ++G  PG  S L  LF +  +++L++ LT  +AK+   +  NQ++++ +   + +I L R ++K+++L A++A+  LA GN   Q  ++++ A  PL+ +L+++ R   V E ++ ALW+LAG   + +  MA ++GV LLI+F+ + S+ L  IG+E + V++ GP S+  +IG  NG+QP+V LLKSD   IV   + ++R LCV  GY+ H  NQ  V   +G+  L+ LM +  +EL+QV+AA T+A V++ N+E  + +  N +F+++++L  +YS N +++LLAG +LAAFA+NN+ +Q++IA+ GG+R      FL S+DEY +C  AFQ+++L+R++PDE+ A S+  GIK L++ L  ++   +Q L CDC+ RL HT+AG+  A++S   V++LC L++S  + V+  AA+A+ YL+F   + RQ+LR+CR  PYL+KV++++ K  KI   F+EGW H K +GLP I     F+T +  I     + E+
Sbjct:    1 MNEVDEQGWGHVHHAAFNGYVKSVERFVTAMEDQLEFTTQDNLHSTPLLCATMSGNIEMIQKLLDLGAQIDYKDNRNHGVVEIAATKNFVETLEYFIK-LNNPKLPVWKNLIKFLSSSEDDEA-EAAGKVLRILTTATQDGPS-PNLEPFVDSDGVLAIVKVITGFVGEEAKVQAFNVLVNIIENDRVKQQVLKGGGIPPSVKLLKSENKALLLPLLVVLKEL--CKDKQYADPVVANGAIPAIVKVCQ--------------------TVNDN----------------DIFVQAIDALGNIAESDPEHRTTVGGTPGLFSTLVNLFEDCTSKALVLSLTMAIAKMVRGDKNNQEKYVNEYGASPLIMLVRVRNKDIQLSAIEALYCLADGNDFAQKAILEEGAVMPLINLLKRT-RAPDVQEMSAMALWALAGDDLNERRSMAGMMGVPLLIEFVTSLSETLHYIGAEGLAVLAQGPHSKATLIGHANGVQPMVRLLKSDKEYIVACAMNAIRYLCVGTGYVPHPKNQATVQQARGIKSLIALMVNSRNELIQVQAALTLACVSLGNKENEEHIAENLDFSFIHVLRLLYSENEQVKLLAGEALAAFAFNNVSQQREIAESGGVRMHNFLSFLESKDEYCRCSGAFQIVVLARIVPDEDQASSSAIGIKLLVDLLEFSQKEQIQALTCDCLARLAHTRAGVPAAIVSINGVELLCRLMMSQTEQVRYCAAVALGYLTFDHTAERQLLRRCREQPYLVKVLLYHTKYGKISKSFLEGWNHCKHIGLPPIPEKPKFITAKDSITYLSSIKEQ 770          
BLAST of ankyrin and armadillo repeat-containing protein vs. TrEMBL
Match: W4ZCR3 (ANK_REP_REGION domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 516.924 bits (1330), Expect = 9.272e-166
Identity = 299/833 (35.89%), Postives = 498/833 (59.78%), Query Frame = 1
Query:  118 MHQFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERI---FHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENEN---RSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFL--QTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKID-LNRPFLTTRKEIDLF---KDLNEKQITLFSNSE 2580
            M+  D NGW +IH AA+ G+I S+EK +    ++LE  TND+   TP+LLAV SG L+TV+ L+KLG+ +  +N+Q  G +E+  L++ ID+L +F+++ D    PVW  L+ F+ S  DEE+  A   +  +L+   L     PY +  +    V  ++KVIK     + K  +  +L + I  +VV+E  ++  G+   L ++   +NPD  R +V     ++   +   E I     +G I  L K+  W              +SS++T                    D+L ++ +    +A  +  YQ +IG   G L+ +  LF EN +   +SLL+ LT+ V+ +  ++ +NQ  F+ +G  +++I+L   K  E++L A+ AI  LA+ N   Q  ++++    PL+ +L++SG +  V+   ++ALW+LAG   D +  MAS+IGV+LLIDFL  Q  +DIL  IG+E + V++ G  +++D I   NG+QPLV LL+S    IVLS IR+LR LC+ +G++ HV NQ  +L  +G+ +LV LM    +ELV+VE+A ++   ++ N E + ++  N +F+Y++IL +++SS+  +RLLAG +LAAFAYNN+ +QK+IA+ GGIR+    PFL S DE+ +C +AFQ+++L+R+IPDE+ A ++  GIK L++ +  +KN  +  L  +C+ RL HT+AG+  A++S   VD+LC L+++  + V+G+AA+A+ YLSF  ++ R++L +CR+DPYL KV+ +Y +  ++   F+E W+HY+ +GLP ID   +P L  +K +      K+ N ++ T+ S+ E
Sbjct:    1 MNDLDDNGWSHIHHAAYHGYIKSIEKFVGASEDQLEFPTNDDKLMTPILLAVDSGKLDTVECLVKLGSDLRYQNTQNQGPVEIAALKQYIDILEFFIKH-DHKELPVWPKLMKFMGSDMDEEAEAAGKML--VLLTKPLEDGLNPYWEPIVQNGGVPVMMKVIKSMVCDKAKLYAFTILLNIIEAKVVKEQIVKAAGIPTALKMI---TNPD--REIVYASSCILCHLSMVKEYIDSMVQNGAIPILVKL--W--------------QSSNDT--------------------DILVQVTETISQIASANAEYQKTIGNSSGALTAVVGLF-ENRSPNSKSLLLALTRAVSNIVQKDEENQNMFVDEGGSSALISLANVKYHELQLSAISAIHMLAQDNPHTQKVILEEGGVIPLMQLLKRSG-SPNVHVCTASALWALAGEDIDERRSMASMIGVNLLIDFLNAQAENDILHYIGAEGLAVLAQGALNKQDTIANANGVQPLVRLLRSPKEHIVLSTIRALRHLCIGIGFIPHVKNQATILGARGIRYLVALMVHSRNELVRVESALSLGYCSIGNAEVMTDISENVDFDYIHILRRLHSSDNLVRLLAGGALAAFAYNNVTQQKEIAESGGIRYHSFVPFLESNDEFFRCNAAFQVVVLARIIPDEDQATTSAIGIKLLVDLIQQSKNPLILALTAECIARLAHTRAGVPAAVVSIQSVDVLCQLMLAENEQVRGSAAIALGYLSFNHKAEREMLNRCRQDPYLFKVLKYYTQNYRLSQAFLEAWKHYQHIGLPPIDTAQKPCLVGKKNMPFLSNIKNPNGRRFTILSSGE 787          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Cavefish
Match: ankar (ankyrin and armadillo repeat containing [Source:ZFIN;Acc:ZDB-GENE-030616-533])

HSP 1 Score: 177.563 bits (449), Expect = 3.444e-46
Identity = 136/491 (27.70%), Postives = 248/491 (50.51%), Query Frame = 1
Query: 1039 PTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNID--IVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQ-LIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFY-NKENKIDPEFMEGWQHYKRVGLPKIDLNR 2499
            P+ Q ++ +  G +S+L   F+   +  L  E+   +A+LA ++ +NQ+     G    ++ + + +    ++ A  AI  +A  N   Q  L QK      LL L K     T  E+ + +LW+LAG T   +  MA++IG   ++D L + SD +Q +G +A+  +S    + + ++ ++NG+ PLV LL+        +LS I +LR LC+ + +  +  +Q ++     +  L+ L+++     V+V+ A T+A + M N++         +F+Y  ++E + S +P+IRL AG +LA FA NN  +Q  I K GG                E+  +AFQ +I+L+ VI   +    T  GI  L+  L   K + V  +    +  L HT+  +++A+++  +V+ L   L S  + V+   A A+ YL+F   + R ++ +CR  P   K++M +  K+ KI   F   ++  ++VGLP + L +
Sbjct:  150 PSNQTAVARAGG-ISQLVE-FLTVNSEVLQEEVCLALAELARDHTENQELICGAGAVQPLVQVLQTRKMSTQVKAARAIEAIAHQNPAIQT-LFQKTHVARYLLQLLKVFHQ-TSREQGAVSLWALAGDTLKQQKYMANVIGYHSILDMLLSSSDKMQYVGCQAVIALSRESCTHQKILCRENGVPPLVRLLRGSRSTERTLLSAICALRTLCIGVAHTNNAKSQAVIYEENAVAALLELLQNRESLQVKVQVAQTLACILMGNQKLQKVFWEKEDFSYDTVVELLQSEDPEIRLEAGHALALFACNNPTQQTAIWKRGGT---------------ERAKAAFQVVIVLANVITGSDKVTLTARGITALVALLQSEKPNTV-VITAQFLATLAHTRT-VSDALVTMRVVEHLTAQLYSKEEEVRTACANALGYLTFNRHAHRILMAECRNTPLKYKLMMNHLAKDGKICSRFTSEFERQRKVGLPSLSLEQ 619          

HSP 2 Score: 56.6102 bits (135), Expect = 1.232e-7
Identity = 79/366 (21.58%), Postives = 163/366 (44.54%), Query Frame = 1
Query: 1177 NQQEFMKDGIEN----SIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNIDIVLSCIRSLRQLCVKLGYLA--HVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTR-LC----HTKAGIANAMI 2241
            N   F KD +E     +++ +  +   +++ +A   + ++ + N+    +L++  A   L+ +L   G+   ++ + +  L  LAGH+   ++ +A L GV+ +++ L +    + L     +  +  G  S +  + +  GI  LV  L + N +++        ++C+ L  LA  H  NQ L+     +  LV ++++      QV+AA  I ++  +N  A+  L   ++    Y+L+ +   +   R     SL A A + L +QK +A   G  +  +   L S  +  + +    +I LSR     +  +    G+  L+  L  +++++   L   C  R LC    HT    + A+I
Sbjct:   23 NTDSFWKDIMEAGGIAALVEILSSGRLKLQCMAAAVLCHMTE-NVAVCEELVRCRAVAVLIKLL--GGQQPEIHSRCAVILADLAGHSGQYQTHIADLGGVEPVVNLLSSDLQDVLLNAVRCVQALCVGCPSNQTAVARAGGISQLVEFL-TVNSEVL------QEEVCLALAELARDHTENQELICGAGAVQPLVQVLQTRKMS-TQVKAARAIEAIAHQN-PAIQTLFQKTHVAR-YLLQLLKVFHQTSREQGAVSLWALAGDTLKQQKYMANVIG--YHSILDMLLSSSDKMQYVGCQAVIALSRESCTHQKILCRENGVPPLVRLLRGSRSTERTLLSAICALRTLCIGVAHTNNAKSQAVI 373          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001760.1 (pep scaffold:Pmarinus_7.0:GL491932:428:5346:1 gene:ENSPMAG00000001593.1 transcript:ENSPMAT00000001760.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.69 bits (535), Expect = 1.065e-60
Identity = 126/376 (33.51%), Postives = 214/376 (56.91%), Query Frame = 1
Query: 1372 NITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNID--IVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAF-QLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIM-FYNKENKIDPEFMEGWQHYKRVGLPKI 2487
             + V E  + ALW+LAG T   ++ +   +G+ L+ID L   SD LQ +G  A+  ++    + ++ I +++G+ PLV LL++       +L+ + +L  LCV + ++    +Q+ V   + +  L+ L+ ++A+  ++VEAA T+A V ++N E  +++     FNY  ILE +   +  +RL AG +LA FAYNN  +Q  +A+ G I    L PFL SE+E+E+  +AF Q+++LS V  D E    T  G+  L+  LS + N D   L  + +  L HT+AG+  AM++ G +++L   L S  D+V+  AA+A+ YLSF  E+ R +L  CR  P L + +M     + +I P+FM  ++  + +GLP +
Sbjct:    6 QLEVREHGALALWALAGGTQHQQAAVVLQVGLRLIIDMLLASSDKLQFVGCHAMAAMAREGRAHQEQICREDGVAPLVRLLRTPRTTERTLLATVSALGALCVGVAHVNTRLSQNKVEEEQAIPELLRLLSTHANPNIKVEAACTLAYVLLKNHEVQEKMMEKDGFNYDVILELLEHPDRAVRLRAGYALAVFAYNNREQQATLAQAGRIAVSDLLPFLESENEHEQAQAAFQQMVVLSGVFRDGEQVPLTAQGLSVLVGLLS-SSNLDSIVLASELLASLAHTRAGLPIAMVTLGAMEMLTEHLFSSADTVREAAAVALGYLSFNREAHRMLLVSCRCRPGLYRQLMSSLGPDARISPDFMADFERQQLIGLPAL 380          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Nematostella
Match: EDO46402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPY8])

HSP 1 Score: 346.665 bits (888), Expect = 9.876e-106
Identity = 242/802 (30.17%), Postives = 419/802 (52.24%), Query Frame = 1
Query:  118 MHQFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLN-GDRFPYIQNCITADIVSTIIKVIKGTQGYE-CKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGV--IVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFL-QTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNID--IVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNRP 2502
            M +FD NGW +IH A+F G+  S+ + I+   ++LEL T D    TP LLA  SG LETVQ L++LGA +   N      I L  L   +++L YFL+  + ++  VW HL+  +   D E +   + C+ ++ ++   N  D F      +  D +  I+ ++K     +  K   L +L +   + + ++   + G +  ++ LL+        R   ++L  L            H+GV  +V L                  +    +E VD                       + +    L++ +   Q  +G     +  L  L  E +++ +L  + + ++ +   +  NQ  F+ +G    +++L + + +E +   V+A+  L + N E+   L+       +L+ L K  R   +    + ALW++AG  +  +  +A+ IGV++LI+FL +     L  IGSEA+ V++ G  ++R+ I + NG+ PLV LL   +    I+LS +R+LR LC+ +G+ AH  NQ  V    G  FLV  M     E+++VE+AYT++ V + N +   E+  + +F+++++L  +Y  + ++ LLAGA+LA FA+NN+  QK IA  GG+R+     FL S+D  +   +AFQ+++LSR+IPDE+ +++   GIK L+  L  +++ D Q L  + +  L HT+AGI  A+IS G V++L  LL+S  ++V+  AA+A+ +LS+     RQ+L  CR +P+L KV+ F+  + K+ P+F+E WQH KR+GLP I +N+P
Sbjct:    1 MDEFDENGWAHIHHASFNGYHKSVSRFIKNKEDQLELETQDGTSCTPFLLACKSGVLETVQLLVELGANLKATNRSLQSGIVLAALYGHLEVLEYFLELKNADI-DVWKHLISGLSGQDIETA--CAKCLAELTLDGHSNRHDDF------VREDGIKAIVVLLKSQAASDDAKMYGLSILLNLTHHALAKDQMSDLG-IPAVIGLLKESKRSLYLR-ATKLLGELANSLKNKEAIASHNGVDALVSL-----------------LQHTGDEEVVDS----------------------VLRTVKTLSDSNSEIQTIVGNNKTSIKALIGLLSEIKSKHVLATVARTISVIVRLHTANQDGFVSEGGIPHLMDLMKLRSRECQFAVVEALHALCEKN-EHNQSLVTDLGSVMMLMRLLKKSRAKDLRTLTAGALWAIAGAKNTQRRSIANEIGVNMLIEFLSENLPQSLHFIGSEALGVLAEGVHNKRNEIAQANGVMPLVRLLAKASTPGYIILSVLRTLRALCICVGFRAHHQNQKAVGDEGGTKFLVRFMVHARQEIIKVESAYTLSCVALGNNDISKEVTEHRDFSFIHVLRLLYDEDEEVALLAGAALAVFAFNNVNNQKAIAMSGGVRYHTFLNFLESKDHRQIAHAAFQVVVLSRIIPDEDQSMTCANGIKLLVSLLD-SQSEDTQTLAANFIGGLAHTRAGIPGAIISIGTVNLLAKLLLSPFETVQAAAAVALGFLSYDKVGERQLLNVCRHEPFLYKVLQFHAGKVKLSPDFVERWQHCKRIGLPPI-INKP 749          
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Nematostella
Match: EDO43577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY53])

HSP 1 Score: 260.381 bits (664), Expect = 2.890e-72
Identity = 225/787 (28.59%), Postives = 375/787 (47.65%), Query Frame = 1
Query:  127 FDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKS--DNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLP 2481
             DS+GW  +H AA+   +  L  LI K  + ++L + DE  STP+LL+  SG L+ V+ LI+L A     N+  +G+I+L  L    ++L YF++  +++  PVW  LV  + S   E    A  C+ ++L   K N     + ++ + A  V  ++ ++K T   + +  +  VL +   ++ VR        + V++ LL  P     +R  V I D+  V  N   E+I   G I  L                                   +G  +SD   H L+  +      +A+   + Q +I  E G L  L +L +   ++ L      C++ LA  +  NQ   +  G   S++ L R+K    ++ A  A+  LA+ N E Q  + + +A KPL+ +L+    +I V E+ + ALW+LAG     +  +AS+IG+++L+D L   S+ LQ I   A+  ++      ++ I    G+ PLV LL++   +  ++L  IR L  LCV + + ++   Q  +   + L  LV L+RS    L+QVE A TI  + + N +    L   + F  + IL  +     ++RL AG +L+ F YNN  +Q  I   GG++    + FL S  +  +  +AFQ+I+L+RVI D +    T  G++ L+  L+ +     + L       L HT+AGI  A+I+ G V  L   L +  + V+ +AA+A+ YLSF   + R +L  CR  P L   ++      KI   F++ W   K VGLP
Sbjct:  526 IDSHGWSPVHYAAYFNHVDCLLHLIHKDTKLVQLQSKDETLSTPILLSASSGALDAVKCLIELNADYTVTNNHDNGMIQLASLHFHTNILEYFIEWNNKD-LPVWDILVGMLKSEHLERQKSAVKCL-EVLSVAKDN-----HWKSILYAGGVPALVTLLK-TDDEDLQGCAASVLCNIGSHEEVRLEVSAADAVVVVIKLLNSPVAMIHSRSAVIIGDLGCVSNN--QEKIAEEGGIEAL-----------------------------------VGLLNSD-VEHVLVNAV-NALRVVADGSKSNQKAIA-ESGALDILISL-LSTRSKKLQANTAACLSSLAKCHHDNQDLIVAKGAVKSLVTLARSKSSVCQVKAASALEALAEKNPEAQKIIDEADAPKPLIRLLKM--WSIEVKEQGAGALWALAGSVRSHQQRIASMIGINILVDMLMLKSERLQYIAGSAMIALATENIENQNKIVAGGGVLPLVRLLRAGKSSQKVLLMVIRVLGILCVGVAHQSNKSTQVEIANAEALVTLVQLLRSSKVPLIQVETAITIGKIALNNNQTQKVLAEQTRFRVIDILHLLKDEEEEVRLKAGRALSIFGYNNTSQQYAIKNAGGVKLASFEEFLESSTQLYRAHAAFQIIVLARVIVDCDQVTLTARGVQLLVSLLA-SDEDHTKILAASLTASLGHTRAGIPAALITAGAVKALLQNLFNANEEVRSSAAVALGYLSFDRTAERLMLVACRNTPGLFDALLRNLGSGKIAMVFVDDWNQTKNVGLP 1260          
BLAST of ankyrin and armadillo repeat-containing protein vs. Planmine SMEST
Match: SMESG000068683.1 (SMESG000068683.1)

HSP 1 Score: 1828.53 bits (4735), Expect = 0.000e+0
Identity = 888/895 (99.22%), Postives = 893/895 (99.78%), Query Frame = 1
Query:  118 MHQFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLKSDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNRPFLTTRKEIDLFKDLNEKQITLFSNSEDNQKIGSLTERHIVTKFPDFRNQSPQLQKIKIEIGEIESLDEDLENSERKELENLQNKMKQVSFYDDGSETLNT 2802
            MHQFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVV+ILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQL+QKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPL+NLLKSDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLV+LTKGLHFLVGLMR+YADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNRPFLTTRKEIDLFKDLNEKQITLFSNSED QKIGSLTERHIVTKFPDFRNQSPQLQKIKIEIGEIESLDEDLENSERKELE LQNKMKQVSFYDDGSETLNT
Sbjct:    1 MHQFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPSNPDIARIVVRILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQLMQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLINLLKSDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVILTKGLHFLVGLMRTYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNRPFLTTRKEIDLFKDLNEKQITLFSNSEDYQKIGSLTERHIVTKFPDFRNQSPQLQKIKIEIGEIESLDEDLENSERKELEKLQNKMKQVSFYDDGSETLNT 895          
BLAST of ankyrin and armadillo repeat-containing protein vs. Planmine SMEST
Match: SMESG000058465.1 (SMESG000058465.1)

HSP 1 Score: 228.794 bits (582), Expect = 2.116e-61
Identity = 201/795 (25.28%), Postives = 387/795 (48.68%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPS---NPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQ-HSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAK-DKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLK--SDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLM-RSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKM-YSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKE--NKIDPEFMEGWQHYKRVGLP 2481
            D +GW  +H AAF   +  L+  + K P+   + T + ++S+P+LLA  SG L++V+ L++LGA +  R+++   II +  L     +L YF+  ++    PVW  +++ +   D     +    +N + I  K + D +  I   + + ++  ++++++     +  K +  VL +    + V+    +   +E+ + + + P       +A I+ QI  I         +++F      DL K  E  + ++EE   N + K     V      + I S  HS+    +L+ E  Q    + E   +Y+N+                 + N +LLI  +  ++ +   N +NQ  F+     + I+ L + + +  +++   +A+ NL   N   +   ++  A   L+ +L+    ++ V E+   +LW+LAG     +  +A  IG  LLI+ + T S+ LQ IG  AI  ++    + +D I ++ GI+PLV LL+  S    ++ + + +L  LC+ + +  +   Q  ++       L+ +  R  AD ++++E  +T+A++T+ ++E  ++   N  F +  +LE M ++ +  I      SLA F +NN I Q  I + GG+     + FL S+D+ E+C +AF ++IL++ I +      T   ++ L   L  T+N  V  L    +  LCHT+AGI +A +S G V+ L  LL S    V+  +++A+ YLSF   + R +LR+CR++  +    +    E  +K+  E +E +Q  +++GLP
Sbjct:  617 DKSGWMPVHCAAFYDQVTILKLFVRKDPDMKNILTRNTIKSSPILLASKSGALDSVKCLMELGADLKYRDAEHRSIIHMAVLATRTQILEYFIH-INIGCLPVWRIVLEMLHHSD---KTYVQQSVNCLEIMTKYSVDHWKSI---LESGLILALVELLQNNDWVDLLKTASAVLCNICHKKEVQNEMQKTKIVEISIQIFQFPDIQLKSQMAFILTQICQI------ESCQQLFS-----DL-KGYESLAAMIEEARINQDIKVLVNGV------KAIDSLCHSNEQNQNLVVEKTQIVSFIIEF-LSYKNN-----------------DLNDTLLIASSLAISSIVTSNTENQNMFIDAKCVDPILKLLKYRANVNVQVAVANALENLCINNNRSREAFLKVEAEISLIHLLKI--WSVEVKEQGLRSLWALAGSHISGQRLIADRIGPGLLIELIMTKSETLQSIGCLAISALTKEVKNAQDRILREGGIEPLVRLLRLSSSTKQVLKNTVETLGVLCIGVAHCNNYAVQTHIVHENAFKDLINIFQRPTADTILKIEIGFTMAALTLNHKE--NQKKMNEEFKFCELLEIMAHTVDKTILSRCLTSLAVFGFNNTINQYTIQQAGGLDCNLFEDFLNSDDKIEQCQAAFNMVILAKDILNSSQVTITAVCVEKLTTNLRSTEN-HVIILSASLIASLCHTRAGIPDAFVSLGTVEYLLGLLDSENAEVRAASSVALGYLSFNGTAARIMLRECRKNFTVFHKFIAEVTEMGSKVSSELIEAYQRAEKIGLP 1363          
BLAST of ankyrin and armadillo repeat-containing protein vs. Planmine SMEST
Match: SMESG000058465.1 (SMESG000058465.1)

HSP 1 Score: 228.409 bits (581), Expect = 2.191e-61
Identity = 201/795 (25.28%), Postives = 387/795 (48.68%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPS---NPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQ-HSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAK-DKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLK--SDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLM-RSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKM-YSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKE--NKIDPEFMEGWQHYKRVGLP 2481
            D +GW  +H AAF   +  L+  + K P+   + T + ++S+P+LLA  SG L++V+ L++LGA +  R+++   II +  L     +L YF+  ++    PVW  +++ +   D     +    +N + I  K + D +  I   + + ++  ++++++     +  K +  VL +    + V+    +   +E+ + + + P       +A I+ QI  I         +++F      DL K  E  + ++EE   N + K     V      + I S  HS+    +L+ E  Q    + E   +Y+N+                 + N +LLI  +  ++ +   N +NQ  F+     + I+ L + + +  +++   +A+ NL   N   +   ++  A   L+ +L+    ++ V E+   +LW+LAG     +  +A  IG  LLI+ + T S+ LQ IG  AI  ++    + +D I ++ GI+PLV LL+  S    ++ + + +L  LC+ + +  +   Q  ++       L+ +  R  AD ++++E  +T+A++T+ ++E  ++   N  F +  +LE M ++ +  I      SLA F +NN I Q  I + GG+     + FL S+D+ E+C +AF ++IL++ I +      T   ++ L   L  T+N  V  L    +  LCHT+AGI +A +S G V+ L  LL S    V+  +++A+ YLSF   + R +LR+CR++  +    +    E  +K+  E +E +Q  +++GLP
Sbjct:  607 DKSGWMPVHCAAFYDQVTILKLFVRKDPDMKNILTRNTIKSSPILLASKSGALDSVKCLMELGADLKYRDAEHRSIIHMAVLATRTQILEYFIH-INIGCLPVWRIVLEMLHHSD---KTYVQQSVNCLEIMTKYSVDHWKSI---LESGLILALVELLQNNDWVDLLKTASAVLCNICHKKEVQNEMQKTKIVEISIQIFQFPDIQLKSQMAFILTQICQI------ESCQQLFS-----DL-KGYESLAAMIEEARINQDIKVLVNGV------KAIDSLCHSNEQNQNLVVEKTQIVSFIIEF-LSYKNN-----------------DLNDTLLIASSLAISSIVTSNTENQNMFIDAKCVDPILKLLKYRANVNVQVAVANALENLCINNNRSREAFLKVEAEISLIHLLKI--WSVEVKEQGLRSLWALAGSHISGQRLIADRIGPGLLIELIMTKSETLQSIGCLAISALTKEVKNAQDRILREGGIEPLVRLLRLSSSTKQVLKNTVETLGVLCIGVAHCNNYAVQTHIVHENAFKDLINIFQRPTADTILKIEIGFTMAALTLNHKE--NQKKMNEEFKFCELLEIMAHTVDKTILSRCLTSLAVFGFNNTINQYTIQQAGGLDCNLFEDFLNSDDKIEQCQAAFNMVILAKDILNSSQVTITAVCVEKLTTNLRSTEN-HVIILSASLIASLCHTRAGIPDAFVSLGTVEYLLGLLDSENAEVRAASSVALGYLSFNGTAARIMLRECRKNFTVFHKFIAEVTEMGSKVSSELIEAYQRAEKIGLP 1353          
BLAST of ankyrin and armadillo repeat-containing protein vs. Planmine SMEST
Match: SMESG000058465.1 (SMESG000058465.1)

HSP 1 Score: 228.409 bits (581), Expect = 2.333e-61
Identity = 201/795 (25.28%), Postives = 387/795 (48.68%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPS---NPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQ-HSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAK-DKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLK--SDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLM-RSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKM-YSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKE--NKIDPEFMEGWQHYKRVGLP 2481
            D +GW  +H AAF   +  L+  + K P+   + T + ++S+P+LLA  SG L++V+ L++LGA +  R+++   II +  L     +L YF+  ++    PVW  +++ +   D     +    +N + I  K + D +  I   + + ++  ++++++     +  K +  VL +    + V+    +   +E+ + + + P       +A I+ QI  I         +++F      DL K  E  + ++EE   N + K     V      + I S  HS+    +L+ E  Q    + E   +Y+N+                 + N +LLI  +  ++ +   N +NQ  F+     + I+ L + + +  +++   +A+ NL   N   +   ++  A   L+ +L+    ++ V E+   +LW+LAG     +  +A  IG  LLI+ + T S+ LQ IG  AI  ++    + +D I ++ GI+PLV LL+  S    ++ + + +L  LC+ + +  +   Q  ++       L+ +  R  AD ++++E  +T+A++T+ ++E  ++   N  F +  +LE M ++ +  I      SLA F +NN I Q  I + GG+     + FL S+D+ E+C +AF ++IL++ I +      T   ++ L   L  T+N  V  L    +  LCHT+AGI +A +S G V+ L  LL S    V+  +++A+ YLSF   + R +LR+CR++  +    +    E  +K+  E +E +Q  +++GLP
Sbjct:  625 DKSGWMPVHCAAFYDQVTILKLFVRKDPDMKNILTRNTIKSSPILLASKSGALDSVKCLMELGADLKYRDAEHRSIIHMAVLATRTQILEYFIH-INIGCLPVWRIVLEMLHHSD---KTYVQQSVNCLEIMTKYSVDHWKSI---LESGLILALVELLQNNDWVDLLKTASAVLCNICHKKEVQNEMQKTKIVEISIQIFQFPDIQLKSQMAFILTQICQI------ESCQQLFS-----DL-KGYESLAAMIEEARINQDIKVLVNGV------KAIDSLCHSNEQNQNLVVEKTQIVSFIIEF-LSYKNN-----------------DLNDTLLIASSLAISSIVTSNTENQNMFIDAKCVDPILKLLKYRANVNVQVAVANALENLCINNNRSREAFLKVEAEISLIHLLKI--WSVEVKEQGLRSLWALAGSHISGQRLIADRIGPGLLIELIMTKSETLQSIGCLAISALTKEVKNAQDRILREGGIEPLVRLLRLSSSTKQVLKNTVETLGVLCIGVAHCNNYAVQTHIVHENAFKDLINIFQRPTADTILKIEIGFTMAALTLNHKE--NQKKMNEEFKFCELLEIMAHTVDKTILSRCLTSLAVFGFNNTINQYTIQQAGGLDCNLFEDFLNSDDKIEQCQAAFNMVILAKDILNSSQVTITAVCVEKLTTNLRSTEN-HVIILSASLIASLCHTRAGIPDAFVSLGTVEYLLGLLDSENAEVRAASSVALGYLSFNGTAARIMLRECRKNFTVFHKFIAEVTEMGSKVSSELIEAYQRAEKIGLP 1371          
BLAST of ankyrin and armadillo repeat-containing protein vs. Planmine SMEST
Match: SMESG000058465.1 (SMESG000058465.1)

HSP 1 Score: 228.409 bits (581), Expect = 2.482e-61
Identity = 201/795 (25.28%), Postives = 387/795 (48.68%), Query Frame = 1
Query:  130 DSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLLAVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNVDENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNCITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEVILPLLRPPS---NPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEWSSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQ-HSDWFTHDLLKEIFQFFGNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANENIKNQQEFMKDGIENSIINLTRAK-DKEMRLVAVDAIINLAKGNIEYQNQLIQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGVDLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLK--SDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLM-RSYADELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKM-YSSNPKIRLLAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQLIILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTKAGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILRKCRRDPYLMKVIMFYNKE--NKIDPEFMEGWQHYKRVGLP 2481
            D +GW  +H AAF   +  L+  + K P+   + T + ++S+P+LLA  SG L++V+ L++LGA +  R+++   II +  L     +L YF+  ++    PVW  +++ +   D     +    +N + I  K + D +  I   + + ++  ++++++     +  K +  VL +    + V+    +   +E+ + + + P       +A I+ QI  I         +++F      DL K  E  + ++EE   N + K     V      + I S  HS+    +L+ E  Q    + E   +Y+N+                 + N +LLI  +  ++ +   N +NQ  F+     + I+ L + + +  +++   +A+ NL   N   +   ++  A   L+ +L+    ++ V E+   +LW+LAG     +  +A  IG  LLI+ + T S+ LQ IG  AI  ++    + +D I ++ GI+PLV LL+  S    ++ + + +L  LC+ + +  +   Q  ++       L+ +  R  AD ++++E  +T+A++T+ ++E  ++   N  F +  +LE M ++ +  I      SLA F +NN I Q  I + GG+     + FL S+D+ E+C +AF ++IL++ I +      T   ++ L   L  T+N  V  L    +  LCHT+AGI +A +S G V+ L  LL S    V+  +++A+ YLSF   + R +LR+CR++  +    +    E  +K+  E +E +Q  +++GLP
Sbjct:  615 DKSGWMPVHCAAFYDQVTILKLFVRKDPDMKNILTRNTIKSSPILLASKSGALDSVKCLMELGADLKYRDAEHRSIIHMAVLATRTQILEYFIH-INIGCLPVWRIVLEMLHHSD---KTYVQQSVNCLEIMTKYSVDHWKSI---LESGLILALVELLQNNDWVDLLKTASAVLCNICHKKEVQNEMQKTKIVEISIQIFQFPDIQLKSQMAFILTQICQI------ESCQQLFS-----DL-KGYESLAAMIEEARINQDIKVLVNGV------KAIDSLCHSNEQNQNLVVEKTQIVSFIIEF-LSYKNN-----------------DLNDTLLIASSLAISSIVTSNTENQNMFIDAKCVDPILKLLKYRANVNVQVAVANALENLCINNNRSREAFLKVEAEISLIHLLKI--WSVEVKEQGLRSLWALAGSHISGQRLIADRIGPGLLIELIMTKSETLQSIGCLAISALTKEVKNAQDRILREGGIEPLVRLLRLSSSTKQVLKNTVETLGVLCIGVAHCNNYAVQTHIVHENAFKDLINIFQRPTADTILKIEIGFTMAALTLNHKE--NQKKMNEEFKFCELLEIMAHTVDKTILSRCLTSLAVFGFNNTINQYTIQQAGGLDCNLFEDFLNSDDKIEQCQAAFNMVILAKDILNSSQVTITAVCVEKLTTNLRSTEN-HVIILSASLIASLCHTRAGIPDAFVSLGTVEYLLGLLDSENAEVRAASSVALGYLSFNGTAARIMLRECRKNFTVFHKFIAEVTEMGSKVSSELIEAYQRAEKIGLP 1361          
The following BLAST results are available for this feature:
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ANKAR1.238e-5328.03ankyrin and armadillo repeat containing [Source:HG... [more]
ANKAR1.238e-5328.03ankyrin and armadillo repeat containing [Source:HG... [more]
ANKAR3.138e-1428.64ankyrin and armadillo repeat containing [Source:HG... [more]
ANKAR1.420e-1327.11ankyrin and armadillo repeat containing [Source:HG... [more]
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ankar1.730e-7226.42ankyrin and armadillo repeat containing [Source:ZF... [more]
ankar7.411e-5627.81ankyrin and armadillo repeat containing [Source:ZF... [more]
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gsg1lr1.057e-7026.65GSG1-like related [Source:Xenbase;Acc:XB-GENE-5832... [more]
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ankar5.213e-6926.34ankyrin and armadillo repeat containing [Source:MG... [more]
Ankar6.305e-6926.34ankyrin and armadillo repeat containing [Source:MG... [more]
Ankar7.842e-6926.34ankyrin and armadillo repeat containing [Source:MG... [more]
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|A2RT91|ANKAR_MOUSE3.647e-6826.34Ankyrin and armadillo repeat-containing protein OS... [more]
sp|Q7Z5J8|ANKAR_HUMAN5.945e-5328.03Ankyrin and armadillo repeat-containing protein OS... [more]
sp|Q4I1B1|VAC8_GIBZE4.938e-724.14Vacuolar protein 8 OS=Gibberella zeae (strain PH-1... [more]
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JCJ70.000e+039.29ankyrin and armadillo repeat-containing protein OS... [more]
A0A1S3KBH80.000e+039.22ankyrin and armadillo repeat-containing protein-li... [more]
K1QD732.447e-17236.87Ankyrin and armadillo repeat-containing protein OS... [more]
C3ZBA24.100e-17234.11ANK_REP_REGION domain-containing protein OS=Branch... [more]
W4ZCR39.272e-16635.89ANK_REP_REGION domain-containing protein OS=Strong... [more]
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ankar3.444e-4627.70ankyrin and armadillo repeat containing [Source:ZF... [more]
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001760.11.065e-6033.51pep scaffold:Pmarinus_7.0:GL491932:428:5346:1 gene... [more]
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO464029.876e-10630.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435772.890e-7228.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ankyrin and armadillo repeat-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068683.10.000e+099.22SMESG000068683.1[more]
SMESG000058465.12.116e-6125.28SMESG000058465.1[more]
SMESG000058465.12.191e-6125.28SMESG000058465.1[more]
SMESG000058465.12.333e-6125.28SMESG000058465.1[more]
SMESG000058465.12.482e-6125.28SMESG000058465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000192 ID=SMED30000192|Name=ankyrin and armadillo repeat-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2855bp
ACGAAACATAATCACTGAAAATTTGAATTTTAATCTTGGTATTAAATTTA
AGTAGGACGTGTGAAAAGTAAGCCAAAATACGCGAGTTTTGGTGATATTG
CTTGGAAAGTTAGAACAATGCATCAATTTGATTCAAATGGCTGGGATAAT
ATACATTCAGCAGCTTTCAAAGGATTCATTCCGTCGTTAGAGAAATTAAT
TGAAAAACATCCTGAAAAACTAGAACTGACAACCAATGATGAATTGCGTT
CTACACCGCTGCTTCTGGCAGTAATGTCTGGAAATTTAGAAACAGTTCAG
GAACTAATTAAACTTGGAGCTCAGATCCACACAAGGAATTCTCAAGGTCA
TGGAATTATTGAACTCACTTGCCTTCGAAAAGATATTGATATGTTAAATT
ATTTCCTACAAAATGTTGATGAGAATGTTTTCCCAGTATGGGTTCATTTG
GTGGATTTCGTGGATTCAATTGATGATGAAGAGAGCATTCACGCAAGCTC
CTGCATCAATCAAATTCTTATTAATAATAAATTGAATGGTGACAGGTTTC
CATATATACAGAACTGTATTACCGCTGATATTGTTTCGACTATTATAAAG
GTAATTAAAGGAACACAAGGATATGAATGCAAAAAAGAAAGCCTCAAAGT
ATTAACTCATTTTATCGTGTATCAAGTTGTTCGAGAAAGCTTCATTGAAA
AGGGCGGCTTAGAAGTTATATTGCCTTTATTAAGGCCACCAAGCAATCCA
GATATTGCAAGAATTGTTGTCCAAATTTTAGATATCTTGATAGTTGAGCC
TAATGGATTTTCTGAAAGAATATTTCATTCAGGGGTTATTGTAGATTTGA
ACAAAATTTTAGAATGGTCATCTGTGGTTGTTGAGGAAAAATATCAAAAT
TTCGAAACTAAATCTTCGGATGAAACCGTTGACGAGGACTATGATTCGCA
ACCTATTGGTTCGCAGCATTCAGATTGGTTCACACATGATTTACTCAAAG
AAATTTTTCAATTTTTTGGAAATCTAGCAGAAATACATCCGACATATCAG
AATAGTATTGGCAAAGAACCAGGCTGTTTATCAAGGTTGAGTACTCTGTT
CATGGAAAATGAGAACCGATCTCTATTAATTGAATTAACAAAATGTGTTG
CCAAATTGGCTAATGAGAACATAAAGAACCAACAAGAATTTATGAAAGAT
GGCATTGAAAATTCAATCATTAATTTAACTCGAGCCAAAGATAAAGAGAT
GCGATTGGTCGCTGTAGATGCGATTATAAATTTAGCCAAGGGAAATATTG
AATATCAAAATCAGTTGATACAAAAAAATGCTCATAAACCACTTTTACTA
ATGTTGAGAAAATCTGGTAGAAATATCACTGTAAATGAAAAAGCTTCGAC
GGCTCTTTGGTCATTGGCTGGCCACACCAGTGACAGCAAATCAGAAATGG
CCAGTTTGATTGGAGTCGATTTGTTGATAGATTTCTTGCAAACCCCGTCA
GATATTCTTCAATTAATTGGTTCTGAAGCTATCTTTGTAATAAGTGGCGG
TCCGACTAGTCAGAGAGACGTGATTGGAAAGAAAAATGGAATCCAACCAC
TCGTAAATTTACTGAAGTCTGATAACATAGATATCGTTTTGAGCTGTATT
CGATCTTTAAGACAGTTATGCGTGAAACTCGGATATCTGGCGCATGTGTG
GAATCAGCATTTGGTTCTTTTAACAAAGGGTCTTCATTTTCTTGTTGGGT
TAATGAGGTCTTATGCCGATGAACTTGTGCAAGTTGAGGCTGCTTATACG
ATCGCTTCGGTTACAATGCGTAACGAAGAAGCATTGGATGAACTCCATAC
CAATTCAAATTTCAATTATGTATATATTTTAGAAAAAATGTACAGTTCAA
ATCCAAAAATCAGATTACTTGCTGGTGCATCTTTAGCTGCGTTTGCGTAC
AATAATTTAATAGAACAAAAGAAAATCGCTAAGTTTGGCGGAATTCGTTT
TAAATGCTTACAGCCGTTTTTATTTTCCGAAGATGAATATGAAAAATGCA
TGAGTGCTTTTCAATTAATAATTCTTTCTCGAGTGATTCCAGATGAAGAA
TTAGCGGTGAGTACAGGGTTTGGGATTAAAACCCTTATTGAAACACTTTC
ACTGACAAAAAACTCGGATGTACAAGAATTAGGTTGTGATTGTGTTACTA
GATTATGTCATACCAAAGCAGGCATAGCAAATGCCATGATCAGTTTTGGA
ATTGTAGATATTCTTTGTACTCTCTTGGTAAGTTATGTAGATTCCGTGAA
AGGAACTGCAGCGCTAGCAGTAAAGTATTTGTCATTTTTCCCCGAGTCCA
GGCGTCAGATTTTACGGAAGTGTCGACGTGATCCATATTTGATGAAAGTA
ATTATGTTTTATAATAAAGAAAATAAAATTGATCCGGAGTTCATGGAAGG
TTGGCAGCACTACAAACGAGTTGGTCTTCCAAAAATTGACTTAAATCGCC
CATTTTTAACAACAAGAAAAGAAATCGATTTATTCAAGGATTTGAATGAG
AAGCAAATTACCTTATTTAGTAATTCTGAAGATAATCAAAAAATCGGATC
ATTAACCGAGCGGCACATTGTTACGAAATTCCCCGACTTTAGAAACCAGT
CACCACAATTGCAGAAAATTAAAATAGAAATTGGAGAAATCGAGTCGCTT
GATGAAGATTTAGAAAATTCAGAAAGGAAGGAGCTTGAAAATCTCCAAAA
CAAAATGAAACAGGTATCATTTTACGATGACGGAAGTGAAACCTTGAATA
CTTGAAATTATTTTATAATCTAGATAACTATGTTAAAGGATTATGACTAC
ATATT
back to top

protein sequence of SMED30000192-orf-1

>SMED30000192-orf-1 ID=SMED30000192-orf-1|Name=SMED30000192-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=896bp
MHQFDSNGWDNIHSAAFKGFIPSLEKLIEKHPEKLELTTNDELRSTPLLL
AVMSGNLETVQELIKLGAQIHTRNSQGHGIIELTCLRKDIDMLNYFLQNV
DENVFPVWVHLVDFVDSIDDEESIHASSCINQILINNKLNGDRFPYIQNC
ITADIVSTIIKVIKGTQGYECKKESLKVLTHFIVYQVVRESFIEKGGLEV
ILPLLRPPSNPDIARIVVQILDILIVEPNGFSERIFHSGVIVDLNKILEW
SSVVVEEKYQNFETKSSDETVDEDYDSQPIGSQHSDWFTHDLLKEIFQFF
GNLAEIHPTYQNSIGKEPGCLSRLSTLFMENENRSLLIELTKCVAKLANE
NIKNQQEFMKDGIENSIINLTRAKDKEMRLVAVDAIINLAKGNIEYQNQL
IQKNAHKPLLLMLRKSGRNITVNEKASTALWSLAGHTSDSKSEMASLIGV
DLLIDFLQTPSDILQLIGSEAIFVISGGPTSQRDVIGKKNGIQPLVNLLK
SDNIDIVLSCIRSLRQLCVKLGYLAHVWNQHLVLLTKGLHFLVGLMRSYA
DELVQVEAAYTIASVTMRNEEALDELHTNSNFNYVYILEKMYSSNPKIRL
LAGASLAAFAYNNLIEQKKIAKFGGIRFKCLQPFLFSEDEYEKCMSAFQL
IILSRVIPDEELAVSTGFGIKTLIETLSLTKNSDVQELGCDCVTRLCHTK
AGIANAMISFGIVDILCTLLVSYVDSVKGTAALAVKYLSFFPESRRQILR
KCRRDPYLMKVIMFYNKENKIDPEFMEGWQHYKRVGLPKIDLNRPFLTTR
KEIDLFKDLNEKQITLFSNSEDNQKIGSLTERHIVTKFPDFRNQSPQLQK
IKIEIGEIESLDEDLENSERKELENLQNKMKQVSFYDDGSETLNT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR000225Armadillo
IPR002110Ankyrin_rpt
IPR011989ARM-like
IPR020683Ankyrin_rpt-contain_dom
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 873..900
NoneNo IPR availablePANTHERPTHR46464FAMILY NOT NAMEDcoord: 23..817
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 98..128
e-value: 2200.0
score: 2.4
coord: 29..59
e-value: 880.0
score: 5.4
coord: 65..94
e-value: 0.021
score: 24.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 65..97
score: 11.114
IPR000225ArmadilloSMARTSM00185arm_5coord: 207..248
e-value: 51.0
score: 7.8
coord: 415..457
e-value: 450.0
score: 0.4
coord: 501..541
e-value: 0.68
score: 19.0
coord: 677..720
e-value: 190.0
score: 3.4
coord: 722..762
e-value: 8.2
score: 13.9
coord: 459..499
e-value: 300.0
score: 1.8
coord: 547..589
e-value: 400.0
score: 0.8
IPR000225ArmadilloPFAMPF00514Armcoord: 504..540
e-value: 2.3E-4
score: 21.1
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 512..539
score: 8.522
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 22..125
e-value: 1.3E-13
score: 52.7
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 22..121
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 544..790
e-value: 2.4E-16
score: 61.4
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 29..121
score: 14.875
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 573..774
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 113..546