Transient receptor potential cation channel subfamily M member 3

Overview
NameTransient receptor potential cation channel subfamily M member 3
Smed IDSMED30000186
Length (bp)3387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member 3 (SMED30000186) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 3 (SMED30000186) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member 3 (SMED30000186) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 3 (SMED30000186) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000186

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30000186h1SMcG0022037 dd_Smed_v4_7784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000186h1SMcG0022037 dd_Smed_v4_7784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gonoporeSMED30000186h1SMcG0001379 Contig1577uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
gonoporeSMED30000186h1SMcG0001379 Contig1577newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30000186h1SMcG0001379 Contig1577uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30000186h1SMcG0001379 Contig1577newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
gonoporeSMED30000186h1SMcG0022037 Contig1577uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
gonoporeSMED30000186h1SMcG0022037 Contig1577newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30000186h1SMcG0022037 Contig1577uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30000186h1SMcG0022037 Contig1577newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 163.31 bits (412), Expect = 2.149e-67
Identity = 148/586 (25.26%), Postives = 264/586 (45.05%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFV--HDLFDKSMKLDRKIVEAVISSIDDND------LEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYL-LYPVRRIINMMSGNILQNENIHPKPG-----RQLIRTDEENFEFQSQSFIEVHSKK-------ITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII-DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVD 2708
            +K Q+I+R      R Q+     +  D    +D  I++A++ +    D       +  LK+ + +N  DIA  ++F+  D        LH      L +N+ EFVKLFLEN   +++F+T + L  LY +   + PS   +  +  +   D    +    +  L ++ V +++  + G+  Q   ++P+P      R L+         Q  S   ++ +        + P +DL +WA++    ELA I W   ++ I +AL  S IL ++           +  ML+ A ++++  AI V TE + K +E    LL R  + W   TCLQ+A+    ++F+S     +++ K+W G+LS    +W++ + +    +L+  LI         S R     +  TP                             + F+  P+V F ++++SY  FL +F Y+    L ++ +    W E  I+ ++  ++ EE+RQ+  D +  G + K   Y S  WN  D+  IL+++    L C L        R   S+   + CLR+M  + IS TLGPK+I++ RM+ D
Sbjct:  404 KKIQDIVR------RRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFM--DEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYEN---LDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQP--LYPRPRHNDRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEED--TDSSEEMLALA-EEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLI---------SFREKRLQDVGTPAA-------------------------RARAFFTAPVVVFHLNILSYFAFLCLFAYV----LMVDFQPVPSWCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAG--LTCRLIPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKD 933          

HSP 2 Score: 115.161 bits (287), Expect = 2.149e-67
Identity = 82/293 (27.99%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  128 TCKCGNIKTDHQDFPIKDEI-----WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN--DNGNV------VQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 955
             C+CG     H +   K        W  + + +    D FG I FTG +  +      ++R + +D P    V+Y LM  +W    P L+ISVTGG K  N     +    +  L++V +    WII GG + G+   + EAV ++    +    ++  +G+ TWG +   + L +     P  +   +  +G +  LDS+   F+  DDGT  QY  E   R + EK + E   + G V      V ++ EGG   L +  N+     P V+++ SGR ADVI  + +L ++
Sbjct:   88 VCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQEMPTDAFGDIVFTGLSQKVKK----YVRVS-QDTPS--SVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVS 372          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 163.31 bits (412), Expect = 2.149e-67
Identity = 148/586 (25.26%), Postives = 264/586 (45.05%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFV--HDLFDKSMKLDRKIVEAVISSIDDND------LEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYL-LYPVRRIINMMSGNILQNENIHPKPG-----RQLIRTDEENFEFQSQSFIEVHSKK-------ITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII-DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVD 2708
            +K Q+I+R      R Q+     +  D    +D  I++A++ +    D       +  LK+ + +N  DIA  ++F+  D        LH      L +N+ EFVKLFLEN   +++F+T + L  LY +   + PS   +  +  +   D    +    +  L ++ V +++  + G+  Q   ++P+P      R L+         Q  S   ++ +        + P +DL +WA++    ELA I W   ++ I +AL  S IL ++           +  ML+ A ++++  AI V TE + K +E    LL R  + W   TCLQ+A+    ++F+S     +++ K+W G+LS    +W++ + +    +L+  LI         S R     +  TP                             + F+  P+V F ++++SY  FL +F Y+    L ++ +    W E  I+ ++  ++ EE+RQ+  D +  G + K   Y S  WN  D+  IL+++    L C L        R   S+   + CLR+M  + IS TLGPK+I++ RM+ D
Sbjct:  404 KKIQDIVR------RRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFM--DEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYEN---LDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQP--LYPRPRHNDRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEED--TDSSEEMLALA-EEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLI---------SFREKRLQDVGTPAA-------------------------RARAFFTAPVVVFHLNILSYFAFLCLFAYV----LMVDFQPVPSWCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAG--LTCRLIPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKD 933          

HSP 2 Score: 115.161 bits (287), Expect = 2.149e-67
Identity = 82/293 (27.99%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  128 TCKCGNIKTDHQDFPIKDEI-----WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN--DNGNV------VQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 955
             C+CG     H +   K        W  + + +    D FG I FTG +  +      ++R + +D P    V+Y LM  +W    P L+ISVTGG K  N     +    +  L++V +    WII GG + G+   + EAV ++    +    ++  +G+ TWG +   + L +     P  +   +  +G +  LDS+   F+  DDGT  QY  E   R + EK + E   + G V      V ++ EGG   L +  N+     P V+++ SGR ADVI  + +L ++
Sbjct:   88 VCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQEMPTDAFGDIVFTGLSQKVKK----YVRVS-QDTPS--SVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVS 372          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 162.925 bits (411), Expect = 2.184e-67
Identity = 148/586 (25.26%), Postives = 264/586 (45.05%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFV--HDLFDKSMKLDRKIVEAVISSIDDND------LEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYL-LYPVRRIINMMSGNILQNENIHPKPG-----RQLIRTDEENFEFQSQSFIEVHSKK-------ITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII-DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVD 2708
            +K Q+I+R      R Q+     +  D    +D  I++A++ +    D       +  LK+ + +N  DIA  ++F+  D        LH      L +N+ EFVKLFLEN   +++F+T + L  LY +   + PS   +  +  +   D    +    +  L ++ V +++  + G+  Q   ++P+P      R L+         Q  S   ++ +        + P +DL +WA++    ELA I W   ++ I +AL  S IL ++           +  ML+ A ++++  AI V TE + K +E    LL R  + W   TCLQ+A+    ++F+S     +++ K+W G+LS    +W++ + +    +L+  LI         S R     +  TP                             + F+  P+V F ++++SY  FL +F Y+    L ++ +    W E  I+ ++  ++ EE+RQ+  D +  G + K   Y S  WN  D+  IL+++    L C L        R   S+   + CLR+M  + IS TLGPK+I++ RM+ D
Sbjct:  404 KKIQDIVR------RRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFM--DEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYEN---LDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQP--LYPRPRHNDRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEED--TDSSEEMLALA-EEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLI---------SFREKRLQDVGTPAA-------------------------RARAFFTAPVVVFHLNILSYFAFLCLFAYV----LMVDFQPVPSWCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAG--LTCRLIPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKD 933          

HSP 2 Score: 115.546 bits (288), Expect = 2.184e-67
Identity = 82/292 (28.08%), Postives = 134/292 (45.89%), Query Frame = 2
Query:  131 CKCGNIKTDHQDFPIKDEI-----WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN--DNGNV------VQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 955
            C+CG     H +   K        W  + + +    D FG I FTG +  +      ++R + +D P    V+Y LM  +W    P L+ISVTGG K  N     +    +  L++V +    WII GG + G+   + EAV ++    +    ++  +G+ TWG +   + L +     P  +   +  +G +  LDS+   F+  DDGT  QY  E   R + EK + E   + G V      V ++ EGG   L +  N+     P V+++ SGR ADVI  + +L ++
Sbjct:   89 CQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQEMPTDAFGDIVFTGLSQKVKK----YVRVS-QDTPS--SVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVS 372          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Human
Match: TRPM2 (transient receptor potential cation channel subfamily M member 2 [Source:HGNC Symbol;Acc:HGNC:12339])

HSP 1 Score: 161.77 bits (408), Expect = 6.214e-67
Identity = 161/635 (25.35%), Postives = 288/635 (45.35%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFV--HDLFDKSMKLDRKIVEAVISSIDDND------LEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPG-----RQLIRTDEENFEFQSQSFIEVHSKK-------ITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII-DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGEL 2858
            +K Q+I+R      R Q+     +  D    +D  I++A++ +    D       +  LK+ + +N  DIA  ++F+  D        LH      L +N+ EFVKLFLEN   +++F+T + L  LY +   + PS C +                   SK  ++ V +++  + G+  Q   ++P+P      R L+         Q  S   ++ +        + P +DL +WA++    ELA I W   ++ I +AL  S IL ++           +  ML+ A ++++  AI V TE + K +E    LL R  + W   TCLQ+A+    ++F+S     +++ K+W G+LS    +W++ + +    +L+  LI         S R     +  TP                             + F+  P+V F ++++SY  FL +F Y+    L ++ +    W E  I+ ++  ++ EE+RQ+  D +  G + K   Y S  WN  D+  IL+++    L C L        R   S+   + CLR+M  + IS TLGPK+I++ RM+ D+FFFL + +++++S+G    A+  +  R ++  L     Y  Y   +G++
Sbjct:  404 KKIQDIVR------RRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFM--DEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYEN---LDPS-CLF------------------HSKLQMHHVAQVLRELLGDFTQP--LYPRPRHNDRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEED--TDSSEEMLALA-EEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLI---------SFREKRLQDVGTPAA-------------------------RARAFFTAPVVVFHLNILSYFAFLCLFAYV----LMVDFQPVPSWCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAG--LTCRLIPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNERRVDW-LFRGAVYHSYLTIFGQI 962          

HSP 2 Score: 115.161 bits (287), Expect = 6.214e-67
Identity = 82/293 (27.99%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  128 TCKCGNIKTDHQDFPIKDEI-----WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN--DNGNV------VQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 955
             C+CG     H +   K        W  + + +    D FG I FTG +  +      ++R + +D P    V+Y LM  +W    P L+ISVTGG K  N     +    +  L++V +    WII GG + G+   + EAV ++    +    ++  +G+ TWG +   + L +     P  +   +  +G +  LDS+   F+  DDGT  QY  E   R + EK + E   + G V      V ++ EGG   L +  N+     P V+++ SGR ADVI  + +L ++
Sbjct:   88 VCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQEMPTDAFGDIVFTGLSQKVKK----YVRVS-QDTPS--SVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVS 372          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Human
Match: TRPM6 (transient receptor potential cation channel subfamily M member 6 [Source:HGNC Symbol;Acc:HGNC:17995])

HSP 1 Score: 156.377 bits (394), Expect = 8.214e-61
Identity = 167/691 (24.17%), Postives = 302/691 (43.70%), Query Frame = 3
Query:  987 QSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDL-FDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN----------HSLYVKPSR----CGY--------LLVDFIATTDKNFDSKRKKSKYL---LYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQ-----------------DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPS-------------------VNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
            Q+T N   K  +   +IL E    +R+ I + D   ++   LD  I+ A++   + +  E+ L + + ++  DIA+K + +    Q      L +     L  ++++FVKL +E   ++  FLT   L  LYN          H L     +     GY        L+V+++       +  RK  + L   LY   +     SGN  +NE+       Q IRT +  ++F+ +S +   S+K + +                 DL +WA+L +  ++A+ FW+ GEE    A+IA I+   M    ++     D S  L   SK+F ++A+ ++ +A  + +    TLL   L+ W+N TCL++A+SG L  F+S +     +  +W G L      W  +I        I  L   S                    +Q   S + + S +    E  ++      +H+        +P+   +  FY  PIVKF  + ++Y+ FL++F Y  LVE++    +Q     I+IF   +    E +R+I   E      K+K ++S  WN+ +   I ++   F LR +         R  Y + +     R++ ++ ++   GP V MI +M  ++F+ + I ++ ++S+G    A+   +    + SL  +I + PY+  YGE+   E
Sbjct:  352 QNTFNFSLKQSKHLFQILMECM-VHRDCITIFDADSEEQQDLDLAILTALLKGTNLSASEQ-LNLAMAWDRVDIAKKHILIYE--QHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTNTLLHHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLYRKYKHQRHSSGN--RNESAESTLHSQFIRTAQP-YKFKEKSIVLHKSRKKSKEQNVSDDPESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPPTILTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVKEYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYEFYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQPQPSVQEWLVSIYIFTNAI----EVVREICISEPGKFTQKVKVWISEYWNLTETVAIGLFSAGFVLR-WGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPK-EPPSWSLARDIVFEPYWMIYGEVYAGE 1029          

HSP 2 Score: 100.138 bits (248), Expect = 8.214e-61
Identity = 76/285 (26.67%), Postives = 128/285 (44.91%), Query Frame = 2
Query:  131 CKCGNIKTDHQDFPI----------KDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPT--YHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV-------RENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVI 928
            C CG +  DH               + E WS+E +T     DTFG INF    D    H+  +IR + +     ++ +  LM+  W    P+L+ISV GG++     +  ++   +  L++  +    WII  G N G+   + +A+   +S  ++S  ++  +GI  WG I N + L  ++    Y            L+S    F+  DDGT  +Y  E   R   EK +       R      VV ++ EGG   + S + ++K   P+V+ + +GRAAD++
Sbjct:   52 CYCGRLIGDHAGIDYSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINF---QDGEHTHHAKYIRTSYDTK---LDHLLHLMLKEWKMELPKLVISVHGGIQNFTMPSKFKEIFSQ-GLVKAAETTGAWIITEGINTGVSKHVGDAL---KSHSSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDGTVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLL 326          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Celegans
Match: gtl-1 (GTL-1; Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:G5ECM4])

HSP 1 Score: 92.0485 bits (227), Expect = 2.004e-39
Identity = 66/256 (25.78%), Postives = 127/256 (49.61%), Query Frame = 2
Query:  188 WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKT---EKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGN----VVQILYEGGSRALESAYNSLK--ASIPLVLIKNSGRAADVI 928
            WS++++T+    D +G I F G     T H+  + R + +  P   ++V+ LM+  W    P+LII++ GGL +      +  + F++ ++++ K    WII  G + G+   +  A++++ +    S N V  +GI +WG +        ++ T  +        + K L D+H   FLF D+GT  +Y  E   R + E  + + D       +V ++ EGG+  ++  ++ +     IP+++   SGRAAD++
Sbjct:  182 WSIQSHTEIVPTDAYGNIVFEG-----TAHHAQYARISFDSDPR--DIVH-LMMKVWKLKPPKLIITINGGLTKF-DLQPKLARTFRKGIMKIAKSTDAWIITSGLDEGVVKHLDSALHDHGNH--TSKNHVVAIGIASWGMLKQRSRFVGKDSTVTYATNVFNNTRLKELNDNHS-YFLFSDNGTVNRYGAEIIMRKRLEAYLAQGDKKRSAIPLVCVVLEGGAFTIKMVHDYVTTIPRIPVIVCDGSGRAADIL 425          

HSP 2 Score: 91.2781 bits (225), Expect = 2.004e-39
Identity = 95/395 (24.05%), Postives = 168/395 (42.53%), Query Frame = 3
Query: 1014 DIEKFQEILREIYEKYRNQ--IFVHDLFDKSMK-LDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN----------------HSLYVKPSRCGYLLVDFIATTDK-NFDSKRKKSKYLLYPVRRIIN---MMSGNILQNENIHPKP-----------------------------GRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIAS---IILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGEL 2033
            D +  Q+++++I E   N+  + +  L + S + LD  I+  ++   + +  E+ L++ + +N  DIA  ++F N        + LH      L N++I+FV L LEN  S++ FLT   L  LYN                   ++K    G L+ + +    K N+  +  K++Y L+  R+        + N  +N+ I P                               GR+    DE++F    +      + +    DL +WA+LT+  ++A + W  GEE +  AL+AS   + L K   L    G    S   +  S +F E+A+ V+       ++ T  LL   L  W + TCL +A +    +FL+   C   +  +W+G L
Sbjct:  457 DPKTAQKLIKQIVECSTNKSLMTIFRLGESSREDLDHVIMSCLLKGQNLSPPEQ-LQLALAWNRADIARTEIFANG--TEWTTQDLHNAMIEALSNDRIDFVHLLLENGVSMQKFLTYGRLEHLYNTDKGPQNTLRTNLLVDSKHHIKLVEVGRLVENLMGNLYKSNYTKEEFKNQYFLFNNRKQFGKRVHSNSNGGRNDVIGPSGDAGRERMSSMQISLINNARNSIISLFNGGGRKRESDDEDDFSNLEEEANMDFTFRYPYSDLMIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLAT--GEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQTLRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGL 846          

HSP 3 Score: 51.2174 bits (121), Expect = 5.108e-6
Identity = 51/222 (22.97%), Postives = 103/222 (46.40%), Query Frame = 3
Query: 2238 IPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQ---ERTGSIYK-LKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIAL----QDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHT 2879
            + +K  I  FY+ PI  + +   +++ FL++  Y  LV+ +   +I + W+E ++F Y+     E  R+++     + +  + K L+ +     N     G+L Y+I +F+R  LS     + R        +  L+++ Y  +   LGP + ++  MI  +     +  + + ++G L  ++    +D      +  L+  IF +PYF  YGE+   E  T
Sbjct: 1064 LSWKKKIMEFYKAPITTYWLWFFAFIWFLILLTYNLLVKTQ---RIAS-WSEWYVFAYIFVWTLEIGRKVVSTIMMDTSKPVLKQLRVFFFQYRNGLLAFGLLTYLIAYFIR--LSPTTKTLGRILIICNSVIWSLKLVDYLSVQQGLGPYINIVAEMIPTMIPLCVLVFITLYAFGLLRQSITYPYED-----WHWILVRNIFLQPYFMLYGEVYAAEIDT 1274          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Celegans
Match: gtl-2 (Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:Q20766])

HSP 1 Score: 121.709 bits (304), Expect = 1.450e-27
Identity = 147/641 (22.93%), Postives = 260/641 (40.56%), Query Frame = 3
Query: 1170 LKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN-------HSL------YVKPSRCGYLLVDFIATTDKN---------FDSKRKKSKYLLYPVRRIINMMS-----GNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDT--SAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGEL------------SPFLPMWXXXXXXXXXXXXXXXLI-------MPSVNQPTQSERSNESAESQTPEFMYEA------------------NSPFKRHYSQS-----KKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHT 2879
            L +T+ +N  D+A+  +F N   +  +  +L +     L  ++++FV+  LEN  S+++FL+   L  LYN       HS+      +       YL +  I    +          + S+  K KY  Y   + IN  S       I+Q E    K   Q+   +EE+F F +  F           DL +WA+LT    +A   W  GE+ +   L+A I L K    I +  Y D   +  L   + K +E AI ++ + +    + T  LL   L  W N  CL +A+  N   FL+   C   + ++W G L            +   P   + ++          L+       +P   +   S  SN    S+ PE   E                   NS     Y  +     K++  +   +  + FY  PI KF    I++++FL     + L+E  L    +    E   F Y + +  E IR+++  E +    K+K + +  +NI+    +L +++ +  R  +        R   S +  +  ++I +Y  + P LGP + M  +M+  + +   +  + ++++G    AL +   +  +  L+  IFY+PYF  YGE+   E  T
Sbjct:  473 LALTLSWNRVDLAKSCLFSNG--RKWSSDVLEKAMNDALYWDRVDFVECLLENGVSMKNFLSINRLENLYNMDDINSAHSVRNWMENFDSMDPHTYLTIPMIGQVVEKLMGNAFQLYYTSRSFKGKYDRY---KRINQSSYFHRKRKIVQKELFKKKSDDQINDNEEEDFSF-AYPF----------NDLLIWAVLTSRHGMAECMWVHGEDAMAKCLLA-IRLYKATAKIAEDEYLDVEEAKRLFDNAVKCREDAIELLDQCYRADHDRTLRLLRMELPHWGNNNCLSLAVLANTKTFLAHPCCQILLAELWHGSLKVRSGSNVRVLTALICPPAILFMAYKPKHSKTARLLSEETPEQLPYPRESITSTTSNRYRYSKGPEEQKETLLEKGSYTKKVTIISSRKNSGVASVYGSASSMMFKREPQLNKFERFRAFYSSPITKFWSWCIAFLIFLTTQTCILLLETSL----KPSKYEWITFIYTVTLSVEHIRKLMTSEGSRINEKVKVFYAKWYNIWTSAALLFFLVGYGFR-LVPMYRHSWGRVLLSFSNVLFYMKIFEYLSVHPLLGPYIQMAAKMVWSMCYICVLLLVPLMAFGVNRQALTEPNVKDWHWLLVRNIFYKPYFMLYGEVYAGEIDT 1091          

HSP 2 Score: 94.3597 bits (233), Expect = 3.561e-19
Identity = 78/311 (25.08%), Postives = 142/311 (45.66%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKYKG--EIFETCKCGNIKTDH-------QDFPI-----KDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHF---TKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREND-NGNVVQI---LYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVIN 931
            +I+  F+ R C ++    +  E C CG   + H          P+     + + W++ NNT+  T D FG I F G       H   ++R + +  P  ++V+Y LM   W    P+L+I+V GG+        +  + F++ +++  +    WII  G + G+   +++A+ E     A   +Q+  +GI  WG I   + L  +N   ++   +        +L+     FL  D+GT  ++  + + R   E  +     NG  V +   L EGG  ++ +   Y ++K  IP ++   SGRAAD+I+
Sbjct:   88 WIENTFEKRECIRFAALPKDPERCGCGRPLSAHTPASTFFSTLPVHLLEKEQQTWTIANNTQTSTTDAFGTIVFQGGAHA---HKAQYVRLSYDSEP--LDVMY-LMEKVWGLEAPRLVITVHGGMSNF-ELEERLGRLFRKGMLKAAQTTGAWIITSGLDSGVVRHVAKALDE-AGISARMRSQIVTIGIAPWGVIKRKERLIRQNEHVYYDVHSLSVNANVGILNDRHSYFLLADNGTVGRFGADLHLRQNLENHIATFGCNGRKVPVVCTLLEGGISSINAIHDYVTMKPDIPAIVCDGSGRAADIIS 390          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 88.5817 bits (218), Expect = 1.996e-17
Identity = 64/205 (31.22%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2265 FYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHT 2879
            FY  PI  F    IS++LF+  F Y  LV+      +     E  +  YV     E++R+II  +      K++ Y+   WN   I  I+ YI+ FF+RCF S     V     SV  +M   +++ Y  + P LGP V M G+MI ++ + + +  + ++S+G LA           +  L+  IF +PYF  YGE+  DE  T
Sbjct:  896 FYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTV----IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSVAYGRVILACDSVLWTM---KLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFG-LARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDT 1092          

HSP 2 Score: 64.3142 bits (155), Expect = 5.156e-10
Identity = 51/201 (25.37%), Postives = 90/201 (44.78%), Query Frame = 2
Query:  356 WNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREND-------NGNVVQILYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVI 928
            W    P+LII+V GG    +      +   K  L++       WII  G + G+   ++ A+      Q+   N++  +GI  WG +   +    ++ T  +   + KG+   L++    FL  D+GT  +Y  E   R + E  + +         +  VV ++ EGGS  + S   Y +    +P+V+   SGRAAD++
Sbjct:    8 WQISPPRLIITVHGGTSNFDLQPKLARVFRK-GLLKAASTTGAWIITSGCDTGVVKHVAAAL---EGAQSAQRNKIVCIGIAPWGLLKKREDFIGQDKTVPYYPSSSKGRFTGLNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLL 204          

HSP 3 Score: 59.6918 bits (143), Expect = 1.504e-8
Identity = 34/132 (25.76%), Postives = 65/132 (49.24%), Query Frame = 3
Query: 1653 DLFLWALLTEFTELAIIFWKIGEEHIGSALIA-----SIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGEL 2033
            +L +WA+LT+  ++A+  W+ GEE +  AL+A     S+     E  +      +    L + +++F+ +++ ++   ++     T  LL   L  W+N TCL +A+  N   FL+   C   +  +W G L
Sbjct:  549 ELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLE----VEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGL 676          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 88.5817 bits (218), Expect = 2.306e-17
Identity = 64/205 (31.22%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2265 FYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHT 2879
            FY  PI  F    IS++LF+  F Y  LV+      +     E  +  YV     E++R+II  +      K++ Y+   WN   I  I+ YI+ FF+RCF S     V     SV  +M   +++ Y  + P LGP V M G+MI ++ + + +  + ++S+G LA           +  L+  IF +PYF  YGE+  DE  T
Sbjct: 1241 FYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTV----IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSVAYGRVILACDSVLWTM---KLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFG-LARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDT 1437          

HSP 2 Score: 77.0258 bits (188), Expect = 7.603e-14
Identity = 65/265 (24.53%), Postives = 116/265 (43.77%), Query Frame = 2
Query:  179 DEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPH-----FIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREND-------NGNVVQILYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVI 928
            +E WSL  +T     + FG + F G         PH     ++R N +  P  +  +++ +   W    P+LII+V GG    +      +   K  L++       WII  G + G+   ++ A+      Q+   N++  +GI  WG +   +    ++ T  +   + KG+   L++    FL  D+GT  +Y  E   R + E  + +         +  VV ++ EGGS  + S   Y +    +P+V+   SGRAAD++
Sbjct:  300 NEKWSLRKHTVSLATNAFGQVEFQGG--------PHPYKAQYVRVNFDTEPAYIMSLFEHV---WQISPPRLIITVHGGTSNFDLQPKLARVFRK-GLLKAASTTGAWIITSGCDTGVVKHVAAAL---EGAQSAQRNKIVCIGIAPWGLLKKREDFIGQDKTVPYYPSSSKGRFTGLNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLL 549          

HSP 3 Score: 59.3066 bits (142), Expect = 2.135e-8
Identity = 34/132 (25.76%), Postives = 65/132 (49.24%), Query Frame = 3
Query: 1653 DLFLWALLTEFTELAIIFWKIGEEHIGSALIA-----SIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGEL 2033
            +L +WA+LT+  ++A+  W+ GEE +  AL+A     S+     E  +      +    L + +++F+ +++ ++   ++     T  LL   L  W+N TCL +A+  N   FL+   C   +  +W G L
Sbjct:  894 ELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLE----VEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGL 1021          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 88.5817 bits (218), Expect = 2.394e-17
Identity = 64/205 (31.22%), Postives = 99/205 (48.29%), Query Frame = 3
Query: 2265 FYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHT 2879
            FY  PI  F    IS++LF+  F Y  LV+      +     E  +  YV     E++R+II  +      K++ Y+   WN   I  I+ YI+ FF+RCF S     V     SV  +M   +++ Y  + P LGP V M G+MI ++ + + +  + ++S+G LA           +  L+  IF +PYF  YGE+  DE  T
Sbjct: 1201 FYSAPISTFWSWTISFILFITFFTYTLLVKTPPRPTV----IEYILIAYVAAFGLEQVRKIIMSDAKPFYEKIRTYVCSFWNCVTILAIIFYIVGFFMRCFGSVAYGRVILACDSVLWTM---KLLDYMSVHPKLGPYVTMAGKMIQNMSYIIVMLVVTLLSFG-LARQSITYPDETWHWILVRNIFLKPYFMLYGEVYADEIDT 1397          

HSP 2 Score: 77.0258 bits (188), Expect = 7.572e-14
Identity = 65/265 (24.53%), Postives = 116/265 (43.77%), Query Frame = 2
Query:  179 DEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPH-----FIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREND-------NGNVVQILYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVI 928
            +E WSL  +T     + FG + F G         PH     ++R N +  P  +  +++ +   W    P+LII+V GG    +      +   K  L++       WII  G + G+   ++ A+      Q+   N++  +GI  WG +   +    ++ T  +   + KG+   L++    FL  D+GT  +Y  E   R + E  + +         +  VV ++ EGGS  + S   Y +    +P+V+   SGRAAD++
Sbjct:  260 NEKWSLRKHTVSLATNAFGQVEFQGG--------PHPYKAQYVRVNFDTEPAYIMSLFEHV---WQISPPRLIITVHGGTSNFDLQPKLARVFRK-GLLKAASTTGAWIITSGCDTGVVKHVAAAL---EGAQSAQRNKIVCIGIAPWGLLKKREDFIGQDKTVPYYPSSSKGRFTGLNNRHSYFLLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLL 509          

HSP 3 Score: 59.3066 bits (142), Expect = 2.111e-8
Identity = 34/132 (25.76%), Postives = 65/132 (49.24%), Query Frame = 3
Query: 1653 DLFLWALLTEFTELAIIFWKIGEEHIGSALIA-----SIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGEL 2033
            +L +WA+LT+  ++A+  W+ GEE +  AL+A     S+     E  +      +    L + +++F+ +++ ++   ++     T  LL   L  W+N TCL +A+  N   FL+   C   +  +W G L
Sbjct:  854 ELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLE----VEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGL 981          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339082)

HSP 1 Score: 140.198 bits (352), Expect = 3.856e-55
Identity = 161/680 (23.68%), Postives = 295/680 (43.38%), Query Frame = 3
Query:  987 QSTMNIDEKDIEK-FQEILREIYEKYRNQIFVHDLFDK----SMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQN-------ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP----------------QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSP------------FLPMWXXXXXXXXXXXXXXXLIMPSVNQP---------TQSERSNESAE-----SQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGEL 2858
            Q T  +     EK +QE+L+    + +N I V  + +K    + +LD+ I+ A+  S   +  E+ L + + +N  DIA  ++F+    Q      L E     L++++I+FVKL LEN  S++ FLT   L  LYN + +   +  GY+L D      K +        Y L+ +  +IN + G   ++         I+ K          ++  +Q Q +   +S  +                   +L +WA+LT+  ++A++ W  GEE +  +L++  +   M     +    ++    L   +K+F+     ++  ++ +  E    LL   L +W+N +CL +A++ N    L+       +  +W G L               +P +   +       L +   MP   +            S+RS   AE     S T +F    N      Y++ K+   +  K     FY  PI KF    I+Y+ FL++F +  LV+++       RW E +   Y+  +  E++R+II  E     +K   +    WN  D   I++++I    R    ++   + R  Y V      LRI+    ++  LGP V M+G+M+ ++ +F+ + ++ ++S+G    A L  N+      SLI E+ ++PYF  YGE+
Sbjct:  337 QKTFEVGLDQSEKLYQELLQ--CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIFVYG--QEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYN-TKHGPANTLGYILRDVRPHIPKGY-------IYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTNFKVILGLAMPFYIRQLDFKSKEELQQ---MPQTEEEHLENQNLDNDDSDRSQPDAEVSLTDSDTAQFREFFN---LSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQ----MPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR--FRENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQ--PTWSLIKEVTFQPYFMLYGEV 989          

HSP 2 Score: 96.6709 bits (239), Expect = 3.856e-55
Identity = 84/308 (27.27%), Postives = 138/308 (44.81%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKY----KGEIFETCKCGNIKTDHQDFP-----IKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRE-------NDNGNVVQILYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVI 928
            +I+  FQ R C K+    K +    C CG  +  HQ  P        ++W    +T+ +  D +G I F G        Y   +R + +  PE++    +L    WN   P+L+I+V GG K       + KK  ++ L++  K    WI  GG N G+   + +A+     Q+   + +V  +GI  WG +  N  L   N   P +  +    K  VL + H   FL  D+GT+ +Y  E   R K EK +         + +  VV ++ EGG+  + +   Y +    +P+V+   SGRAAD++
Sbjct:   15 WIETNFQKRECIKFIPCPKDDT--KCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQY---VRLSFDTRPELL---VQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQR---TGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHA-YFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL 309          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339075)

HSP 1 Score: 100.138 bits (248), Expect = 1.444e-40
Identity = 84/308 (27.27%), Postives = 138/308 (44.81%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKY----KGEIFETCKCGNIKTDHQDFP-----IKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVR-------ENDNGNVVQILYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVI 928
            +I+  FQ R C K+    K +    C CG  +  HQ  P        ++W    +T+ +  D +G I F G        Y   +R + +  PE++    +L    WN   P+L+I+V GG K       + KK  ++ L++  K    WI  GG N G+   + +A+     Q+   + +V  +GI  WG +  N  L   N   P +  +    K  VL + H   FL  D+GT+ +Y  E   R K EK +         + +  VV ++ EGG+  + +   Y +    +P+V+   SGRAAD++
Sbjct:   15 WIETNFQKRECIKFIPCPKDDT--KCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQY---VRLSFDTRPELL---VQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQR---TGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHA-YFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL 309          

HSP 2 Score: 87.8113 bits (216), Expect = 1.444e-40
Identity = 87/378 (23.02%), Postives = 166/378 (43.92%), Query Frame = 3
Query:  987 QSTMNIDEKDIEK-FQEILREIYEKYRNQIFVHDLFDK----SMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQN-------ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP----------------QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGEL 2033
            Q T  +     EK +QE+L+    + +N I V  + +K    + +LD+ I+ A+  S   +  E+ L + + +N  DIA  ++F+    Q      L E     L++++I+FVKL LEN  S++ FLT   L  LYN + +   +  GY+L D      K +        Y L+ +  +IN + G   ++         I+ K          ++  +Q Q +   +S  +                   +L +WA+LT+  ++A++ W  GEE +  +L++  +   M     +    ++    L   +K+F+     ++  ++ +  E    LL   L +W+N +CL +A++ N    L+       +  +W G L
Sbjct:  337 QKTFEVGLDQSEKLYQELLQ--CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIFVYG--QEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYN-TKHGPANTLGYILRDVRPHIPKGY-------IYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGL 701          

HSP 3 Score: 83.5741 bits (205), Expect = 9.008e-16
Identity = 61/217 (28.11%), Postives = 109/217 (50.23%), Query Frame = 3
Query: 2211 YSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGEL 2858
            Y++ K+   +  K     FY  PI KF    I+Y+ FL++F +  LV+++       RW E +   Y+  +  E++R+II  E     +K   +    WN  D   I++++I    R    ++   + R  Y V      LRI+    ++  LGP V M+G+M+ ++ +F+ + ++ ++S+G    A L  N+      SLI E+ ++PYF  YGE+
Sbjct:  800 YNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQ----MPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR--FRENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTW--SLIKEVTFQPYFMLYGEV 1008          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339074)

HSP 1 Score: 96.6709 bits (239), Expect = 1.836e-38
Identity = 84/308 (27.27%), Postives = 138/308 (44.81%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKY----KGEIFETCKCGNIKTDHQDFP-----IKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRE-------NDNGNVVQILYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVI 928
            +I+  FQ R C K+    K +    C CG  +  HQ  P        ++W    +T+ +  D +G I F G        Y   +R + +  PE++    +L    WN   P+L+I+V GG K       + KK  ++ L++  K    WI  GG N G+   + +A+     Q+   + +V  +GI  WG +  N  L   N   P +  +    K  VL + H   FL  D+GT+ +Y  E   R K EK +         + +  VV ++ EGG+  + +   Y +    +P+V+   SGRAAD++
Sbjct:   33 WIETNFQKRECIKFIPCPKDDT--KCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQY---VRLSFDTRPELL---VQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQR---TGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHA-YFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL 327          

HSP 2 Score: 84.3445 bits (207), Expect = 1.836e-38
Identity = 87/378 (23.02%), Postives = 166/378 (43.92%), Query Frame = 3
Query:  987 QSTMNIDEKDIEK-FQEILREIYEKYRNQIFVHDLFDK----SMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQN-------ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP----------------QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGEL 2033
            Q T  +     EK +QE+L+    + +N I V  + +K    + +LD+ I+ A+  S   +  E+ L + + +N  DIA  ++F+    Q      L E     L++++I+FVKL LEN  S++ FLT   L  LYN + +   +  GY+L D      K +        Y L+ +  +IN + G   ++         I+ K          ++  +Q Q +   +S  +                   +L +WA+LT+  ++A++ W  GEE +  +L++  +   M     +    ++    L   +K+F+     ++  ++ +  E    LL   L +W+N +CL +A++ N    L+       +  +W G L
Sbjct:  355 QKTFEVGLDQSEKLYQELLQ--CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIFVYG--QEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYN-TKHGPANTLGYILRDVRPHIPKGY-------IYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGL 719          

HSP 3 Score: 82.4185 bits (202), Expect = 2.178e-15
Identity = 61/217 (28.11%), Postives = 109/217 (50.23%), Query Frame = 3
Query: 2211 YSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGEL 2858
            Y++ K+   +  K     FY  PI KF    I+Y+ FL++F +  LV+++       RW E +   Y+  +  E++R+II  E     +K   +    WN  D   I++++I    R    ++   + R  Y V      LRI+    ++  LGP V M+G+M+ ++ +F+ + ++ ++S+G    A L  N+      SLI E+ ++PYF  YGE+
Sbjct:  818 YNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQ----MPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR--FRENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQ--PTWSLIKEVTFQPYFMLYGEV 1026          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339077)

HSP 1 Score: 96.6709 bits (239), Expect = 1.897e-38
Identity = 84/308 (27.27%), Postives = 138/308 (44.81%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKY----KGEIFETCKCGNIKTDHQDFP-----IKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRE-------NDNGNVVQILYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVI 928
            +I+  FQ R C K+    K +    C CG  +  HQ  P        ++W    +T+ +  D +G I F G        Y   +R + +  PE++    +L    WN   P+L+I+V GG K       + KK  ++ L++  K    WI  GG N G+   + +A+     Q+   + +V  +GI  WG +  N  L   N   P +  +    K  VL + H   FL  D+GT+ +Y  E   R K EK +         + +  VV ++ EGG+  + +   Y +    +P+V+   SGRAAD++
Sbjct:  117 WIETNFQKRECIKFIPCPKDDT--KCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQY---VRLSFDTRPELL---VQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQR---TGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHA-YFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL 411          

HSP 2 Score: 84.3445 bits (207), Expect = 1.897e-38
Identity = 89/379 (23.48%), Postives = 166/379 (43.80%), Query Frame = 3
Query:  987 QSTMNIDEKDIEK-FQEILREIYEKYRNQIFVHDLFDK----SMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQN-------ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP----------------QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTS--AMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGEL 2033
            Q T  +     EK +QE+L+    + +N I V  + +K    + +LD+ I+ A+  S   +  E+ L + + +N  DIA  ++F+    Q      L E     L++++I+FVKL LEN  S++ FLT   L  LYN + +   +  GY+L D      K +        Y L+ +  +IN + G   ++         I+ K          ++  +Q Q +   +S  +                   +L +WA+LT+  ++A++ W  GEE +  +L++  +   M     +    DT     L   +K+F+     ++  ++ +  E    LL   L +W+N +CL +A++ N    L+       +  +W G L
Sbjct:  439 QKTFEVGLDQSEKLYQELLQ--CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIFVYG--QEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYN-TKHGPANTLGYILRDVRPHIPKGY-------IYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDL-DTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGL 803          

HSP 3 Score: 82.0333 bits (201), Expect = 2.580e-15
Identity = 61/217 (28.11%), Postives = 109/217 (50.23%), Query Frame = 3
Query: 2211 YSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGEL 2858
            Y++ K+   +  K     FY  PI KF    I+Y+ FL++F +  LV+++       RW E +   Y+  +  E++R+II  E     +K   +    WN  D   I++++I    R    ++   + R  Y V      LRI+    ++  LGP V M+G+M+ ++ +F+ + ++ ++S+G    A L  N+      SLI E+ ++PYF  YGE+
Sbjct:  902 YNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQ----MPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR--FRENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQ--PTWSLIKEVTFQPYFMLYGEV 1110          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339078)

HSP 1 Score: 96.6709 bits (239), Expect = 1.977e-38
Identity = 84/308 (27.27%), Postives = 138/308 (44.81%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKY----KGEIFETCKCGNIKTDHQDFP-----IKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRE-------NDNGNVVQILYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVI 928
            +I+  FQ R C K+    K +    C CG  +  HQ  P        ++W    +T+ +  D +G I F G        Y   +R + +  PE++    +L    WN   P+L+I+V GG K       + KK  ++ L++  K    WI  GG N G+   + +A+     Q+   + +V  +GI  WG +  N  L   N   P +  +    K  VL + H   FL  D+GT+ +Y  E   R K EK +         + +  VV ++ EGG+  + +   Y +    +P+V+   SGRAAD++
Sbjct:   15 WIETNFQKRECIKFIPCPKDDT--KCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGGAHPTKAQY---VRLSFDTRPELL---VQLFTKEWNLELPKLLITVQGG-KANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDALLLEGQQR---TGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKLAVLNNRHA-YFLLVDNGTQAKYGAELILRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL 309          

HSP 2 Score: 83.9593 bits (206), Expect = 1.977e-38
Identity = 87/378 (23.02%), Postives = 166/378 (43.92%), Query Frame = 3
Query:  987 QSTMNIDEKDIEK-FQEILREIYEKYRNQIFVHDLFDK----SMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQN-------ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP----------------QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGEL 2033
            Q T  +     EK +QE+L+    + +N I V  + +K    + +LD+ I+ A+  S   +  E+ L + + +N  DIA  ++F+    Q      L E     L++++I+FVKL LEN  S++ FLT   L  LYN + +   +  GY+L D      K +        Y L+ +  +IN + G   ++         I+ K          ++  +Q Q +   +S  +                   +L +WA+LT+  ++A++ W  GEE +  +L++  +   M     +    ++    L   +K+F+     ++  ++ +  E    LL   L +W+N +CL +A++ N    L+       +  +W G L
Sbjct:  337 QKTFEVGLDQSEKLYQELLQ--CTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSPPEQ-LSLALTWNRVDIARSEIFVYG--QEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYN-TKHGPANTLGYILRDVRPHIPKGY-------IYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGL 701          

HSP 3 Score: 72.0182 bits (175), Expect = 3.015e-12
Identity = 45/164 (27.44%), Postives = 78/164 (47.56%), Query Frame = 3
Query: 2211 YSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMI 2702
            Y++ K+   +  K     FY  PI KF    I+Y+ FL++F +  LV+++       RW E +   Y+  +  E++R+II  E     +K   +    WN  D   I++++I    R    ++   + R  Y V      LRI+    ++  LGP V M+G+M+
Sbjct:  800 YNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQ----MPRWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNMWNPCDGAAIILFVIGLAFR--FRENTMDIGRVIYCVDSIYWYLRILNILGVNKYLGPLVTMMGKMV 957          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Zebrafish
Match: trpm6 (transient receptor potential cation channel, subfamily M, member 6 [Source:ZFIN;Acc:ZDB-GENE-111212-1])

HSP 1 Score: 152.91 bits (385), Expect = 3.670e-55
Identity = 163/691 (23.59%), Postives = 305/691 (44.14%), Query Frame = 3
Query:  966 KSILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDN--DLEKILKITIKFNCFDIAEKKVFL-NADYQ--SLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKN----------------------------FDSKRKKSKY--LLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP--------QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAM-LSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQ----PTQSERSNESAESQTPEFMY-----EANSPFKRHYSQSKKKASI--PYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
            + +L   Q +  ++  +  +  +IL E  E +R  I + D   +S  L    V  + +S+       E+ L +T+ ++  DIA+  + +    +Q  SL Q +L       L  +++ FVKL +EN  ++  FLT   L  LYN    ++     + L   IA   +                             +  KR ++ Y  L  P +   +  S            P R   R   + +  Q +  +    +K  P         DLF+WA+L    E+A++ W+ GE+ +  A++A  +   +    ++    DT A  L + S +F ++A+ V+ +A  + +     LL   +K W+N TCLQ+A+S  L  F++ +     +  +W G L+     W         F +I  ++MP   Q     +Q+E S+     +  +F +     E     K      ++ +S   P+   +  FY  P+VKF  H ++++ FL++F Y  LV L     IQ    E  +  Y+L +  E+ R+++  E      KLK + S  WNI D  GIL++++   LR    Q+  + +   YS+      +R++  + ++   GP + MI +M+ ++F+ + I +L ++S+GT   + L  N   +   +L+ ++ ++PY+  +GE+   E
Sbjct:  340 EDVLQRIQDSFGVERSESTELLDILMECME-HRELISIFD--SESEDLQEADVAILSTSLRGTRASPEEQLSLTLAWDRADIAKDHILVYGQQWQVGSLEQIMLD-----ALIMDRVNFVKLLIENGMTMSHFLTISRLEQLYN----IQTGSSHHFLRHVIADAKQTRLPAVYRISLIDIGMVIEYLIGGAYRSTYTRKRFRTMYSRLHNPAKETSSPFSKAKKVAPAPEATPPRSHFRRTAQPYRHQ-EGGVAPQDQKSDPIPDFVCTFNDLFVWAVLKHRQEMALLLWQHGEQAMARAVVACKLYRTLAMEAKESNMGDTMAEELKKNSLEFGQLAVDVLDQAFRENERMAMKLLTWEMKDWSNFTCLQMAVSSGLRPFVAHNCTQMLLTDLWMGRLNLSKNSW---------FKIIGSILMPVAIQLLEFKSQAEMSHVPQLQEALQFGWDTVPSEQEGAEKAVPGDEERGSSCLYPWTRKVYDFYTAPVVKFWFHTMAFLGFLMMFAYTCLVRLNETPNIQ----ECLVMTYILAMAVEKAREVLVLEPRKFTKKLKVWFSEYWNINDFLGILLFLVGVSLR--WHQETRLASHIVYSLDFVFWSVRLLDLFAVNQHAGPYLTMITKMMSNMFYIVIIMALVLVSFGTSRKSILSPNEDPSW--TLLRDVVFQPYWMIFGEVYAGE 1000          

HSP 2 Score: 84.3445 bits (207), Expect = 3.670e-55
Identity = 65/265 (24.53%), Postives = 116/265 (43.77%), Query Frame = 2
Query:  176 KDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTK--KTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV-------RENDNGNVVQILYEGGSRALESA--YNSLKASIPLVLIKNSGRAADVINAI 937
            ++E WS+  +T     D FG ++F G +         ++R +C+  PE++    +LM+  W+   P+L+I+V GG      +    +      L+   +    WI+  G N G+   + +AV  Y S      N   ++GI  WG I NN  L   +   H+         +  L+     FL  DDGT  +   +   R + E+ +       R   +  +V ++ EGG   L     Y    + +P+++ + +GRAAD++  I
Sbjct:   69 EEEEWSVLQHTSLSPTDAFGSLDFQGSSKRACR--AKYVRLSCDSPPELL---VQLMLREWHMEIPKLVITVHGGTDNFLLSPRVCQAFST-GLVTAAESTGAWILTDGINTGVSKYVGDAVKMYGSHDHRKRN---VVGITPWGIIENNSDLIGRDGLRHYQALGNPLSKRASLNGMHSHFLLVDDGTIGKSGCQIELRKRLERHIHYQKIHPRLPQHVPLVCVVVEGGPSVLSVVLEYVCRTSPVPVLVFEGTGRAADMLALI 324          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 153.68 bits (387), Expect = 5.048e-53
Identity = 154/653 (23.58%), Postives = 306/653 (46.86%), Query Frame = 3
Query:  999 NIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVI-----SSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN--------HSLYVKPS--RCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPK-PGRQLIRTDEENFEFQSQSFIEVHSKKITP--QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPE----FMYEANSPFKRHYSQ--SKKKASIPYKDMI----KMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQ-IIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
             +   +I  + ++++ I + + + + VHD  ++  +LD  I++A++      S +  D    LK+ + +N  DIA+ ++F + D Q   Q  L E     L N++ +FV+LF++N  +I+ FLT   L  LY         H+L +K +  R   L    ++    N    RK  ++  + V +++     +  +    + K P  ++ +       F SQ  +    ++     +DLFLWA+L    E+A  FW +G E + +AL+   I+ +M  L      ++  +  S  + K+++ A+ + +E ++  ++  Y+LL+R    W+  T L IA       F +     + + K+W G +     + +++++     ++   LI  +  +    +     AE  + E     +     P     S   + +  S  +  ++      F+  P+  F+ ++I Y  FL++F Y+ L++ +         AEI ++F+V  ++ EEIRQ     E    + K+K Y+  +WN  D+  I ++++   L C ++   +   R   ++   +  LR++  + I   LGPK+I++ RMI D+FFFL   S+++I+YG    AL       ++  +     YRPY   +G++ L+E
Sbjct:  327 GLHSTEITSWTKLIQRILD-HGHLLTVHDP-EQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIF-SGDVQWSAQD-LEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELYCSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRK-FRFTFHEVSKVLKDFLDDTCKG--FYQKLPAERMGK----GRLFHSQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLA-----TEAESARSMKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDGDPVAGEGSAETAARSCSATFIRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVG--LSCRMAMSTYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDW-VFRRALYRPYLHIFGQIPLEE 960          

HSP 2 Score: 76.2554 bits (186), Expect = 5.048e-53
Identity = 64/297 (21.55%), Postives = 121/297 (40.74%), Query Frame = 2
Query:  134 KCGNIKTDHQDF----------PIKDEIWSLENNTKCR----TCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEK---GKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            +CG +  + Q +          P+   + S+   +  R         G I+FTG    ++     F+R      P     +Y+++   W    P L++++ GG   +       +   ++ L++  +    WI+  G   GI   + +AV ++     +   +V  +GI  W  I N  +L +  P +  T  TE    G V  LD +   F+  D+   K+       R+K  K +     G          V+ +L  G  R L+  Y +++ SIP +++  SG  AD++  ++D
Sbjct:   20 QCGELMYESQGYSSLVGCRCYTPLTQSVVSMVEKSSERFDKQMAGRLGDIDFTG----VSRTRGKFVRVTSSTDPA---EIYQILTKQWGLAPPHLVVALMGG-DEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDP-KRPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMD 307          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 154.451 bits (389), Expect = 5.134e-53
Identity = 154/653 (23.58%), Postives = 306/653 (46.86%), Query Frame = 3
Query:  999 NIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVI-----SSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN--------HSLYVKPS--RCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPK-PGRQLIRTDEENFEFQSQSFIEVHSKKITP--QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPE----FMYEANSPFKRHYSQ--SKKKASIPYKDMI----KMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQ-IIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
             +   +I  + ++++ I + + + + VHD  ++  +LD  I++A++      S +  D    LK+ + +N  DIA+ ++F + D Q   Q  L E     L N++ +FV+LF++N  +I+ FLT   L  LY         H+L +K +  R   L    ++    N    RK  ++  + V +++     +  +    + K P  ++ +       F SQ  +    ++     +DLFLWA+L    E+A  FW +G E + +AL+   I+ +M  L      ++  +  S  + K+++ A+ + +E ++  ++  Y+LL+R    W+  T L IA       F +     + + K+W G +     + +++++     ++   LI  +  +    +     AE  + E     +     P     S   + +  S  +  ++      F+  P+  F+ ++I Y  FL++F Y+ L++ +         AEI ++F+V  ++ EEIRQ     E    + K+K Y+  +WN  D+  I ++++   L C ++   +   R   ++   +  LR++  + I   LGPK+I++ RMI D+FFFL   S+++I+YG    AL       ++  +     YRPY   +G++ L+E
Sbjct:  278 GLHSTEITSWTKLIQRILD-HGHLLTVHDP-EQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIF-SGDVQWSAQD-LEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELYCSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRK-FRFTFHEVSKVLKDFLDDTCKG--FYQKLPAERMGK----GRLFHSQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLA-----TEAESARSMKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDGDPVAGEGSAETAARSCSATFIRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVG--LSCRMAMSTYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDW-VFRRALYRPYLHIFGQIPLEE 911          

HSP 2 Score: 75.485 bits (184), Expect = 5.134e-53
Identity = 58/251 (23.11%), Postives = 107/251 (42.63%), Query Frame = 2
Query:  230 FGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEK---GKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
             G I+FTG    ++     F+R      P     +Y+++   W    P L++++ GG   +       +   ++ L++  +    WI+  G   GI   + +AV ++     +   +V  +GI  W  I N  +L +  P +  T  TE    G V  LD +   F+  D+   K+       R+K  K +     G          V+ +L  G  R L+  Y +++ SIP +++  SG  AD++  ++D
Sbjct:   17 LGDIDFTG----VSRTRGKFVRVTSSTDPA---EIYQILTKQWGLAPPHLVVALMGG-DEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDP-KRPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMD 258          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 152.91 bits (385), Expect = 1.342e-52
Identity = 153/659 (23.22%), Postives = 303/659 (45.98%), Query Frame = 3
Query:  999 NIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVI-----SSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN--------HSLYVKPS--RCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQ---------NENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPE----FMYEANSPFKRHYSQ--SKKKASIPYKDMI----KMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQ-IIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
             +   +I  + ++++ I + + + + VHD  ++  +LD  I++A++      S +  D    LK+ + +N  DIA+ ++F + D Q   Q  L E     L N++ +FV+LF++N  +I+ FLT   L  LY         H+L +K +  R   L    ++    N    RK  ++  + V +++     +  +         ++ +H K    + R  E  +                 +DLFLWA+L    E+A  FW +G E + +AL+   I+ +M  L      ++  +  S  + K+++ A+ + +E ++  ++  Y+LL+R    W+  T L IA       F +     + + K+W G +     + +++++     ++   LI  +  +    +     AE  + E     +     P     S   + +  S  +  ++      F+  P+  F+ ++I Y  FL++F Y+ L++ +         AEI ++F+V  ++ EEIRQ     E    + K+K Y+  +WN  D+  I ++++   L C ++   +   R   ++   +  LR++  + I   LGPK+I++ RMI D+FFFL   S+++I+YG    AL       ++  +     YRPY   +G++ L+E
Sbjct:  278 GLHSTEITSWTKLIQRILD-HGHLLTVHDP-EQDSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSEIF-SGDVQWSAQD-LEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELYCSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRK-FRFTFHEVSKVLKDFLDDTCKGFYQKLPAVSKALHQKNLPDMDRRCEHPW-----------------RDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMKEMAHLA-----TEAESARSMKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVWTSLIKFNPEEQVSKDEGEPFAELDSLETEQALLLTDGDPVAGEGSAETAARSCSATFIRVVLRRWNRFWSAPVTVFMGNVIMYFAFLILFSYVLLLDFRPPPPYGPSAAEIILYFWVFTLVLEEIRQSFFTDEDMSILKKMKLYVEDNWNKCDMVAISLFVVG--LSCRMAMSTYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDW-VFRRALYRPYLHIFGQIPLEE 906          

HSP 2 Score: 75.8702 bits (185), Expect = 1.342e-52
Identity = 58/251 (23.11%), Postives = 107/251 (42.63%), Query Frame = 2
Query:  230 FGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEK---GKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
             G I+FTG    ++     F+R      P     +Y+++   W    P L++++ GG   +       +   ++ L++  +    WI+  G   GI   + +AV ++     +   +V  +GI  W  I N  +L +  P +  T  TE    G V  LD +   F+  D+   K+       R+K  K +     G          V+ +L  G  R L+  Y +++ SIP +++  SG  AD++  ++D
Sbjct:   17 LGDIDFTG----VSRTRGKFVRVTSSTDPA---EIYQILTKQWGLAPPHLVVALMGG-DEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLASTSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDP-KRPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMD 258          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Zebrafish
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 172.555 bits (436), Expect = 5.439e-43
Identity = 165/617 (26.74%), Postives = 294/617 (47.65%), Query Frame = 3
Query: 1092 DKSMKLDRKIVEAVISSIDDND------LEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLT-EEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKS------KYLLYPVRRIINMMSGNILQNENIHP--KPGRQLIRTDEENFEFQSQSFIEVHSKK---------ITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQP--TQSERSNESAESQTPEFMYEANSPFKRH---YSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII-DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYG 2852
            DK+  +D  I++A++ +   ++       E+ L++ + +N  DIAE ++F   +        LH      L  ++ EFV+L LEN   + +FL  EE L  LY+H     PS C +L    +A   +    +R +       K  L  V   +  + G+  Q   I    KP +  +R      +  S+  +++                +DLFLWA++    ELA I W+   + I +AL AS IL K+     +    + + ML  A+  +++ AI V +E H+   +    LLIR   +W   TCL +A+  +   F++ S   + + +IW GELS   P WK+L+ + F  ++    +    ++    Q+ER+ +   +    F  +++   KRH   +SQ  +   +     +  F + P VKF  ++ SY  FL +F     V L ++ +    W E+ ++ ++  ++ EEIRQ+  D + +G   K K Y+   WNI D+  I+++I     R   S  +F + +    +   + CLR+M  + IS TLGPK+I++ RM++D+FFF+ + S+++++YG     +       +N  +I    Y PY   +G
Sbjct:  396 DKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIF--TEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSH----LPS-CFFLRK--LAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVR-----LKVPSKGALDLPCSGEEWSADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANH-YEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFA----VVLMIDFQTSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQASDTVFYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILIENEERLNW-IIRGAVYEPYITIFG 992          

HSP 2 Score: 124.02 bits (310), Expect = 4.858e-28
Identity = 87/293 (29.69%), Postives = 138/293 (47.10%), Query Frame = 2
Query:  131 CKCGNIKTDHQDFPIKDE-----IWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKV-LLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGN--------VVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTR 958
            CKCG  K  H D  IK E      W    + +    D FG I+F G    +      ++R + + +    E +Y+LM   W    P L+ISVTGG K     T+ + K  +  LI+V +    WI+ GG + G+   +  AV +Y     +   Q+ ++G+  WG I N   L +     P Y+   +  +G++  LD +   FL  DDGT+  Y  E   R + EK + +   GN        VV ++ +GG   L + YNS+    P V+++ SGR ADVI  +  + +++
Sbjct:   61 CKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGG----LGQKTGKYVRVSSDTS---CENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRR-GLIKVAQTTGAWILTGGTHAGVMKHVGMAVRDYTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVEIELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIAHVASVPVSK 345          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 181.8 bits (460), Expect = 1.121e-75
Identity = 167/652 (25.61%), Postives = 295/652 (45.25%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKI-----LKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKN-----------FDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQ-DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMI------------KMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLI-TEIFYRPYFQTYGELMLDEFHTNE 2885
            E   +++  I E  R+ + V+   D     +  I++A++ +   +  + +     LK+ + +N  DIA+ ++F            L +     L NN+ +FVKLF++N  +I D+LT   L  LY+  L    +   Y L+       +N            +S  K  ++ LY V +I+  + G++      H   G      ++ N            S   +P  DLF+WA+L    E+A  FW++G E + SAL A  IL +   L R    ++ S  +   + KF+++AI V  E +   +   + LL+R    W   TCLQ+A   +   F +Q    S + + W G+++   P+W ++++     ++   LI  + N+   SE    S   +  +   E   P K+   +  K    P  ++I            K F+  P+  F  +++ Y  FL +F Y+ L+E K+        +E  ++F++  ++ EEIRQ           K+K YL  SWN  DI  + ++II    R F   + F   R        +  LR++  + ++  LGPK+I++ +M+ D+FFFL    +++I+YG     L       M LS I   +FYRPY Q +G++  +EF  ++
Sbjct:  342 ENLTKMVERIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATD--LDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVL---DNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHVL-GNMKGSVNKRN------------SGSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKE---LSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTFFCPPLIYTDLI--TFNRTLSSEELYFSFREEKDDNAEEV--PLKKMSVKKSKTKKAPEAEIIKEKQRPRWMQRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPDGPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRMF--NESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLL--HPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASK 963          

HSP 2 Score: 124.405 bits (311), Expect = 1.121e-75
Identity = 87/322 (27.02%), Postives = 142/322 (44.10%), Query Frame = 2
Query:   50 FL*MDLFIKKYFQIRYCYKYKGEIFET-----CKCGNIKTDHQDFPIKD-------EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGN---------VVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            FL +  +I K F+ + C  +  +  ++     C+CG +  +H    ++D         W+   +T     D +G + F G        +  FIR + +  P     VY L+   W    P L++SV GG       T  +    K  L++  +    WI+ GG  VGI   + EAV ++ +  +NS  +V  +GI  WG + N + L N     P  ++    +     LD++   FL  DDGT  Q   ET+FR + E+ +     G          V+ +L  G S+ L   YN+ K+ IP +L+  SG  AD +  IL+
Sbjct:    6 FLTLQSWIPKLFKKKTCTTFIEDTKDSSPTKLCQCGALMINHVSVAMEDNFGAAMVSTWNSAEHTTEEPTDAYGDVEFVGAG----RKHSKFIRLSNDTDPA---SVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRK-GLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILE 319          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 179.489 bits (454), Expect = 7.755e-75
Identity = 161/642 (25.08%), Postives = 286/642 (44.55%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKI-----LKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKN-----------FDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHS--KKITPQ-DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLI-TEIFYRPYFQTYGELMLDEFHTNE 2885
            E   +++  I E  R+ + V+   D     +  I++A++ +   +  + +     LK+ + +N  DIA+ ++F            L +     L NN+ +FVKLF++N  +I D+LT   L  LY+  L    +   Y L+       +N            +S  K  ++ LY V +I+  + G++      H                   Q  +E +   K  +P  DLF+WA+L    E+A  FW++G E + SAL A  IL +   L R    ++ S  +   + KF+++AI V  E +   +   + LL+R    W   TCLQ+A   +   F +Q    S + + W G+++   P+W ++++     ++   LI  +  +   +  +    E Q P +M                          K F+  P+  F  +++ Y  FL +F Y+ L+E K+        +E  ++F++  ++ EEIRQ           K+K YL  SWN  DI  + ++II    R F   + F   R        +  LR++  + ++  LGPK+I++ +M+ D+FFFL    +++I+YG     L       M LS I   +FYRPY Q +G++  +EF  ++
Sbjct:  342 ENLTKMVERIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATD--LDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVL---DNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTH-------------------QIAVEKYQPRKSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKE---LSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTFFCPPLIYTDLITFNSVEQNGAPEAEIIKEKQRPRWMQR-----------------------WKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPDGPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRMF--NESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLL--HPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASK 928          

HSP 2 Score: 124.02 bits (310), Expect = 7.755e-75
Identity = 87/322 (27.02%), Postives = 142/322 (44.10%), Query Frame = 2
Query:   50 FL*MDLFIKKYFQIRYCYKYKGEIFET-----CKCGNIKTDHQDFPIKD-------EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGN---------VVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            FL +  +I K F+ + C  +  +  ++     C+CG +  +H    ++D         W+   +T     D +G + F G        +  FIR + +  P     VY L+   W    P L++SV GG       T  +    K  L++  +    WI+ GG  VGI   + EAV ++ +  +NS  +V  +GI  WG + N + L N     P  ++    +     LD++   FL  DDGT  Q   ET+FR + E+ +     G          V+ +L  G S+ L   YN+ K+ IP +L+  SG  AD +  IL+
Sbjct:    6 FLTLQSWIPKLFKKKTCTTFIEDTKDSSPTKLCQCGALMINHVSVAMEDNFGAAMVSTWNSAEHTTEEPTDAYGDVEFVGAG----RKHSKFIRLSNDTDPA---SVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRK-GLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILE 319          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 174.866 bits (442), Expect = 1.604e-73
Identity = 162/642 (25.23%), Postives = 290/642 (45.17%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKI-----LKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKN-----------FDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHS--KKITPQ-DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLI-TEIFYRPYFQTYGELMLDEFHTNE 2885
            E   +++  I E  R+ + V+   D     +  I++A++ +   +  + +     LK+ + +N  DIA+ ++F            L +     L NN+ +FVKLF++N  +I D+LT   L  LY+  L    +   Y L+       +N            +S  K  ++ LY V +I+  + G++      H                   Q  +E +   K  +P  DLF+WA+L    E+A  FW++G E + SAL A  IL +   L R    ++ S  +   + KF+++AI V  E +   +   + LL+R    W   TCLQ+A   +   F +Q    S + + W G+++   P+W ++++     ++   LI     +P     S+  +   TP  +   ++   R      +       +  K F+  P+  F  +++ Y  FL +F Y+ L+E K+        +E  ++F++  ++ EEIRQ           K+K YL  SWN  DI  + ++II    R F   + F   R        +  LR++  + ++  LGPK+I++ +M+ D+FFFL    +++I+YG     L       M LS I   +FYRPY Q +G++  +EF  ++
Sbjct:  342 ENLTKMVERIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATD--LDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVL---DNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTH-------------------QIAVEKYQPRKSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKE---LSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTFFCPPLIYTDLI---TFKPNNYMISSHLSIDPTPHTVTINSNLLGR------EGCCRLLPERWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPDGPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRMF--NESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLL--HPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDASK 942          

HSP 2 Score: 124.405 bits (311), Expect = 1.604e-73
Identity = 87/322 (27.02%), Postives = 142/322 (44.10%), Query Frame = 2
Query:   50 FL*MDLFIKKYFQIRYCYKYKGEIFET-----CKCGNIKTDHQDFPIKD-------EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGN---------VVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            FL +  +I K F+ + C  +  +  ++     C+CG +  +H    ++D         W+   +T     D +G + F G        +  FIR + +  P     VY L+   W    P L++SV GG       T  +    K  L++  +    WI+ GG  VGI   + EAV ++ +  +NS  +V  +GI  WG + N + L N     P  ++    +     LD++   FL  DDGT  Q   ET+FR + E+ +     G          V+ +L  G S+ L   YN+ K+ IP +L+  SG  AD +  IL+
Sbjct:    6 FLTLQSWIPKLFKKKTCTTFIEDTKDSSPTKLCQCGALMINHVSVAMEDNFGAAMVSTWNSAEHTTEEPTDAYGDVEFVGAG----RKHSKFIRLSNDTDPA---SVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRK-GLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILE 319          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 175.252 bits (443), Expect = 5.086e-73
Identity = 168/661 (25.42%), Postives = 296/661 (44.78%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKI-----LKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKN-----------FDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQS-----------QSFIEVHSKKITPQ-------DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLI-TEIFYRPYFQTYGELMLDEFHTNESTNQ 2897
            E   +++  I E  R+ + V+   D     +  I++A++ +   +  + +     LK+ + +N  DIA+ ++F            L +     L NN+ +FVKLF++N  +I D+LT   L  LY+  L    +   Y L+       +N            +S  K  ++ LY V +I+  + G++      H   G      ++ N    S           +S  ++  +K  P+       DLF+WA+L    E+A  FW++G E + SAL A  IL +   L R    ++ S  +   + KF+++AI V  E +   +   + LL+R    W   TCLQ+A   +   F +Q    S + + W G+++   P+W ++++     ++   LI  +      S R +    S    F++ A           K+K    +    K F+  P+  F  +++ Y  FL +F Y+ L+E K+        +E  ++F++  ++ EEIRQ           K+K YL  SWN  DI  + ++II    R F   + F   R        +  LR++  + ++  LGPK+I++ +M+ D+FFFL    +++I+YG     L       M LS I   +FYRPY Q +G++  +EF    S  Q
Sbjct:  339 ENLTKMVERIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATD--LDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVL---DNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHVL-GNMKGSVNKRNSGVSSIWKPPKSVYIKKSMEQIAVEKYQPRKSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKE---LSRMESEAEESLAMRDLAAKFEQLAI-VFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTFFCPPLIYTDLI--TFKDAVGSCRKSGELTSGEGPFLFLAPEA-----EIIKEKQRPRWMQRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPDGPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRMF--NESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLL--HPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDGERSIFQ 977          

HSP 2 Score: 122.094 bits (305), Expect = 5.086e-73
Identity = 85/316 (26.90%), Postives = 139/316 (43.99%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKYKGEIFET-----CKCGNIKTDHQDFPIKD-------EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGN---------VVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            +I K F+ + C  +  +  ++     C+CG +  +H    ++D         W+   +T     D +G + F G        +  FIR + +  P     VY L+   W    P L++SV GG       T  +    K  L++  +    WI+ GG  VGI   + EAV ++ +  +NS  +V  +GI  WG + N + L N     P  ++    +     LD++   FL  DDGT  Q   ET+FR + E+ +     G          V+ +L  G S+ L   YN+ K+ IP +L+  SG  AD +  IL+
Sbjct:    9 WIPKLFKKKTCTTFIEDTKDSSPTKLCQCGALMINHVSVAMEDNFGAAMVSTWNSAEHTTEEPTDAYGDVEFVGAG----RKHSKFIRLSNDTDPA---SVYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRK-GLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGKGSIEIPVLCMLIAGESKMLGRVYNATKSPIPCLLVAGSGGVADCLAEILE 316          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Xenopus
Match: shc2 (SHC (Src homology 2 domain containing) transforming protein 2 [Source:Xenbase;Acc:XB-GENE-6073771])

HSP 1 Score: 183.341 bits (464), Expect = 1.721e-68
Identity = 166/640 (25.94%), Postives = 292/640 (45.62%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKI-----LKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKN-----------FDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQ-DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLI-TEIFYRPYFQTYGELMLDEFHTNE 2885
            E   +++  I E  R+ + V+   D     +  I++A++ +   +  + +     LK+ + +N  DIA+ ++F            L +     L NN+ +FVKLF++N  +I D+LT   L  LY+  L    +   Y L+       +N            +S  K  ++ LY V +I+  + G++      H   G      ++ N  +Q +       K  +P  DLF+WA+L    E+A  FW++G E + SAL A  IL +   L R    ++ S  +   + KF+++AI V  E +   +   + LL+R    W   TCLQ+A   +   F +Q    S + + W G+++   P+W ++++     ++   LI     +    E   ESA+      M   ++  K    Q  +     +    K F+  P+  F  +++ Y  FL +F Y+ L+E K+        +E  ++F++  ++ EEIRQ           K+K YL  SWN  DI  + ++II    R F   + F   R        +  LR++  + ++  LGPK+I++ +M+ D+FFFL    +++I+YG     L       M LS I   +FYRPY Q +G++  +EF   E
Sbjct:  247 ENLTKMVERIVEN-RDLVTVYSDADGIEDFETVILKALVKACKKHSSDAVEYLDELKLAVAWNREDIAKTELFHGEILWKATD--LDDTMTDALINNKPKFVKLFVDNGLNIVDYLTYGRLEELYSSVL---DNTLLYQLLKSKHDEHRNSKTKDHHELLFMESNGKGREFKLYEVSKILRDLLGDVCTTFYTHVL-GNMKGSVNKRNSGYQPR-------KSTSPWIDLFIWAILQNRDEMATYFWEMGSEAVTSALAAMKILKE---LSRMESEAEESLAMRDLAAKFEQLAIGVFNECYRNSENRAFKLLVRRSVIWGGATCLQLAYEADARNFFAQDGVQSMLTENWWGQMAQNTPVWAMVLTFFCPPLIYTDLI---TFKSIDHENGIESAQRME---MDSLDTDIKTTVKQRPR-----WMQRWKQFWSAPVTAFFGNVVMYFAFLFLFSYVLLLEFKMPPPDGPANSEFILYFWIFTMVCEEIRQSFFVGTMPVAQKVKQYLQDSWNHVDIIALCLFIIGLICRMF--NESFEAGRTILCFDFMVFTLRLIHIFAVNKQLGPKIIIVRKMMKDVFFFLFFLGVWLIAYGVTTEGLL--HPTDMRLSWIFRRVFYRPYLQIFGQIPQEEFDEAE 854          

HSP 2 Score: 98.5969 bits (244), Expect = 1.721e-68
Identity = 68/221 (30.77%), Postives = 101/221 (45.70%), Query Frame = 2
Query:  332 VYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRE--------------NDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            VY L+   W    P L++SV GG       T  +    K  L++  +    WI+ GG  VGI   + EAV ++ +  +NS  +V  +GI  WG + N + L N     P  ++    +     LD++   FL  DDGT  Q   ET+FR + E+ +                NDN NV  ILY       +  YN+ K+ IP +L+  SG  AD +  IL+
Sbjct:   12 VYSLITYNWKIPPPNLVVSVVGGDGDFKMKTWLKDILRK-GLVKAAQSTGAWIMTGGMQVGIGKYVGEAVRDHATANSNSRTKVVAMGIAPWGIVHNRQSLVNPKGSFPATYYMDNVDGPTYSLDNNYSVFLLADDGTHGQMGGETSFRFRLEEHISRQKTGAGGRFDYGPLNDNRNVA-ILY------FQRVYNATKSPIPCLLVAGSGGVADCLAEILE 224          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Mouse
Match: Trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:MGI Symbol;Acc:MGI:1351901])

HSP 1 Score: 165.236 bits (417), Expect = 1.579e-70
Identity = 142/585 (24.27%), Postives = 260/585 (44.44%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFV--HDLFDKSMKLDRKIVEAVISSIDDND------LEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKP-----GRQLIRTDEENFEFQSQSFIEVHSKK-------ITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII-DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVD 2708
            +K Q+I+R      R Q+     +  D    +D  I++A++ +    D       +  LK+ + +N  DIA  ++F   D        LH      L +N+ EFV+LFLEN   +++F+T + L  LY +   ++PS   +  +  +   ++         +  ++ V +++  + G+  Q   ++P+P      R  +         Q  S   ++ +        I P +DL +WA++    ELA I W   ++   +AL  S IL ++           +  ML+ A + F+  AI V TE + K +E    LL+R  + W   TCLQ+A+    ++F+S     +++ K+W G+L     +W               +I+  +  P                 ++     F+      K+  ++     ++ F+  P+V F ++++SY  FL +F Y+ +V+ + +      W E  I+ ++  ++ EE RQ+  D +  G +     Y S  WN  D+  IL++I+   L C L        R   S+   M CLR+M  + IS TLGPK+I++ RM+ D
Sbjct:  403 KKIQDIVR------RRQLLTIFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIF--TDEWQWKPADLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYEN---LEPSCLFHSKLQKVLAEEQRLAYASATPRLHMHHVAQVLRELLGDSTQL--LYPRPRYTDRPRLSMTVPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAVIQNHRELAGIIWAQSQDCTAAALACSKILKELSKEEED--TDSSEEMLALADE-FEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLW--------------RIILCMLAFP----------------LLFTGFISFR-----EKRLQALCRPARVRAFFNAPVVIFHMNILSYFAFLCLFAYVLMVDFQPS----PSWCEYLIYLWLFSLVCEETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIVG--LTCRLIPATLYPGRIILSLDFIMFCLRLMHIFTISKTLGPKIIIVKRMMKD 930          

HSP 2 Score: 122.865 bits (307), Expect = 1.579e-70
Identity = 87/293 (29.69%), Postives = 136/293 (46.42%), Query Frame = 2
Query:  128 TCKCGNIKTDHQDFPIKDEI-----WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN--DNGNV------VQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 955
             C CG     H +  IK        W  + + +    D FG I FT  +  +      ++R + +D P    V+Y+LM  +W    P L+ISVTGG K  N     +    +  L++V +    WII GG + G+   + EAV ++    +    +V  +G+ TWG I N + L +     P  +   +  +G +  LDS+   F+  DDGT  QY  E   R K EK + E   + G V      V ++ EGG   L + YN++    P V+++ SGR ADVI  +  L ++
Sbjct:   87 VCACGYTHEQHLEVAIKPHTFQGKEWDPKKHVQEMPTDAFGDIVFTDLSQKVGK----YVRVS-QDTPS--SVIYQLMTQHWGLDVPNLLISVTGGAKNFNMKLRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSCKEGEVITIGVATWGTIHNREGLIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAINNGTPCVIVEGSGRVADVIAQVATLPVS 371          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Mouse
Match: Trpm4 (transient receptor potential cation channel, subfamily M, member 4 [Source:MGI Symbol;Acc:MGI:1915917])

HSP 1 Score: 171.014 bits (432), Expect = 9.509e-43
Identity = 154/630 (24.44%), Postives = 295/630 (46.83%), Query Frame = 3
Query: 1113 RKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFL-NADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQ------NENIHPK-PGRQ-----LIRTDEENFEF-----QSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIM--PSVNQPTQSERS---NESAESQTPEFMYEANSPFKRHYSQSK--------KKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII------------DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEF 2873
            R +V+A  SS     L++ L++ + +N  DIA+ ++F  +  ++S +   L  +    L N++ EFV+L + +  S+  FLT   L  LY+    V P+    L+ + +   D+   +   KS     PV   + +   N+ Q       E   P+ P R      L +   EN          Q   +   ++    DL +WALL    ++AI FW+ G   + SAL A ++L  M    R    ++ +A     +  F+ M++ +  E ++  +E    LL+R    W   TCLQ+A+  +   F +Q    S + + W GE+    P+W +L++     ++   LI+   S  +PTQ +     + S     P    E ++       Q +         K S  + D    F+  P+  F+ +++SY+LFLL+F ++ LV+ +     +   +E+ ++F+   ++ EE+RQ +              +R    ++L  YLS +WN  D+  +  +++   + C L+  LF + R    +   +  LR++  + ++  LGPK++++ +M+ D+FFFL    +++++YG     +   + R++  S++  +FYRPY Q +G++  +E 
Sbjct:  233 RALVKACGSSEASAYLDE-LRLAVAWNRVDIAQSELFRGDIQWRSFH---LEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYS---AVSPNS---LIRNLL---DQASHASSSKSP----PVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVM---ARLESEAEEAARRKDLAATFESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAFFCPPLIYTNLIVFRKSEEEPTQKDLDFDMDSSINGAGPPGTVEPSAKVALERRQRRRPGRALCCGKFSKRWSD----FWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQ---PTKPSVSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLG--VGCRLTPGLFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLP-SILRRVFYRPYLQIFGQIPQEEM 832          

HSP 2 Score: 77.0258 bits (188), Expect = 1.164e-13
Identity = 48/167 (28.74%), Postives = 79/167 (47.31%), Query Frame = 2
Query:  482 TWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPT----YHFTKKTEKG-KVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG--------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
             WI+ GG + GI   +  AV ++++    SS  V + G+  WG + N  +L N   +    Y +    E G +  LD +   F   DDGT  +   E  FRL+FE  V +   G         V+ +L +G  + L+   ++ +A +P +L+  SG AAD +   L+
Sbjct:    5 AWIVTGGLHTGIGRHVGVAVRDHQTASTGSSKVVAM-GVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLE 170          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Mouse
Match: Trpm4 (transient receptor potential cation channel, subfamily M, member 4 [Source:MGI Symbol;Acc:MGI:1915917])

HSP 1 Score: 170.629 bits (431), Expect = 1.657e-42
Identity = 151/626 (24.12%), Postives = 293/626 (46.81%), Query Frame = 3
Query: 1113 RKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFL-NADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQ------NENIHPK-PGRQ-----LIRTDEENFEF-----QSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIM--PSVNQPTQSERS---NESAESQTPEFMYEANSPFKRHYSQSKKKASI----PYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII------------DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEF 2873
            R +V+A  SS     L++ L++ + +N  DIA+ ++F  +  ++S +   L  +    L N++ EFV+L + +  S+  FLT   L  LY+    V P+    L+ + +   D+   +   KS     PV   + +   N+ Q       E   P+ P R      L +   EN          Q   +   ++    DL +WALL    ++AI FW+ G   + SAL A ++L  M    R    ++ +A     +  F+ M++ +  E ++  +E    LL+R    W   TCLQ+A+  +   F +Q    S + + W GE+    P+W +L++     ++   LI+   S  +PTQ +     + S     P    E ++       Q ++         +      F+  P+  F+ +++SY+LFLL+F ++ LV+ +     +   +E+ ++F+   ++ EE+RQ +              +R    ++L  YLS +WN  D+  +  +++   + C L+  LF + R    +   +  LR++  + ++  LGPK++++ +M+ D+FFFL    +++++YG     +   + R++  S++  +FYRPY Q +G++  +E 
Sbjct:  380 RALVKACGSSEASAYLDE-LRLAVAWNRVDIAQSELFRGDIQWRSFH---LEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYS---AVSPNS---LIRNLL---DQASHASSSKSP----PVNGTVELRPPNVGQVLRTLLGETCAPRYPARNTRDSYLGQDHRENDSLLMDWANKQPSTDASFEQAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVM---ARLESEAEEAARRKDLAATFESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSTTPIWALLLAFFCPPLIYTNLIVFRKSEEEPTQKDLDFDMDSSINGAGPPGTVEPSAKVALERRQRRRPGRALCCGKFSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQ---PTKPSVSELLLYFWAFTLLCEELRQGLGGGWGSLASGGRGPDRAPLRHRLHLYLSDTWNQCDLLALTCFLLG--VGCRLTPGLFDLGRTVLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLP-SILRRVFYRPYLQIFGQIPQEEM 979          

HSP 2 Score: 109.768 bits (273), Expect = 1.145e-23
Identity = 79/317 (24.92%), Postives = 142/317 (44.79%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKYKGEIFE-----TCKCGNIKTDHQDFPIKDEI-------WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPT----YHFTKKTEKG-KVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG--------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            +I K F+ + C  +  ++ +      C+CG  +  H    ++D         W+ + +T  +  D +G ++FT Y+      + +F+R +    P     VY L+   W F  P L++SV GG           +   ++ L+   +    WI+ GG + GI   +  AV ++++    SS +V  +G+  WG + N  +L N   +    Y +    E G +  LD +   F   DDGT  +   E  FRL+FE  V +   G         V+ +L +G  + L+   ++ +A +P +L+  SG AAD +   L+
Sbjct:   10 WIPKIFRKKVCTTFIVDLSDDAGGTLCQCGQPRDAHPSVAVEDAFGAAVVTEWNSDEHTTEKPTDAYGDLDFT-YSG---RKHSNFLRLSDRTDPA---TVYSLVTRSWGFRAPNLVVSVLGG-SGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGSS-KVVAMGVAPWGVVRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTGVGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLE 317          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Mouse
Match: Trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:MGI Symbol;Acc:MGI:1861718])

HSP 1 Score: 163.696 bits (413), Expect = 1.923e-40
Identity = 150/629 (23.85%), Postives = 295/629 (46.90%), Query Frame = 3
Query: 1092 DKSMKLDRKIVEAVISSIDDNDLEKI-----LKITIKFNCFDIAEKKVFLNAD--YQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIAT-------TDKNFDSKRKK------SKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASK--KFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKD------------MIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQ-IIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
            + S  LD  I++A++ +   +  E       LK+ + ++  DIA+ ++F N D  ++S +   L E     L +N+ +FV+LF+++   + +FLT   L  LY HS+  K      LL + +         T     +++ +        + L+ V R++     +  +      + GR++            +   ++  K   P +DLFLWA+L    E+A  FW +G E + +AL A  I+ +M  L       +  A ++R  +  K++++A+ + +E +   ++  + LL+R   +W+  TCL +A   +   F +     +++ KIW G+++   P+ ++L +     ++   LI  S + P + +  +     Q P+ +    S       Q +K    P                 + F+  P+  F+ +++ Y  FL +F Y+ LV+ +   +  +  +E+ ++F+V  ++ EEIRQ     E T  + K   Y+  +WN  D+  I ++I+   + C +   +F   R   ++   +  LR++  + I   LGPK+I++ RM+ D+FFFL   S+++++YG    AL       +   +   + YRPY Q +G++ LDE
Sbjct:  324 EGSEDLDTVILKALVKACKSHSQEAQDYLDELKLAVAWDRVDIAKSEIF-NGDVEWKSCD---LEEVMTDALVSNKPDFVRLFVDSGADMAEFLTYGRLQQLY-HSVSPK-----SLLFELLQRKHEEGRLTLAGLGAQQARELPIGLPAFSLHEVSRVLKDFLHDACRGFY---QDGRRMEERGPPKRPAGQKWLPDLSRKSEDPWRDLFLWAVLQNRYEMATYFWAMGREGVAAALAACKIIKEMSHL-------EKEAEVARTMREAKYEQLALDLFSECYGNSEDRAFALLVRRNHSWSRTTCLHLATEADAKAFFAHDGVQAFLTKIWWGDMATGTPILRLLGAFTCPALIYTNLISFSEDAPQRMDLED----LQEPDSLDMEKSFLCSRGGQLEKLTEAPRAPGDLGPQAAFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSG-SEVTLYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMVAIFLFIVG--VTCRMVPSVFEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDGRLEW-IFRRVLYRPYLQIFGQIPLDE 924          

HSP 2 Score: 60.8474 bits (146), Expect = 9.273e-9
Identity = 54/255 (21.18%), Postives = 112/255 (43.92%), Query Frame = 2
Query:  233 GIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKIL----CNENPTYHFTKKTEKGKV-----LLDSHCDGFLFCDDGT-EKQYDKETNFRLKFEKCVRENDNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAIL 940
            G INF G           F++     AP    V+++L++  W+   P L++S+ G  +R     +  +   ++ L++  +    WI+    +VG+   + +AV ++     ++  +V  +G+ +   IL+ ++L      E+   H+    ++G +      LDS+   F+  + G      D  T  +L  EK + +   G          V+ +L  G    LE    +++ + P +++  SG  ADV+ A++
Sbjct:   26 GEINFGGSG----KKRGKFVKVPSSVAPS---VLFELLLTEWHLPAPNLVVSLVGE-ERPLAMKSWLRDVLRKGLVKAAQSTGAWILTSALHVGLARHVGQAVRDHSLASTSTKIRVVAIGMASLDRILHRQLLDGVHQKEDTPIHY--PADEGNIQGPLCPLDSNLSHFILVESGALGSGNDGLTELQLSLEKHISQQRTGYGGTSCIQIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALV 270          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Mouse
Match: Trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:MGI Symbol;Acc:MGI:1861718])

HSP 1 Score: 163.696 bits (413), Expect = 2.776e-40
Identity = 150/629 (23.85%), Postives = 295/629 (46.90%), Query Frame = 3
Query: 1092 DKSMKLDRKIVEAVISSIDDNDLEKI-----LKITIKFNCFDIAEKKVFLNAD--YQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIAT-------TDKNFDSKRKK------SKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASK--KFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKD------------MIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQ-IIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
            + S  LD  I++A++ +   +  E       LK+ + ++  DIA+ ++F N D  ++S +   L E     L +N+ +FV+LF+++   + +FLT   L  LY HS+  K      LL + +         T     +++ +        + L+ V R++     +  +      + GR++            +   ++  K   P +DLFLWA+L    E+A  FW +G E + +AL A  I+ +M  L       +  A ++R  +  K++++A+ + +E +   ++  + LL+R   +W+  TCL +A   +   F +     +++ KIW G+++   P+ ++L +     ++   LI  S + P + +  +     Q P+ +    S       Q +K    P                 + F+  P+  F+ +++ Y  FL +F Y+ LV+ +   +  +  +E+ ++F+V  ++ EEIRQ     E T  + K   Y+  +WN  D+  I ++I+   + C +   +F   R   ++   +  LR++  + I   LGPK+I++ RM+ D+FFFL   S+++++YG    AL       +   +   + YRPY Q +G++ LDE
Sbjct:  324 EGSEDLDTVILKALVKACKSHSQEAQDYLDELKLAVAWDRVDIAKSEIF-NGDVEWKSCD---LEEVMTDALVSNKPDFVRLFVDSGADMAEFLTYGRLQQLY-HSVSPK-----SLLFELLQRKHEEGRLTLAGLGAQQARELPIGLPAFSLHEVSRVLKDFLHDACRGFY---QDGRRMEERGPPKRPAGQKWLPDLSRKSEDPWRDLFLWAVLQNRYEMATYFWAMGREGVAAALAACKIIKEMSHL-------EKEAEVARTMREAKYEQLALDLFSECYGNSEDRAFALLVRRNHSWSRTTCLHLATEADAKAFFAHDGVQAFLTKIWWGDMATGTPILRLLGAFTCPALIYTNLISFSEDAPQRMDLED----LQEPDSLDMEKSFLCSRGGQLEKLTEAPRAPGDLGPQAAFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLVDFRPPPQGPSG-SEVTLYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMVAIFLFIVG--VTCRMVPSVFEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDGRLEW-IFRRVLYRPYLQIFGQIPLDE 924          

HSP 2 Score: 61.2326 bits (147), Expect = 8.898e-9
Identity = 54/255 (21.18%), Postives = 112/255 (43.92%), Query Frame = 2
Query:  233 GIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKIL----CNENPTYHFTKKTEKGKV-----LLDSHCDGFLFCDDGT-EKQYDKETNFRLKFEKCVRENDNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAIL 940
            G INF G           F++     AP    V+++L++  W+   P L++S+ G  +R     +  +   ++ L++  +    WI+    +VG+   + +AV ++     ++  +V  +G+ +   IL+ ++L      E+   H+    ++G +      LDS+   F+  + G      D  T  +L  EK + +   G          V+ +L  G    LE    +++ + P +++  SG  ADV+ A++
Sbjct:   26 GEINFGGSG----KKRGKFVKVPSSVAPS---VLFELLLTEWHLPAPNLVVSLVGE-ERPLAMKSWLRDVLRKGLVKAAQSTGAWILTSALHVGLARHVGQAVRDHSLASTSTKIRVVAIGMASLDRILHRQLLDGVHQKEDTPIHY--PADEGNIQGPLCPLDSNLSHFILVESGALGSGNDGLTELQLSLEKHISQQRTGYGGTSCIQIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALV 270          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. UniProt/SwissProt
Match: sp|A7T1N0|TMP2L_NEMVE (Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 3.933e-70
Identity = 194/774 (25.06%), Postives = 353/774 (45.61%), Query Frame = 3
Query: 1011 KDIEKFQEILREIYEKYRNQIFVHDLFDK-SMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNH---SLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQL--IRTDEENFEFQ---SQSFIEVHSKKITPQ-----DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRH-----------YSQSKKKAS----------------------IP------------------YKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWA----EIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIAL----QDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSF 3110
            K  +K   +++++ E  +  I V+ L  + S  +D  I++A++ +   + + + L + + +N  D+A+  +F   + Q    + L       L +++ EF +LFL+N  S+ +FL+ + L  LY     +  +KP     LL   +         KR+     +  V  +I  + G++   E+ + K G     + +  E    +   S   +  +  +I P      D+FLWA+L    ELA + W+ G E + +AL+AS +L +M    ++    +D S+ L   ++ F+E A+ V+ E  N+ +  + TLL+R L  ++ MT L++A+S    +F++ ++C   + ++W G ++     WK+L+ +         LI P +      +   ++AE +  + + + +S  K H           Y   ++KA                       IP                  + D I  FY  P  KFV +++ Y+ F+ ++ Y+ L         +        EI ++F+V  I+ EEIRQ+  +       K+  Y S +WN  DI  + V+II   LR F +  +F  +R   S+ +    +R +Q + ++  LGPK++MI +M+ D+  F+ I ++F I+YG    A+        +R      IT +   PY+Q YGEL LDE    +               P +  E   D     GR       A++++ TNILL+NLLIA+F +TF ++Q +S K + F
Sbjct:  373 KGADKTYSMIKDVLEDEK-MISVYSLDGEISQDIDLAILKALLKANRSSPVAQ-LNLALAWNRIDLAKSDIF--TEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGNTTIKP-----LLQKEMG--------KRQVKTIDMDVVGEVIEELMGDMF--ESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPV-----LIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTNSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGEK---------------PKEFGEVDPD-----GRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKF 1102          

HSP 2 Score: 122.479 bits (306), Expect = 3.933e-70
Identity = 95/330 (28.79%), Postives = 147/330 (44.55%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKY--KGEIFETCKCGNIKTDHQDFPIKD----EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN----PTYHFTKKTEKGK-VLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV------RENDNGN----VVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTRKDKINIKCQPIN 994
            +I + F  R C ++  K      CKCG  +  H    ++     E W++ + T     + +G I+F GY        P+    +  DA     +V  LM+  WN   P L+ISVTGG K        ++   +  LI+  K    WII GG N G+   + EAV E +     S  QV ++GI TWG +     L +E     P  +  + T   +  +LD +   F   DDGTE +Y  E   R + E+ +        ++ G+    VV ++ EGG   + + Y  +K  +P V+I  SGRAA V+    +  + R    N+  Q IN
Sbjct:   35 WIARNFSRRECIRFVPKSHDVSRCKCGRPRERHSQQALESGQGSEEWNVASCTTKHPTNAYGEIDFEGYGG--QKRAPYLRMSHDTDA----NLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRR-GLIKAAKTTGAWIITGGTNTGVMKHVGEAVKE-QQLMFGSDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIKR----NVDGQTIN 352          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. UniProt/SwissProt
Match: sp|Q91YD4|TRPM2_MOUSE (Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus OX=10090 GN=Trpm2 PE=1 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 9.638e-70
Identity = 142/585 (24.27%), Postives = 260/585 (44.44%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFV--HDLFDKSMKLDRKIVEAVISSIDDND------LEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKP-----GRQLIRTDEENFEFQSQSFIEVHSKK-------ITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII-DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVD 2708
            +K Q+I+R      R Q+     +  D    +D  I++A++ +    D       +  LK+ + +N  DIA  ++F   D        LH      L +N+ EFV+LFLEN   +++F+T + L  LY +   ++PS   +  +  +   ++         +  ++ V +++  + G+  Q   ++P+P      R  +         Q  S   ++ +        I P +DL +WA++    ELA I W   ++   +AL  S IL ++           +  ML+ A + F+  AI V TE + K +E    LL+R  + W   TCLQ+A+    ++F+S     +++ K+W G+L     +W               +I+  +  P                 ++     F+      K+  ++     ++ F+  P+V F ++++SY  FL +F Y+ +V+ + +      W E  I+ ++  ++ EE RQ+  D +  G +     Y S  WN  D+  IL++I+   L C L        R   S+   M CLR+M  + IS TLGPK+I++ RM+ D
Sbjct:  403 KKIQDIVR------RRQLLTIFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIF--TDEWQWKPADLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYEN---LEPSCLFHSKLQKVLAEEQRLAYASATPRLHMHHVAQVLRELLGDSTQL--LYPRPRYTDRPRLSMTVPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAVIQNHRELAGIIWAQSQDCTAAALACSKILKELSKEEED--TDSSEEMLALADE-FEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLW--------------RIILCMLAFP----------------LLFTGFISFR-----EKRLQALCRPARVRAFFNAPVVIFHMNILSYFAFLCLFAYVLMVDFQPS----PSWCEYLIYLWLFSLVCEETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIVG--LTCRLIPATLYPGRIILSLDFIMFCLRLMHIFTISKTLGPKIIIVKRMMKD 930          

HSP 2 Score: 122.865 bits (307), Expect = 9.638e-70
Identity = 87/293 (29.69%), Postives = 136/293 (46.42%), Query Frame = 2
Query:  128 TCKCGNIKTDHQDFPIKDEI-----WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN--DNGNV------VQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 955
             C CG     H +  IK        W  + + +    D FG I FT  +  +      ++R + +D P    V+Y+LM  +W    P L+ISVTGG K  N     +    +  L++V +    WII GG + G+   + EAV ++    +    +V  +G+ TWG I N + L +     P  +   +  +G +  LDS+   F+  DDGT  QY  E   R K EK + E   + G V      V ++ EGG   L + YN++    P V+++ SGR ADVI  +  L ++
Sbjct:   87 VCACGYTHEQHLEVAIKPHTFQGKEWDPKKHVQEMPTDAFGDIVFTDLSQKVGK----YVRVS-QDTPS--SVIYQLMTQHWGLDVPNLLISVTGGAKNFNMKLRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSCKEGEVITIGVATWGTIHNREGLIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAINNGTPCVIVEGSGRVADVIAQVATLPVS 371          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. UniProt/SwissProt
Match: sp|E9PTA2|TRPM2_RAT (Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3)

HSP 1 Score: 162.155 bits (409), Expect = 3.105e-69
Identity = 145/587 (24.70%), Postives = 261/587 (44.46%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFV--HDLFDKSMKLDRKIVEAVISSIDDND------LEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYL--LVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKP-----GRQLIRTDEENFEFQSQSFIEVHSKK-------ITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII-DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVD 2708
            +K Q+I+R      R Q+     +  D    +D  I++A++ +    D       +  LK+ + +N  DIA  ++F   D        LH      L +N+ EFV+LFLEN   +++F+T + L  LY +   ++PS C +   L   +A   +      +  +  ++ V +++  + G+  Q   ++P+P      R  +         Q  S   ++ +        I P +DL +WA++    ELA I W   ++   +AL  S IL ++           +  ML+ A + F+  AI V TE + K +E    LL+R  + W   TCLQ+A+    ++F+S     +++ K+W G+L     +W               +I+  +  P                 ++     F+    Q+  + +      ++ F+  P+V F ++++SY  FL +F Y+ +V+ + +      W E  I+ ++  ++ EE RQ+  D +  G +     Y S  WN  D+  IL++I    L C L        R   S+   M CLR+M  + IS TLGPK+I++ RM+ D
Sbjct:  403 KKIQDIVR------RRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIF--TDEWQWKPSDLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYEN---LEPS-CLFHSKLQKVLAEEHERLAYASETPRLQMHHVAQVLRELLGDSTQL--LYPRPRYTDRPRLSLPMPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAIIQNHRELAGIIWAQSQDCTAAALACSKILKELSKEEED--TDSSEEMLALADE-FEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLW--------------RIILCMLAFP----------------LLFTGFISFREKRLQALCRLA-----RVRAFFNAPVVIFYLNILSYFAFLCLFAYVLMVDFQPS----PSWCEYLIYLWLFSLVCEETRQLFYDPDGCGLMKMASLYFSDFWNKLDVGAILLFIAG--LTCRLIPATLYPGRIILSLDFIMFCLRLMHIFTISKTLGPKIIIVKRMMKD 931          

HSP 2 Score: 124.405 bits (311), Expect = 3.105e-69
Identity = 89/293 (30.38%), Postives = 136/293 (46.42%), Query Frame = 2
Query:  128 TCKCGNIKTDHQDFPIKDEI-----WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN--DNGNV------VQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 955
             C+CG     H +  IK        W  + +      D FG I FTG +  +      ++R + +D   IV  +Y+LM  +W    P L+ISVTGG K  N     +    +  L++V +    WII GG + G+   + EAV ++    +     V  +GI TWG I N + L +     P  +   +  +G +  LDS+   F+  DDGT  QY  E   R K EK + E   + G V      V ++ EGG   L + YN++    P V+++ SGR ADVI  +  L ++
Sbjct:   87 VCECGYTHEQHIEVAIKPHTFQGKEWDPKKHVHEMPTDAFGDIVFTGLSQKVGK----YVRLS-QDTSSIV--IYQLMTQHWGLDVPSLLISVTGGAKNFNMKLRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSCKEGDVITIGIATWGTIHNREALIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAITNGTPCVIVEGSGRVADVIAQVAALPVS 371          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. UniProt/SwissProt
Match: sp|O94759|TRPM2_HUMAN (Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 9.504e-67
Identity = 148/586 (25.26%), Postives = 264/586 (45.05%), Query Frame = 3
Query: 1020 EKFQEILREIYEKYRNQIFV--HDLFDKSMKLDRKIVEAVISSIDDND------LEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYL-LYPVRRIINMMSGNILQNENIHPKPG-----RQLIRTDEENFEFQSQSFIEVHSKK-------ITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQII-DQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVD 2708
            +K Q+I+R      R Q+     +  D    +D  I++A++ +    D       +  LK+ + +N  DIA  ++F+  D        LH      L +N+ EFVKLFLEN   +++F+T + L  LY +   + PS   +  +  +   D    +    +  L ++ V +++  + G+  Q   ++P+P      R L+         Q  S   ++ +        + P +DL +WA++    ELA I W   ++ I +AL  S IL ++           +  ML+ A ++++  AI V TE + K +E    LL R  + W   TCLQ+A+    ++F+S     +++ K+W G+LS    +W++ + +    +L+  LI         S R     +  TP                             + F+  P+V F ++++SY  FL +F Y+    L ++ +    W E  I+ ++  ++ EE+RQ+  D +  G + K   Y S  WN  D+  IL+++    L C L        R   S+   + CLR+M  + IS TLGPK+I++ RM+ D
Sbjct:  404 KKIQDIVR------RRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFM--DEWQWKPSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYEN---LDPSCLFHSKLQKVLVEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQP--LYPRPRHNDRLRLLLPVPHVKLNVQGVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILKELSKEEED--TDSSEEMLALA-EEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLI---------SFREKRLQDVGTPAA-------------------------RARAFFTAPVVVFHLNILSYFAFLCLFAYV----LMVDFQPVPSWCECAIYLWLFSLVCEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAG--LTCRLIPATLYPGRVILSLDFILFCLRLMHIFTISKTLGPKIIIVKRMMKD 933          

HSP 2 Score: 115.161 bits (287), Expect = 9.504e-67
Identity = 82/293 (27.99%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  128 TCKCGNIKTDHQDFPIKDEI-----WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN--DNGNV------VQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 955
             C+CG     H +   K        W  + + +    D FG I FTG +  +      ++R + +D P    V+Y LM  +W    P L+ISVTGG K  N     +    +  L++V +    WII GG + G+   + EAV ++    +    ++  +G+ TWG +   + L +     P  +   +  +G +  LDS+   F+  DDGT  QY  E   R + EK + E   + G V      V ++ EGG   L +  N+     P V+++ SGR ADVI  + +L ++
Sbjct:   88 VCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQEMPTDAFGDIVFTGLSQKVKK----YVRVS-QDTPS--SVIYHLMTQHWGLDVPNLLISVTGGAKNFNMKPRLKSIFRR-GLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIGVATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIPLRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVADVIAQVANLPVS 372          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. UniProt/SwissProt
Match: sp|Q9BX84|TRPM6_HUMAN (Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 3.633e-60
Identity = 167/691 (24.17%), Postives = 302/691 (43.70%), Query Frame = 3
Query:  987 QSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDL-FDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN----------HSLYVKPSR----CGY--------LLVDFIATTDKNFDSKRKKSKYL---LYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQ-----------------DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPS-------------------VNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
            Q+T N   K  +   +IL E    +R+ I + D   ++   LD  I+ A++   + +  E+ L + + ++  DIA+K + +    Q      L +     L  ++++FVKL +E   ++  FLT   L  LYN          H L     +     GY        L+V+++       +  RK  + L   LY   +     SGN  +NE+       Q IRT +  ++F+ +S +   S+K + +                 DL +WA+L +  ++A+ FW+ GEE    A+IA I+   M    ++     D S  L   SK+F ++A+ ++ +A  + +    TLL   L+ W+N TCL++A+SG L  F+S +     +  +W G L      W  +I        I  L   S                    +Q   S + + S +    E  ++      +H+        +P+   +  FY  PIVKF  + ++Y+ FL++F Y  LVE++    +Q     I+IF   +    E +R+I   E      K+K ++S  WN+ +   I ++   F LR +         R  Y + +     R++ ++ ++   GP V MI +M  ++F+ + I ++ ++S+G    A+   +    + SL  +I + PY+  YGE+   E
Sbjct:  352 QNTFNFSLKQSKHLFQILMECM-VHRDCITIFDADSEEQQDLDLAILTALLKGTNLSASEQ-LNLAMAWDRVDIAKKHILIYE--QHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYNTKQGPTNTLLHHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNNLYRKYKHQRHSSGN--RNESAESTLHSQFIRTAQP-YKFKEKSIVLHKSRKKSKEQNVSDDPESTGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDDASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFVSHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPPTILTLEFKSKAEMSHVPQSQDFQFMWYYSDQNASSSKESASVKEYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYEFYSAPIVKFWFYTMAYLAFLMLFTYTVLVEMQPQPSVQEWLVSIYIFTNAI----EVVREICISEPGKFTQKVKVWISEYWNLTETVAIGLFSAGFVLR-WGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVNQHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPK-EPPSWSLARDIVFEPYWMIYGEVYAGE 1029          

HSP 2 Score: 100.138 bits (248), Expect = 3.633e-60
Identity = 76/285 (26.67%), Postives = 128/285 (44.91%), Query Frame = 2
Query:  131 CKCGNIKTDHQDFPI----------KDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPT--YHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV-------RENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVI 928
            C CG +  DH               + E WS+E +T     DTFG INF    D    H+  +IR + +     ++ +  LM+  W    P+L+ISV GG++     +  ++   +  L++  +    WII  G N G+   + +A+   +S  ++S  ++  +GI  WG I N + L  ++    Y            L+S    F+  DDGT  +Y  E   R   EK +       R      VV ++ EGG   + S + ++K   P+V+ + +GRAAD++
Sbjct:   52 CYCGRLIGDHAGIDYSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINF---QDGEHTHHAKYIRTSYDTK---LDHLLHLMLKEWKMELPKLVISVHGGIQNFTMPSKFKEIFSQ-GLVKAAETTGAWIITEGINTGVSKHVGDAL---KSHSSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTTLNSMHSHFILSDDGTVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVILSVWETVKDKDPVVVCEGTGRAADLL 326          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. TrEMBL
Match: A0A267F5R1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006430g1 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 9.757e-94
Identity = 213/780 (27.31%), Postives = 370/780 (47.44%), Query Frame = 3
Query: 1005 DEKDIEKFQEILREIYE-KYRNQIFVHDL--FDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLN---ADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPS--------RCGYL---LVDFIATTDKNF------DSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXX------LIMPSVNQPTQSERSNESA-----ESQTPEFMYEANSPFKRHY------------SQSKKKASI-------------PYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELK-----LNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENIT----------DIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSFIQLQ 3122
            D  ++    + L ++ E  Y+  + V+D    D + +LDR I+   +     + + + L + + +N  D+A +++F +   A ++ L  + L  +    L  NQ EFV L  ++  +I   L  E L GLY+ SL  KP         +  YL   L  ++ T  K        +S+    + LL  V   ++  SG +L++    P P     R D  +++                +DL +W+++ + T++A I W+   + I SAL+++++L  M+ L    G  + SA L  A+  F+ +A  V+   + + ++ T   L+R L  W+  T L +A  G  +EF+SQ A  + I  IW      +LP+W+ LI +    ++         L  P   + T +     S+      S  P+ +    S F RH             + S +K+                +   + MFY  P VKF+  + S V+FLL+F ++ LV LK        + Q    E  +  +++ +I EEIRQI D+ +  ++ KLK + + +W+++D+   L+ I    +R F++++ F+  R  Y++TL+M  +R MQ+Y I  TLGPKV+M+ RMI D  FF +I  +F+++YG  A AL    S  ++  LI ++ Y PY+Q YGEL L +   ++               P     N+T          +    +    +I  FA ++L+TN+LL+NLLIAMF HTF+ +Q  S K +++ + Q
Sbjct:  444 DSSEMRSLVDWLMKLAEPAYQRMLNVYDAESMDPNEQLDRVILTTFLRQTSLSVVTQ-LNLAMAWNRPDLAAQEIFSSERKAKWEQLTGRDLEYSMLRALARNQTEFVSLLFDHGINIGTLLNLETLAGLYS-SLINKPDPQMMRLREQLDYLSSPLSSWLMTESKTVGYATHNESQTAYQERLLRAVGLYVSAKSGGVLRS----PYP-----RRDRSSYQ---------------AEDLLIWSIVVQRTDMARIIWRQTSDTIASALVSAMMLRNMKSLAESEGSLEASAQLGAAADSFEGLAAGVLATCYAQDKQKTLDTLVRRLPVWDGQTLLTLADQGECMEFMSQQAVQTKISDIWIAGSKTYLPLWRTLICMLLPMLIPALIFDKWLLTSPPAGESTGAGSDRHSSVRMKRSSVQPKTVSTRQS-FDRHQQQQQQQQKQQGATPSLRKSQQQQQVSSGGHIQNPSFLQCVFMFYTSPQVKFISTVASAVVFLLLFSFVTLVTLKHPNEATEEEPQPSVLEFVLIGWMVSLIAEEIRQIFDRNKVSALEKLKDWFAHAWDVFDLVLNLMMISCILVRVFVTEEYFVWVRMTYALTLTMFYIRFMQFYLIHQTLGPKVVMVTRMINDTVFFFAILVVFLLAYGVAAQALLYPNS-PLSWKLIKDVVYLPYWQMYGELQLGDILADDDKVS--------PDSPPIMPSNVTGRGFEGGGEGEESEAVHSPLVIVLFAFYMLITNVLLLNLLIAMFQHTFDLVQESSRKLWAYSRYQ 1187          

HSP 2 Score: 147.517 bits (371), Expect = 9.757e-94
Identity = 88/276 (31.88%), Postives = 147/276 (53.26%), Query Frame = 2
Query:  188 WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNK-ILCNEN---------PTYHFTKKTE--KGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEK-----CVRENDNGN---------VVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAI 937
            W+++  T     D +G++ F  +          +IR +C ++     +++KL+   W   +P+LI+SVTGG K+M   +++  K  +Q +I +  K KTWI+ GGFN+G + L+ EA+ +Y+     S   V L+G+C WG++ + + +L +E+          TY     T   KG+ +L+ H   FL CDDGTE  +  E +FR  FEK      VR    G+          V ++ EGG + +++A  S++   P+V++K SGRAA+VI  I
Sbjct:  146 WTVDGCTATARTDAYGVLRFENFEFTRLGQNAKYIRLDCLNSRP--NLLWKLLTKTWRIPEPELIVSVTGGAKKMRPMSDKIIKKLRQGIINIATKTKTWIVTGGFNLGTNKLVGEAIRDYQ-LAGGSERDVVLIGVCPWGSVRDKECLLVSEDKSLEDDLPVSTYRNPDNTAPVKGQAVLEPHHTHFLLCDDGTESMFGAEIDFRASFEKKVAEQMVRRRSRGDGSDLRSVTPCVHLIIEGGRKDVQAALVSVETGSPVVVVKGSGRAANVIAYI 418          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. TrEMBL
Match: A0A2T7Q025 (LSDAT_euk domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01646 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.002e-79
Identity = 175/714 (24.51%), Postives = 337/714 (47.20%), Query Frame = 3
Query:  954 QEKIKSILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKN----FDSKRKKSKYLLYP-VRRIINMMSGNILQNENIHPKPGRQ-LIRTDEENFEFQSQSFIEVH-----SKKITP-----------------QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEAN----------SPFKRHYSQSKKKASIPYKD------------------------------MIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIF--IFFYVLG-IITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDN--RSRAMNLSLITEIFYRPYFQTYGELMLDEFH 2876
            ++K K +    ++  ++D+K I   + I   + E+    +F  +  D    +DR I+ A++ + + ++    L + + +N  DIA +++F + + Q      L+      L  N+ +FV+LFL+N   ++ FL  + L  LY   +  + +  G  L+ ++ T  K     F        +  +P +   I  +  ++L+++  +    ++ ++R +  + E++ + F  +        K  P                 ++LFLWA+L   + L  +FWK G +HIG AL AS +L ++          D SA ++  +   ++ A++V++E +++ ++ T+ LL+R L +W   T   +A S  ++EF   SAC + +  IW+G ++ +         +  +  +  PL++PS+      +   E  +  TP  + E+           SP          K  +P +                                I  FYQ P+ KF  ++ISY +F+ +F Y  LVEL+    ++     IF  I +  LG ++ EE RQ++ ++    IYK+K +    WN +D+   ++++++  LR  L  + F+  R  YS+T+++  LR MQ+++    +GPKVI+I +M+ D+ FF++I  +F++S+GT   A Q N       + +++  +FY PYFQ +GE  LDE  
Sbjct:  562 KQKAKVMFEWQRNDTDVDQKIIGYIRLIKECLKERKLLNVFNLEKADSVKDIDRAILYALLRA-NKSNANSQLALALAWNRCDIARQEIFTSVNRQHWKHIDLYPAMFTALVQNRADFVQLFLDNGLDLKRFLNIKTLWNLYCECIK-EETDAGAQLLRYLITYQKQTWTAFLLCHDPPDFENFPDLLPYIGKVVAHLLEDQRFNFYSDKKFVVRDNNPSLEWKKRDFAAIKRLKKAGGKFLPVKKHQKTKDEFDFESPERELFLWAILFNRSRLVRLFWKQGRDHIGGALFASALLKQLSSFADNEEEDDLSAEMATCAGACEQWAVSVLSECYSRDKQLTHHLLVRELPSWGQTTLFSMADSYEMMEFSGHSACQTKVSSIWKGRMALY------TSEMKIALCIFFPLVVPSIKFTADYKPKEEDKKKATPGDLTESPRGSTLLNNTVSPRTLSDDNQDGKGFVPSQSRRERVYTIASKFNKVNLCDLRTADNISIFAAILYFYQAPVTKFFCNIISYFVFMGLFTYFVLVELR---PVETDSPSIFEYITWAWLGTMVLEEFRQMMSKDHGSVIYKIKNWFGNVWNKFDLLIYVLFMVSIILRYQLDSE-FVWARIVYSITMALFYLRFMQFFYAEKNIGPKVIIIRKMLTDLSFFVAILVVFMLSFGT---AYQANLFPHSVPSWTILGNVFYFPYFQMHGENFLDEMQ 1260          

HSP 2 Score: 126.331 bits (316), Expect = 4.002e-79
Identity = 98/330 (29.70%), Postives = 152/330 (46.06%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKY-----KGEIFETCKCGNIKTDHQ--DFPIKDE----IWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSS-NQVKLLGICTWGAILNNKILCNENPTYHFTKKTE--------KGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEK--------CVRENDNGNV--VQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTRKDK 967
            +I K  Q R C  Y       +    C+CG     H+    P + +    +W  + +TK   CD+FG I F G+    +N+ P ++R    D    +E +  L++ YW+   P+L+IS+TGG KR N          +  L+        WII GG   G+  L+ EA++++     N+  +Q   LGI +WG I NN  L  E  +  F  +          + +  LD +   F+  DDGT+ ++  E  FR K E          V +N + +V  V I+ EGG   L++ + S+K  IP+V+I  SGR AD I     L  T  D+
Sbjct:  225 YISKNIQQRECKAYARNASSSQASHACQCGRELLWHELKGIPTRVDSEHTVWHPQTHTKVMPCDSFGEILFRGFGSQ-SNNSP-YVRV---DYMTDMEKMGTLLMDYWHLPVPKLLISITGGAKRFNLKERLSNILKQ-GLVTAAVSTGAWIITGGTAAGVMELVGEALHDHHLSTGNTDRSQCVALGIASWGVIANNVALDGEGDSGLFPAQYAMEDIQSHGRNRAALDHNHTHFILVDDGTDGKFGVEIEFRAKLESYISSIVETGVAKNQSIHVPSVLIVVEGGVNTLQTVHASIKRKIPVVVINGSGRVADFIALAYRLTKTSNDE 548          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. TrEMBL
Match: A0A1S3HH51 (transient receptor potential cation channel subfamily M member 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106154535 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.359e-76
Identity = 233/868 (26.84%), Postives = 407/868 (46.89%), Query Frame = 3
Query:  957 EKIKSILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDK--SMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCG-YLLVDFIATTDKNFDSKRKKS---------KYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENF---EFQSQSFIEVHS--------KKITP-----------------------QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXX-----------------XXXXXXXXXXXXXLIMPSVNQ-PTQSERSN--ESAESQTPEFMYEANSPFKRHYSQSKKKASIPY---------KDMIKMF------YQVPIVKFVIHLISYVLFLLVFIYLNLVELKL-----NLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSFIQLQXXXXXXXXXXXXXXXXXXHYLITGIIYCGNRCCHKQTRNQNSLLLQDLPKEENKKFSYF 3299
            E+ KS+   +       EK+I+K  + L+ I   +R  + V  L D   +  +D+ I+ A++ + + +D    L + + +N  D+A +++F   + ++  +  L+      L  +++EFV LFL+    ++ FLT   L  LY   L  + S  G + L + +    ++F S+ +             +LY + R+IN    +   N     KPG    +   E     +  +Q + EV+          +  P                       + L LWA+L    ELA +FWK+G++HIG+AL AS IL +M          D +  L     +F+E+A+ V+ E ++K +   + L+ R L  + + T + IA +   + F+ Q+ C + +  IW G++     +WKI                       SF  ++ + + SVN+   ++E+ N  E  E+  P+      +  K    +++K A   Y         KD I +F      +  PI KF+   I Y++FL +F Y  +V+L       NL I   W EIF++ +    I EE+RQ++ ++     YKL  +    WN  D+    ++II+  LR  L++  F+  R  Y +TL ++ +R +Q + I   +GPKVIMI RMI D+ FF+ I  +F+++YG    A L  N  R  + S++ ++ Y PY+Q YG+L LDE         +    Y+    P    +           MTI+    +++LLTN+LL+NLLIA+F +TF  IQ  S   + F +  L+ E+ ++P LPPP  ++ +++ GI+Y   +C  +  +N +    + L  +E +K + F
Sbjct:  584 EEAKSLFDLHGLDQEEVEKNIKKCLKNLK-ICLDHRKLLTVFRLNDSTSARDMDKAILYALLKA-NKSDARTQLNLALAWNRPDVARQQIFTQDNRENWQKVDLYPAMYTALVQDRLEFVHLFLDMGVDLKKFLTASKLQELYYDVLKDRFSGAGAFYLKEKVQQLQQSFASRLRSGDGDHGDLDQNSVLYNIGRVINRCVQDQQDNLYASQKPGMCENQPSAEAGLAEDMTNQRYTEVNEVDERVNTISQCAPGAKMKKKRTKLKEEQKCEFERPEKHLMLWAVLLNRKELAKLFWKMGKDHIGAALFASAILKRMSKDAAGDEEVDLAEDLKNHGVEFEELAVGVLNECYSKDKILGHRLVTRQLPHFGHDTVMTIADTARQMHFMEQACCQTKLNMIWLGKMVQHTSIWKIVPSLFIPFVIPFIKFRIKSKPLKSFSEVRGIDLGSVNRIAPEAEKKNGDEEEENSDPDGDGVEFTRSKTRREKNRKGAKHSYFQVNCCGLDKDSISIFRAFYYFHTAPITKFLYQQIMYIVFLCMFSYFLMVDLHPMNTPDNLHI---W-EIFVWIFSGTSILEEVRQVLTKDSRSLWYKLADWWKSVWNKLDLIMYTLFIISVVLRFTLTEADFVHARRAYCLTLILHFVRFLQGFMIHKDMGPKVIMIRRMITDVIFFVMILLVFLLAYGVAVQALLYPNHKR--DWSILKDVVYIPYWQMYGDLFLDETSGKIDQCTSNATLYLQDNGPQMCPQQNE-------WMTIVL-MVIYMLLTNVLLLNLLIAIFNYTFQNIQDNSLTVWRFYRFGLIYEYHDRPPLPPPAIIISHIVRGIMYIVKKC--RGIKNSDDSFKRVLSVDEQEKLTVF 1433          

HSP 2 Score: 126.716 bits (317), Expect = 1.359e-76
Identity = 93/301 (30.90%), Postives = 140/301 (46.51%), Query Frame = 2
Query:  131 CKCGNIKTDHQDFPI------KDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPH-FIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN-----PTYHFTKKTE---KGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN-DNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTR 958
            C+CG  KT H D  I      KDE W+ EN+++    D FG I F+G+     N  P  +IR    D       ++ L+  YW    P+LII+VTGG ++               LI        W++ GG N G+  L+ EAV ++       S+++  LG+ TWG I N + L  E      P  + ++       G   LD +   ++F DDGTE +Y  E   R K E+ + E  + G          ++ ++ EGG   L++   ++K   P+V+I  SGRAAD +  I   KMTR
Sbjct:  270 CQCGRSKTWHVDEEIDISKHTKDEKWNGENHSEQVPPDCFGEILFSGFG--YDNKVPAPYIRV---DHTTERSTLWHLLDDYWKLPAPRLIITVTGGAQKFFLRPRLLHAFKT-GLINAATGTGAWVVSGGTNTGVMKLVGEAVRDHSFASDVESSKIIALGVATWGIISNKESLVGEENMGCFPALYRSEDLRHGGAGTAALDPNHTHYIFVDDGTENKYGAEIKLRAKLEQYISEKVETGISKTESVPVPIILLVLEGGINTLQTVAEAVKQDTPVVIIGGSGRAADYL--ICGYKMTR 562          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. TrEMBL
Match: A0A1S3HED0 (transient receptor potential cation channel subfamily M member 2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106154535 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.182e-76
Identity = 229/857 (26.72%), Postives = 405/857 (47.26%), Query Frame = 3
Query:  999 NIDEKDIEKF-QEILR--EIYEKYRNQIFVHDLFDK--SMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCG-YLLVDFIATTDKNFDSKRKKS---------KYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENF---EFQSQSFIEVHS--------KKITP-----------------------QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXX-----------------XXXXXXXXXXXXXLIMPSVNQ-PTQSERSN--ESAESQTPEFMYEANSPFKRHYSQSKKKASIPY---------KDMIKMF------YQVPIVKFVIHLISYVLFLLVFIYLNLVELKL-----NLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSFIQLQXXXXXXXXXXXXXXXXXXHYLITGIIYCGNRCCHKQTRNQNSLLLQDLPKEENKKFSYF 3299
             +D++++EK  ++ L+  +I   +R  + V  L D   +  +D+ I+ A++ + + +D    L + + +N  D+A +++F   + ++  +  L+      L  +++EFV LFL+    ++ FLT   L  LY   L  + S  G + L + +    ++F S+ +             +LY + R+IN    +   N     KPG    +   E     +  +Q + EV+          +  P                       + L LWA+L    ELA +FWK+G++HIG+AL AS IL +M          D +  L     +F+E+A+ V+ E ++K +   + L+ R L  + + T + IA +   + F+ Q+ C + +  IW G++     +WKI                       SF  ++ + + SVN+   ++E+ N  E  E+  P+      +  K    +++K A   Y         KD I +F      +  PI KF+   I Y++FL +F Y  +V+L       NL I   W EIF++ +    I EE+RQ++ ++     YKL  +    WN  D+    ++II+  LR  L++  F+  R  Y +TL ++ +R +Q + I   +GPKVIMI RMI D+ FF+ I  +F+++YG    A L  N  R  + S++ ++ Y PY+Q YG+L LDE         +    Y+    P    +           MTI+    +++LLTN+LL+NLLIA+F +TF  IQ  S   + F +  L+ E+ ++P LPPP  ++ +++ GI+Y   +C  +  +N +    + L  +E +K + F
Sbjct:  594 GLDQEEVEKIIKKCLKNLKICLDHRKLLTVFRLNDSTSARDMDKAILYALLKA-NKSDARTQLNLALAWNRPDVARQQIFTQDNRENWQKVDLYPAMYTALVQDRLEFVHLFLDMGVDLKKFLTASKLQELYYDVLKDRFSGAGAFYLKEKVQQLQQSFASRLRSGDGDHGDLDQNSVLYNIGRVINRCVQDQQDNLYASQKPGMCENQPSAEAGLAEDMTNQRYTEVNEVDERVNTISQCAPGAKMKKKRTKLKEEQKCEFERPEKHLMLWAVLLNRKELAKLFWKMGKDHIGAALFASAILKRMSKDAAGDEEVDLAEDLKNHGVEFEELAVGVLNECYSKDKILGHRLVTRQLPHFGHDTVMTIADTARQMHFMEQACCQTKLNMIWLGKMVQHTSIWKIVPSLFIPFVIPFIKFRIKSKPLKSFSEVRGIDLGSVNRIAPEAEKKNGDEEEENSDPDGDGVEFTRSKTRREKNRKGAKHSYFQVNCCGLDKDSISIFRAFYYFHTAPITKFLYQQIMYIVFLCMFSYFLMVDLHPMNTPDNLHI---W-EIFVWIFSGTSILEEVRQVLTKDSRSLWYKLADWWKSVWNKLDLIMYTLFIISVVLRFTLTEADFVHARRAYCLTLILHFVRFLQGFMIHKDMGPKVIMIRRMITDVIFFVMILLVFLLAYGVAVQALLYPNHKR--DWSILKDVVYIPYWQMYGDLFLDETSGKIDQCTSNATLYLQDNGPQMCPQQNE-------WMTIVL-MVIYMLLTNVLLLNLLIAIFNYTFQNIQDNSLTVWRFYRFGLIYEYHDRPPLPPPAIIISHIVRGIMYIVKKC--RGIKNSDDSFKRVLSVDEQEKLTVF 1433          

HSP 2 Score: 125.946 bits (315), Expect = 2.182e-76
Identity = 92/301 (30.56%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  131 CKCGNIKTDHQDFPI------KDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPH-FIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN-----PTYHFTKKTE---KGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVREN-DNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTR 958
            C+CG  KT H D  I      KDE W+ EN+++    D FG I F+G+     N  P  +IR    D    +  ++ L+  YW    P+LII+VTGG ++               LI        W++ GG N G+  L+ EAV ++       S+++  LG+ TWG I N + L  E      P  + ++       G   LD +   ++F D+GTE +Y  E   R K E+ + E  + G          ++ ++ EGG   L++   ++K   P+V+I  SGRAAD +  I   KMTR
Sbjct:  270 CQCGRSKTWHVDEEIDISKHTKDEKWNGENHSEQVPPDCFGEILFSGFG--YDNKVPAPYIRV---DHTTELSTLWHLLDDYWKLPAPRLIITVTGGAQKFFLRPRLLHAFKT-GLINAATGTGAWVVSGGTNTGVMKLVGEAVRDHSFASDVESSKIIALGVATWGIISNKESLVGEENMGCFPALYRSEDLRNGGAGTAALDPNHTHYIFVDNGTENKYGAEIKLRAKLEQYISEQVETGISITESVPVPIILLVLEGGINTLQTVAEAVKQDTPVVIIGGSGRAADYL--ICGYKMTR 562          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. TrEMBL
Match: A0A2C9K628 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106052735 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.201e-76
Identity = 207/743 (27.86%), Postives = 365/743 (49.13%), Query Frame = 3
Query:  954 QEKIKSILSANQSTMNIDEKDIEK-FQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSA-LIASIILNKMEG------LIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQT---PEFMYEANSPFKRHYSQSKKKASIP-----YKDMI---KMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNE--STNQA*VLRYM*KAFPSKSDENITDIDRTIGR--MTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSF 3110
            +EKIK ++   +S+  + E +IEK F  +      K    +F  D  + +  +D  I++A++ +  +  +++ LK+ + +N  D+A+ ++F   D ++    +L E     +K ++++FV+LFL+N  S+++FLT+E L  LYN      P  C  LL   +  T       ++K ++ L  V  ++  + G+  Q              TD        QS +E     ITP Q+LF+WALL    +L+ +FW+ G++   +A L A  +L  ++       +I+K         L  A++ ++E+   V+   ++  +E T+ +L++ +  W   TC+QIA+  +   F+SQ+A  S + K+W G +S   P + IL+ I    +++  +     N   +   S+ +   Q    P     A        + +K+K+         K MI   K FY  PIVKFV+++++Y++FL ++ YL +V+L   +     W E  +  +V+ +  EE+R+           KLK YL   WN  DI  IL++ +   LR     D     R   S+ L     RI+Q + I+  LGPK++MIG+M+ D+ +F+ I  +FI+SY   + A+    S   +  L+  +  + Y+Q YGEL LD+    E  + N      Y  K  PS+           +G+  + I+ GF  ++L+T +LL+NLLIAMF +TF +IQ  +   + F
Sbjct:  361 EEKIKEMI---KSSFGVAELEIEKCFIWVKECCARKDLLSVFELDSKNSAKDVDLAILKALLKANKNQAIDQ-LKLALAWNRIDVAKSEIF--TDDRTWPTGMLDEIMMSAIKLSRVDFVELFLDNGLSLKNFLTKERLTALYN----TIPPNC--LLRSLLMKT-------KRKHEFTLVDVGHLLQDLLGDFYQ----------PCYLTD-------GQSNLETF---ITPAQELFIWALLMNNLKLSKLFWREGKQSSTAACLFAHSVLKSLQAHTIDAKVIKK---------LQTAAEDYEELVNGVIKSCYSSDEERTHNILVQYMPHWGRTTCVQIALHSDNQLFISQNAFQSMLTKVWMGNMSQSNPFYMILVGIVIFPVVLFCVKFNETNTKQKRLSSSSTKHHQIETHPTINGHAKHKSDHSLNSTKEKSRTKGHTEQIKKMIQKLKCFYCSPIVKFVMNVMTYLVFLALYSYLLVVQLTREI----HWIEGVLIAWVISLFLEELREYFTYSNQS---KLKTYLKNKWNYLDIVCILLFALGISLRFVPDDDCMTAARVILSINLITFFFRILQIFSINKQLGPKLVMIGKMLQDLKWFVVILLVFIVSYALASEAVLYPNSEP-SWKLLYFVPRKAYWQIYGELFLDDIEDPETCTNNATEYSTYTIKRCPSE-----------VGKYFVPILLGF--YMLMTTVLLLNLLIAMFSYTFEQIQGNTDMHWCF 1034          

HSP 2 Score: 124.02 bits (310), Expect = 3.201e-76
Identity = 80/284 (28.17%), Postives = 138/284 (48.59%), Query Frame = 2
Query:  125 ETCKCGNIKTDHQDFPIKDE----IWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKIL------CNENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGN------VVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVI 928
            + C C  +K +H    ++ +    +WSL +NT+    + +G I F G+ D I      ++R +  D P  ++ +  L+   W    P L+ISVTGG K  N     ++   +  L++  +    WI+ GG   G+   + EAV ++      S  +V  +GI TWG + N ++L       N    Y    + +  +  LD +   F+  D+GT+ Q+  E  FR K E+ + +   G       V  ++ EGG   LE+ Y++LK++ P V+IK SG+ AD++
Sbjct:   59 KVCYCNYLKKEHSKNALRRKSRTHLWSLSDNTEKTPTNAYGEIEFVGFGDRIGK----YVRVDV-DTP--MDTMLDLLTKVWKMEMPNLLISVTGGAKNFNMKARLKEVFRR-GLVKAAQSTGAWIVTGGTYAGVMKHVGEAVRDF---GLTSQGRVTTIGIATWGCVQNKELLIRKDEDSNHPVEYSIHGEVKPKQSFLDPNHSHFILVDNGTQHQFTVEIPFRAKLEEAISKRKTGTDAITVPVCLLVLEGGPGTLETVYSALKSTTPTVVIKGSGKTADIL 331          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 146.747 bits (369), Expect = 2.354e-60
Identity = 166/701 (23.68%), Postives = 314/701 (44.79%), Query Frame = 3
Query:  972 ILSANQSTMNIDEKD-IEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNAD---YQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN-------HSLY--VKPSRCGYLLVDF------IATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQS--------FIEV---HSKKITPQ-----------------------DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSP-------FK----------RHYSQSKKKAS-IPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGEL 2858
            I++  + T N+ + D +  FQ ++  +  K    +F H   +    +D  I++A++   D +  ++++ +T+ ++  DIA+  VF+        SL Q +L       L  ++++FVKL +EN  S+  FLT   L  LYN        +L+  V+  + G L  ++      +    +       +  Y     R I N + GN  ++    P  G  L R + E F  Q+          FI+    +  K+  Q                       +L +WA+L +  ++++ FW+ GEE +  AL+A  +   M    +K     DTS  L   S +F  +A+ ++ ++  + +  +  LL   LK W+N TCL++A+S  L  F++ +     +  +W   L+     W  +I        I  L   S  +     +S ++ +    +  +   +P       FK          +H ++   ++  +P       FY  PIVKF  + + Y++FL+++ Y+ LV+L +    Q  WA   +  Y+     E+IR++   E      K+K + S  +N  D   I+++ + F LR F S ++FI  R  Y + +    +R++    ++   GP V+MIG+M+ ++F+ + I  + +++YG    A+    S A   SLI ++ ++PY+  YGE+
Sbjct:  324 IIATVKKTFNLSQNDAVHLFQTLMECMKNKELITVF-HVGSEDHQDIDVAILKALLKGTDASAFDQLV-LTLAWDRVDIAKDHVFVYGQKLLVDSLEQAMLD-----ALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTNPNLFQLVRDVKQGNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGNNRRSGRA-PSSGPPL-RKNHEPFSIQADKKEKTRHNHFIKTAQPYKPKVEKQKRSREEVVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSILVPPAILALEYKSKAEMAHIPQSQDAHQMTMEDSEHNLQNPDDIQMDVFKETRINDHVEVKHETEVVTRSRRLPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKLPIFPSPQ-EWA---VILYIFTSAIEKIREMFMSEGGKISQKIKVWFSDYFNRSDFIAIVMFAVGFGLR-FGSGNVFIAGRLIYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEA-EWSLIIDVVFQPYWMMYGEV 1009          

HSP 2 Score: 107.457 bits (267), Expect = 2.354e-60
Identity = 77/284 (27.11%), Postives = 136/284 (47.89%), Query Frame = 2
Query:  122 FETCKCGNIKTDHQDFPIKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV-------RENDNGNVVQILYEGGSRALESAYNSLKAS--IPLVLIKNSGRAADVINAI 937
            +   K G  +  H++       WS+EN+T+    D +GIINF G +    ++   ++R + +  P   E + +LM+  W    P+++ISV GG++       + K+   + LI+       WI+ GG N G+   + +A+ E+ S+   S+ ++  +GI  WG I N   L   +   P         K  VL + H   F+  D+GT  +Y  E N R   EK +       R      VV +++EGG   + +    L+ S  +P+V+ + +GRAAD+++ +
Sbjct:   41 YSDMKLGEAQPPHEE-------WSVENHTEQSPTDAYGIINFQGGSH---SYRAKYVRLSHDSRP---EAILRLMLKEWQMELPKIVISVHGGIQNF-DLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHSSR---SARKICTIGIAPWGVIENRNDLIGRDVVAPYQTLLNPLSKLNVLNNLHSH-FILVDNGTVGKYGAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFV 306          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Cavefish
Match: trpm4a (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:103041664])

HSP 1 Score: 117.472 bits (293), Expect = 1.446e-53
Identity = 96/376 (25.53%), Postives = 173/376 (46.01%), Query Frame = 3
Query: 1008 EKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVIS-----SIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLV--------DFIATTDKNFDSKRKKSK-----------YLLYPVRRIINMMSGNILQN---ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMW 2054
            EK +EK  +    IY+        H   D     D  +++A++      S D ++  + LK+ + +N  DIA+ ++F N D Q    + L +     L NN+ +FV++F+EN  +I ++LT + L  LY     +  S   Y L+          +A +  + DS  KKSK             LY V R++  + G + Q      +   PG    +  ++  + Q+       S       LF+WA+L   +E+AI FW++  E + SAL A  +L +   L +    ++T   +   ++KF+ +A    +  +   +  ++TLLIRT   W  +TCLQ+A++ +   F S     + + +IW G+++    +W
Sbjct:  366 EKVLEKLVDRALSIYQNRALITVFHGDQDSPDDFDTVLLKALVRACRQMSSDASEYTEELKLAVAWNRVDIAKSELF-NGDIQ-WQYEALKDCMTDALVNNKPQFVRVFIENGLNILEYLTYQRLESLYQS---LSDSSLAYSLLQKWLRERHSLVAMSPHSPDSPEKKSKKSLKVPPNVRELSLYEVSRLLGELFGGMCQPFYYSVLDLDPGASNRKAAKQLNKLQADGAYGKRSCNHPWASLFIWAVLQNRSEMAIYFWEMAGESVLSALCACKMLRE---LCKLENETETKLSIKELAQKFETLAHDTFSACYQSSESRSFTLLIRTSPVWGGVTCLQMAMAADARLFFSHDGVQTLLSQIWWGDMNSRTEVW 733          

HSP 2 Score: 114.005 bits (284), Expect = 1.446e-53
Identity = 78/293 (26.62%), Postives = 131/293 (44.71%), Query Frame = 2
Query:  125 ETCKCGNIKTDHQDFPIKD-------EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSS-NQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            + C+CG+ +  H      D         W    +T     D FG + F G        + HF+R +C D P    +VY +M ++W    P L++SV GG  R     +  +   +Q L+   +    WI+ GG   G+ + + EAV ++ +  ++ S ++V  +G+  WG + N + L N     P  ++ + T      LD++   FL  DDG+      ETNF    E  +     G          V+ +L  G +  L+    SLK + P +++  SG AAD+I+ +LD
Sbjct:   46 DRCQCGSERAAHSSSATGDFFGSAVVSQWDTAVHTSEYPTDAFGEVEFAGAG----RRHSHFLRLSC-DTP--ASLVYSIMTVHWGLPPPNLVVSVMGGGGR-EKVKSWVRDVLRQGLVLAAQSTGAWIMTGGLKEGVGHCVGEAVRDHVAAASSPSQSKVVAIGVAPWGLVANRQQLVNAQGSFPARYYIQNTSHDSCYLDNNYQAFLLVDDGSVGHRGGETNFITNMEDYISNQRTGIWGSGNIEIPVLCMLISGEASVLKRMDMSLKKATPWLVLDGSGPAADMISELLD 330          

HSP 3 Score: 75.485 bits (184), Expect = 2.922e-13
Identity = 86/292 (29.45%), Postives = 143/292 (48.97%), Query Frame = 3
Query: 2259 KMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIAL---QDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHT-----NESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSF 3110
            + F+  P+  F+ +++ Y LFL +F Y+ LVE K          E  ++F+V  ++ EE RQ      TG    +  Y+   WN +D+  I+++ +    R F     F   R    V   +  LR++  + I+  LGPK+I++G+M+ D+FFFL    +++++YG    AL    D R       +   +FYRPY   YG++ LDE           TN   ++            E      ++     ++   +V+LL+TN+LL+NLLIAMF +TF+K+Q  S   + F
Sbjct:  848 RQFWFAPVTSFLGNVLMYFLFLFLFAYVLLVEFKPPPPEGPAHIEYLLYFWVFTLVCEEFRQSFFVGNTGLCQSMSLYIQDMWNKFDLTAIMLFCVGLVCRMFPWSYEF--GRSVLCVDYMVFTLRLIHIFAINKQLGPKIIIVGKMVKDVFFFLFFLGVWLMAYGVANQALLYSYDPRP----YWVFRRVFYRPYLHIYGQIPLDEIDAYRRGDKPCTNNVTLIH-----------EGAEPCPQSEANWLVLILLSVYLLVTNVLLLNLLIAMFSYTFSKVQEHSDVHWKF 1122          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Cavefish
Match: trpm4a (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:103041664])

HSP 1 Score: 117.472 bits (293), Expect = 1.471e-53
Identity = 96/376 (25.53%), Postives = 173/376 (46.01%), Query Frame = 3
Query: 1008 EKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVIS-----SIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLV--------DFIATTDKNFDSKRKKSK-----------YLLYPVRRIINMMSGNILQN---ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMW 2054
            EK +EK  +    IY+        H   D     D  +++A++      S D ++  + LK+ + +N  DIA+ ++F N D Q    + L +     L NN+ +FV++F+EN  +I ++LT + L  LY     +  S   Y L+          +A +  + DS  KKSK             LY V R++  + G + Q      +   PG    +  ++  + Q+       S       LF+WA+L   +E+AI FW++  E + SAL A  +L +   L +    ++T   +   ++KF+ +A    +  +   +  ++TLLIRT   W  +TCLQ+A++ +   F S     + + +IW G+++    +W
Sbjct:  366 EKVLEKLVDRALSIYQNRALITVFHGDQDSPDDFDTVLLKALVRACRQMSSDASEYTEELKLAVAWNRVDIAKSELF-NGDIQ-WQYEALKDCMTDALVNNKPQFVRVFIENGLNILEYLTYQRLESLYQS---LSDSSLAYSLLQKWLRERHSLVAMSPHSPDSPEKKSKKSLKVPPNVRELSLYEVSRLLGELFGGMCQPFYYSVLDLDPGASNRKAAKQLNKLQADGAYGKRSCNHPWASLFIWAVLQNRSEMAIYFWEMAGESVLSALCACKMLRE---LCKLENETETKLSIKELAQKFETLAHDTFSACYQSSESRSFTLLIRTSPVWGGVTCLQMAMAADARLFFSHDGVQTLLSQIWWGDMNSRTEVW 733          

HSP 2 Score: 114.005 bits (284), Expect = 1.471e-53
Identity = 78/293 (26.62%), Postives = 131/293 (44.71%), Query Frame = 2
Query:  125 ETCKCGNIKTDHQDFPIKD-------EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSS-NQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            + C+CG+ +  H      D         W    +T     D FG + F G        + HF+R +C D P    +VY +M ++W    P L++SV GG  R     +  +   +Q L+   +    WI+ GG   G+ + + EAV ++ +  ++ S ++V  +G+  WG + N + L N     P  ++ + T      LD++   FL  DDG+      ETNF    E  +     G          V+ +L  G +  L+    SLK + P +++  SG AAD+I+ +LD
Sbjct:   46 DRCQCGSERAAHSSSATGDFFGSAVVSQWDTAVHTSEYPTDAFGEVEFAGAG----RRHSHFLRLSC-DTP--ASLVYSIMTVHWGLPPPNLVVSVMGGGGR-EKVKSWVRDVLRQGLVLAAQSTGAWIMTGGLKEGVGHCVGEAVRDHVAAASSPSQSKVVAIGVAPWGLVANRQQLVNAQGSFPARYYIQNTSHDSCYLDNNYQAFLLVDDGSVGHRGGETNFITNMEDYISNQRTGIWGSGNIEIPVLCMLISGEASVLKRMDMSLKKATPWLVLDGSGPAADMISELLD 330          

HSP 3 Score: 75.485 bits (184), Expect = 3.271e-13
Identity = 86/292 (29.45%), Postives = 143/292 (48.97%), Query Frame = 3
Query: 2259 KMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIAL---QDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHT-----NESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSF 3110
            + F+  P+  F+ +++ Y LFL +F Y+ LVE K          E  ++F+V  ++ EE RQ      TG    +  Y+   WN +D+  I+++ +    R F     F   R    V   +  LR++  + I+  LGPK+I++G+M+ D+FFFL    +++++YG    AL    D R       +   +FYRPY   YG++ LDE           TN   ++            E      ++     ++   +V+LL+TN+LL+NLLIAMF +TF+K+Q  S   + F
Sbjct:  848 RQFWFAPVTSFLGNVLMYFLFLFLFAYVLLVEFKPPPPEGPAHIEYLLYFWVFTLVCEEFRQSFFVGNTGLCQSMSLYIQDMWNKFDLTAIMLFCVGLVCRMFPWSYEF--GRSVLCVDYMVFTLRLIHIFAINKQLGPKIIIVGKMVKDVFFFLFFLGVWLMAYGVANQALLYSYDPRP----YWVFRRVFYRPYLHIYGQIPLDEIDAYRRGDKPCTNNVTLIH-----------EGAEPCPQSEANWLVLILLSVYLLVTNVLLLNLLIAMFSYTFSKVQEHSDVHWKF 1122          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Cavefish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 151.369 bits (381), Expect = 1.563e-36
Identity = 163/643 (25.35%), Postives = 295/643 (45.88%), Query Frame = 3
Query: 1107 LDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNAD---YQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDK------NFDSKRKKS--------KYLLYPV------RRIINMMSGNIL--QNENIHPKPGRQ-LIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGE--------LSPFLPMWXXXXXXXXXXXXXXXL-IMPSVN----QPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKAS----------IPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNE 2885
            +D  I+ A++   + +  ++ L + + +N  DIA  ++F+        SL Q +L     LVL  ++++FVKL +EN  S+  FLT   L  LYN      PS   Y LV  +  +++      N     + S        +YL+         R+    +  N+   + +++  + GRQ   R  EE  +       E++       +L +WA+L +  ++A+ FW+ GEE +  AL+A  +   M     +     D S  L+  S++F ++A+ ++ +++ + ++    LL   LK W+N TCLQ+A++    +F++ +     +  +W G         L   L +      +   F     +  MP       Q   S+ +++ A+ +  E M E  +      S++ +K            IP    I  FY  PIVKF  H ++YV +L++F Y+ LV++ L    Q    E  +  Y+     E++R+I+  E    + K+K +L   WNI D+  IL++ I   LR      L    R  Y V +    +R++  + ++  LGP V+MIG+M++D+ +F+ I  + ++S+G    A+  N +   +  L   IF+ PY+  YGE    +  T E
Sbjct:  286 IDLAILTALLKGANASAPDQ-LSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLD---ALVL--DRVDFVKLLIENGVSMHRFLTLSRLEELYN--TRHGPSNTLYHLVRDVKKSEETLYLQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDMPIRRGRQKTTRKREEEVDIDLDD-PEINHFSFPFHELMVWAVLLKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVEDISQELNHNSREFGQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGLLLPPSILSLEFKNKDEMSYMPQEQEAYLQEKDSDEADKPAKDKDEEDM-EFTAMLGNVSSEASRKKVVEEVQHRHRLIPVGRKIYEFYNAPIVKFWFHTMAYVGYLMLFNYIVLVKMDLWPSPQ----EWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQEYWNITDLMAILIFSIGMVLR-LQDPPLMSYGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAIL-NPNEDPSWMLARNIFFMPYWMIYGEAPCGQNITTE 912          

HSP 2 Score: 73.9442 bits (180), Expect = 8.920e-13
Identity = 62/228 (27.19%), Postives = 107/228 (46.93%), Query Frame = 2
Query:  287 FIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVL--LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV-------RENDNGNVVQILYEGGSRALESAYNSLKAS--IPLVLIKNSGRAADVI 928
            ++R + +  P+++     LM   W    P+L+ISV GGL+       + K+ F + LI+       WI  GG N G+   + +A+ ++ S+   S  ++  +GI  WG + N + L  ++   P    +    K  VL  L SH   F+  D+GT  +Y  E   R + EK +       R      VV ++ EGG   +      L+ +  +P+V+   SGRA+D++
Sbjct:    3 YVRVSYDTKPDLL---LHLMTKEWQLELPKLLISVHGGLQNF-ELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHASK---SRGKICTIGIAPWGIVENQEDLVGKDVVRPYQTMSNPLSKLTVLNSLHSH---FILADNGTTGKYGAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDIL 220          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Cavefish
Match: trpm6 (transient receptor potential cation channel, subfamily M, member 6 [Source:ZFIN;Acc:ZDB-GENE-111212-1])

HSP 1 Score: 146.747 bits (369), Expect = 4.015e-35
Identity = 156/685 (22.77%), Postives = 304/685 (44.38%), Query Frame = 3
Query: 1056 KYRNQIFVHDL-FDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADY---QSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN----------HSLYVKPSRC----GY--------LLVDFIATTD-------KNF------------DSKRKKSKYLLYPVRRIINMMSGNILQNEN---IHPKPGRQLIRTDEENFEFQSQSFIEVHSKKI---TPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAM-LSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFK-----------------------RHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNE 2885
            ++R  I V D   +  ++ D  I++A   S+     E+ L +T+ ++  DIA++ + +   +    +L Q +L+      L  +++ FVKL ++N  +++ FLT   L  LYN          H +     +C    GY        ++++++           K+F            + +R++S  L  P R   N +   +    +      +P R+  R    N E + ++  E+    +   +  DLF+WA+L    ++A+  W  GE+ +  A++A  +   M    ++    D++A  L + S +F ++A+ ++ +A  + Q     LL   +K W++ TCLQ+A++  L  FL+ S     +  +W G L+     W     I    +L   + +  +   +Q+E S+     +  +F  EA SP                         R+   ++    IP+   +  FY  P+VKF  H +SY+ FL++F Y  LV ++          E  +  Y+L    E+ R+++  E      KLK + S  WN++D  GI+++   F LR + S  +    R  Y + +    +R++    I+   GP + MI +M+ ++F+ + I  + ++S+GT   ++        +  L+ E+ ++PYF  +GE+   E +  E
Sbjct:   21 EHRGAITVFDSESEDHLEADVAILKA---SLKGTPAEQ-LSVTLAWDRADIAQEHILVYGQHWKVGALEQAMLN-----ALLMDRVSFVKLLIDNGMTLKHFLTVSRLEELYNSPPGSSDHFLHHIVEDAKKCRLPVGYKISLIDIGMVIEYLIGGAYRSTYRRKSFRVVYNRIHTALKEGRRERSGSLTRPKR--TNDIPAAVTPPRSHFFRTAEPYRRKERPSVSN-ELELEATAELGDASLFVYSINDLFVWAVLKRRQQMALFLWHHGEQAMARAVVACRLYRAMATEAKESDMGDSTAEELKKYSLEFGQLAVDLLDKAFKENQCLAMKLLTSEMKDWSSFTCLQMAVASGLRPFLAHSCTQMLLNDLWMGRLNMRKNSWLKTAEIIVCILLPMAIHL--LEFKSQAEMSHVPQMQEALQFGREAESPGAPETVETGETTQADPSDAEAGRSGRNRKLTRSARWIPWARKVYDFYNAPVVKFWFHTMSYLAFLMLFAYTVLVRMEKRPSA----PEWLVISYILSTALEKAREVLMSEPRKFRKKLKVWFSEYWNMHDFIGIILFFTGFALR-WQSGLVHTAGRLIYCLNIIFWFVRLLDLLAINQKAGPYLTMITKMMSNMFYIVVIMGIVLVSFGTPRGSVLKPYEEP-SWDLLKEVLFQPYFMMFGEVYAGEINPCE 685          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 138.272 bits (347), Expect = 4.274e-49
Identity = 151/702 (21.51%), Postives = 288/702 (41.03%), Query Frame = 3
Query:  972 ILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLV--LKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQN-----------ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQ---------DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTS-AMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPS------------VNQPTQSERSNESAESQ---------------------------TPEFMYEANSPFKRHYSQSK---KKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTN 2882
            I+   + T N          + L E   +       H   +    +D  I+ A++   + +  ++ L + + ++  DIA+  VF+   +  +  +       ++  L  ++++FVKL +EN  S+  FLT   L  LYN S + + S    LL          F       K  L  V  +I  + G   ++            N++ +    +  T +   +  + S + V      P+         +L  WA+L +   +A+ FW+ GEE +  AL+A  +   + G  ++    +     L  A  KF ++A+ ++ ++  + +     LL   L+ W+N TCL++A+S     F++ +     +  +W G L+     W  +I        I  L   S            ++Q  Q ER + +A ++                           T      A+     H  +     + + +     I  FY  PIVKF  + ++Y+ FL++F Y+ LV+L+    +Q    E F+  Y+     E +R+I   E      K+K +L G WNI D  GIL++ +   LR      L I  +  YS+ +    +R++  + ++  +GP ++MIG+M+      + I ++ ++S+G    A+    +   +  L   I ++PY+  +GE+   E   N
Sbjct:  242 IVGTIKKTFNFSHGQAMHLLQTLLECMRRKELITVFHTGSEDHSDVDLAILTALLKGTNFSSADQ-LNLALAWDRVDIAKNHVFVYGQHWMVRLEWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTSDHHQMSNLRILL--------HRFSHLPPDYKITLIDVGLVIEFLMGGAFRSMYTRKRFRLLYHNLYGQHRASVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSREDELKWKRLWCARVKFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSILMLEYKSKAEMSHIPQSEELHQMGQEEREHRAAATRDIPMQRCLSRRVFLRLLSFAIRILLLRTVGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQ----EWFVILYLFMSAIERVREIFMSEPGKFGQKIKVWLDGYWNINDSLGILLFFVAVALRS--QSHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQCMLMIIMAIVLLSFGVARQAILFKEADP-SWYLARNIVFQPYWMIFGEVYAPEIDNN 927          

HSP 2 Score: 75.8702 bits (185), Expect = 4.274e-49
Identity = 64/229 (27.95%), Postives = 107/229 (46.72%), Query Frame = 2
Query:  284 HFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN-----PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEK------CVRENDNG-NVVQILYEGGSRALESAYNSL--KASIPLVLIKNSGRAADVI 928
             + R + +  P+++    +LM+  W    P+L+ISV GGL+    +   ++   K  LI+       WI  GG N G+ N +  A+ E+ S+   SS+++  +GI  WG I N   L  ++     P    +    K  +L   H   F+  DDGT  +Y  E   R + EK      C      G  VV ++ EGG   + +    L  +  +P+V+ + +GRAAD++
Sbjct:    1 QYARVSYDSRPDLL---LQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSK-GLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHASR---SSHKICTIGIAPWGVIENRGDLVGQDSHVVSPYQTLSNPLSKLNLLNSLHSH-FILVDDGTVGKYGAEAQLRRELEKHIATVACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADIL 221          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 147.517 bits (371), Expect = 4.261e-36
Identity = 153/608 (25.16%), Postives = 277/608 (45.56%), Query Frame = 3
Query: 1170 LKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKN-FDSKRK-----------KSKYLLYPVRRII--------NMMSGNILQN-ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQ-DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSD-TSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQI-IDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCF---LSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELML----DEFHTNESTNQA 2900
            L++ + +N  DIA  ++F   D +      L +     L  N+ EF+ LF+E+   + ++LT   L  LYN +     S   ++L+  I+  +K+  D  R+            + + LY +  +I        +M+ GN +     + P            + EF+ Q++ E       P+ DLF+WA+L    ELA  FW  G++ + +AL+AS +L  M   +++   SD TS ML++A   ++++AI ++ E +   +     LLIR L +W   TCL +A   N   F S S   + + +IW G +S  L  W++++ I F  ++   +I         + R    A + TP              ++ +   + P    I +F+   +  F+        FL +F Y+    + ++ +    W E  ++ +VL +I EE+RQ+  D E+ G       Y+   WN  DI  +L++ I    R     +++  F   R    V   + CLR+M  + ++ TLGPK+I++ RM+ DIFFFL +  +++++YG     +     + ++  +   + Y+PY   +G+         F T   TN  
Sbjct:  374 LRLALAWNRVDIATSEIF--TDDRKWQTGDLEQVMDAALLENRPEFISLFVEHGLILREYLTWARLESLYNGA---PASSLLHILLRRISEGEKSPADPHRRWISTLPMAPKRMNHFSLYHISLLIRELLGDSTSMLYGNKMSRFSKLSPSSKNTGSTKGGTSLEFKGQTYNEGQLYCPDPERDLFIWAVLLNRRELANFFWSQGKDCMAAALMASKLLKAM---VQEEDDSDRTSDMLAQADN-YEQLAIGLLDECYKDDELRAQKLLIRQLHSWGGATCLSMAYHANNKSFFSHSGVQALLTQIWWGGMSVDLKTWRVILCIIFPLLIYTRII---------TFRWVLYAHTCTP--------------TRWRNFWTAP----ITVFWANVVSYFI--------FLWLFAYV----IIMDFQYTPDWPEYVLYAWVLSLILEELRQVFTDPEKAGQWKAAVRYIKDIWNRIDILALLLFTIGVICRLIPNSINESTFQAGRSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKRMVKDIFFFLFLLGVWVVAYGVATQGILILNEQRLDW-IFRGVVYQPYLLIFGQFPTRVDSTTFDTTSCTNNG 932          

HSP 2 Score: 82.0333 bits (201), Expect = 5.995e-16
Identity = 59/244 (24.18%), Postives = 105/244 (43.03%), Query Frame = 2
Query:  113 GEIFETCKCGNIKTDHQDFPIKD-----EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLK--RMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKV-LLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGN 811
            G     C+C + +++H +  +       + W    +T     + FG I FTG    +      F+R   +  P    V++KLM+ +W+   P L+ISVTGG K   +        ++              WII GG   G+   + E+V ++     +   ++  +GI TWG I N + L +     P  +   +  +G++  LD++   F+  D+GT  QY  E   R + E+ +     G+
Sbjct:   28 GAARRVCECRHPRSEHANTALLKPTLLGQKWEPAKHTANEPTNAFGDIQFTG----LGQRLGKFVRVGNDTEPS---VLFKLMMEHWHLDVPNLLISVTGGAKNFHLKPQLRTIFRHGLNKTARSTGIQGAWIITGGSYAGVMKYVGESVRDFALASGSKEGKIVAIGIATWGIIHNKEHLIDAQGKFPAEYPMDEAGQGRLSCLDNNHSHFILVDNGTHGQYGVEIVLRARLEQYISTQHTGS 264          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 140.969 bits (354), Expect = 3.302e-34
Identity = 139/596 (23.32%), Postives = 259/596 (43.46%), Query Frame = 3
Query: 1170 LKITIKFNCFDIAEKKVFL-NADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN---HSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYP--VRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQ---------DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRK-RGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQER-------------TGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
            L + + ++  DIA+  VF+    + +L            L  ++++FVKL +EN  S+  FLT   L  LYN     L   P R        +A    N  S        L P  +  ++ M+ G             + +  T +   +  + S + V      P+         +L  WA+L +   +A+ FW+ GEE +  AL+A  +   + G  ++     D+S  L + S +F ++A+ ++ ++  + +     LL   L+ W+N TCL++A+S     F++ +     +  +W G L+     W  +I        I  L   S  + +   +S E  +           S  K       + + +     I  FY  PIVKF  + ++Y+ FL++F Y+ LV+L+    +Q    E F+  Y+     E +R++ D  R               +  K+K +L G WNI D  GIL++ +   LR      L I  +  YS+ +    +R++  + ++  +GP ++MIG+M+ ++F  + I ++ ++S+G    A+    +   +  L   I ++PY+  +GE+   E
Sbjct:  312 LNLALAWDRVDIAKNHVFVYGQHWMALMWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTVSGPLTNPPKR------PLLA----NSRSPPVGLNCTLNPPVIGNLLLMILGGTCSAI-------QAVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSEAVEDSSEELKQYSTEFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSILMLEYKSKAEMSHIPQSEELHQMGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLPSVQ----EWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLDGYWNINDSLGILLFFVAVALRS--QSHLLIEAKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMANMFSIVIIMAIVLLSFGVARQAILFKEADP-SWYLARNIVFQPYWMIFGEVYAPE 883          

HSP 2 Score: 75.0998 bits (183), Expect = 7.001e-14
Identity = 64/233 (27.47%), Postives = 107/233 (45.92%), Query Frame = 2
Query:  287 FIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN-----PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEK-----------CVRENDNG-NVVQILYEGGSRALESAYNSL--KASIPLVLIKNSGRAADVI 928
            + R + +  P+++    +LM+  W    P+L+ISV GGL+    +   ++   K  LI+       WI  GG N G+ N +  A+ E+ S+   SS+++  +GI  WG I N   L  ++     P    +    K  +L   H   F+  DDGT  +Y  E   R + EK           C      G  VV ++ EGG   + +    L  +  +P+V+ + +GRAAD++
Sbjct:    1 YARVSYDSRPDLL---LQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSK-GLIKAALTTGAWIFTGGVNTGVVNHVGNALKEHASR---SSHKICTIGIAPWGVIENRGDLVGQDSHVVSPYQTLSNPLSKLNLLNSLHSH-FILVDDGTVGKYGAEAQLRRELEKHIALQKIHTLACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADIL 225          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 167.548 bits (423), Expect = 1.747e-71
Identity = 194/774 (25.06%), Postives = 353/774 (45.61%), Query Frame = 3
Query: 1011 KDIEKFQEILREIYEKYRNQIFVHDLFDK-SMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNH---SLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQL--IRTDEENFEFQ---SQSFIEVHSKKITPQ-----DLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRH-----------YSQSKKKAS----------------------IP------------------YKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWA----EIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIAL----QDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSF 3110
            K  +K   +++++ E  +  I V+ L  + S  +D  I++A++ +   + + + L + + +N  D+A+  +F   + Q    + L       L +++ EF +LFL+N  S+ +FL+ + L  LY     +  +KP     LL   +         KR+     +  V  +I  + G++   E+ + K G     + +  E    +   S   +  +  +I P      D+FLWA+L    ELA + W+ G E + +AL+AS +L +M    ++    +D S+ L   ++ F+E A+ V+ E  N+ +  + TLL+R L  ++ MT L++A+S    +F++ ++C   + ++W G ++     WK+L+ +         LI P +      +   ++AE +  + + + +S  K H           Y   ++KA                       IP                  + D I  FY  P  KFV +++ Y+ F+ ++ Y+ L         +        EI ++F+V  I+ EEIRQ+  +       K+  Y S +WN  DI  + V+II   LR F +  +F  +R   S+ +    +R +Q + ++  LGPK++MI +M+ D+  F+ I ++F I+YG    A+        +R      IT +   PY+Q YGEL LDE    +               P +  E   D     GR       A++++ TNILL+NLLIA+F +TF ++Q +S K + F
Sbjct:  373 KGADKTYSMIKDVLEDEK-MISVYSLDGEISQDIDLAILKALLKANRSSPVAQ-LNLALAWNRIDLAKSDIF--TEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGNTTIKP-----LLQKEMG--------KRQVKTIDMDVVGEVIEELMGDMF--ESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPV-----LIFPIIYFVPDEQHERQAAEREHQKSLNQKSSKVKSHKEKNDAPVVPVYRSKEEKAVSNDEEARVGTENEEEDFQLEDYIPEIREDDSMEVIMRNKKLGFCDRIMHFYSAPFSKFVGNVVGYLAFIFLYAYVVLFNFPRFDPAKTLGGIHPTEIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFSDTWNFVDIFSLTVFIIAIILRFFTNSRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEIQGEK---------------PKEFGEVDPD-----GRWLSPLLLAIYMVFTNILLLNLLIAIFNYTFERVQEDSDKVWKF 1102          

HSP 2 Score: 122.479 bits (306), Expect = 1.747e-71
Identity = 95/330 (28.79%), Postives = 147/330 (44.55%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKY--KGEIFETCKCGNIKTDHQDFPIKD----EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN----PTYHFTKKTEKGK-VLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV------RENDNGN----VVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTRKDKINIKCQPIN 994
            +I + F  R C ++  K      CKCG  +  H    ++     E W++ + T     + +G I+F GY        P+    +  DA     +V  LM+  WN   P L+ISVTGG K        ++   +  LI+  K    WII GG N G+   + EAV E +     S  QV ++GI TWG +     L +E     P  +  + T   +  +LD +   F   DDGTE +Y  E   R + E+ +        ++ G+    VV ++ EGG   + + Y  +K  +P V+I  SGRAA V+    +  + R    N+  Q IN
Sbjct:   35 WIARNFSRRECIRFVPKSHDVSRCKCGRPRERHSQQALESGQGSEEWNVASCTTKHPTNAYGEIDFEGYGG--QKRAPYLRMSHDTDA----NLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRR-GLIKAAKTTGAWIITGGTNTGVMKHVGEAVKE-QQLMFGSDTQVNVIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIKR----NVDGQTIN 352          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 137.502 bits (345), Expect = 1.669e-58
Identity = 190/767 (24.77%), Postives = 348/767 (45.37%), Query Frame = 3
Query: 1008 EKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGY----LLVDFIATTDKNFDSKRKKSKYLLYPVR-------RIINMMSGNILQNEN--IHPKP-------GRQLIRTDEE-------------NFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQ----PTQSERSNESAESQTPEF-MYEANSPFKRHYS-----------QSKKKASIPYKDMIKM-----------FYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSW--NIYDIC---GILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRM-TIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSF 3110
            E  +  +Q +L+ + ++    IF  D  D  +++D+ I+ A++ S   + LE  L + + ++  DIA+ ++F   + Q     +L       L ++++EFV L L+N  S+ +FLT + L  LY     V+ S+  +    + + +   T  N  ++  K  + +Y  R       R    + G+   +     +P P       G  L+ T E+             +  F  QS  E++   + P  L +  L TE  +  +     GE      L   I     +    K   +D S      S++F ++A+ ++ E +         LLI     W   T L +A++    EF++ S C   + +IW G L         ++       LI  L   S  +    PT     ++SA+   P+F  Y    P    Y+           +++K +    + ++++           FY  PI KF  +LI Y+LFL+VF ++ L+EL     I+    E  +  +V  +  EE+RQ+    R  +++    + S  W  N++++C    ++++ +   LR  L+     +    YS+ + +  +R++  + +S  LGP V+MIGRM +D+ +FL I  +F+++YG    A+     +  +  LIT+IF+RPYFQ YGEL +++   + ++ +         AF +         D   GR+ T+I  F  +LL+ NILL+NLLIA+F +TF+++Q  S++ + F
Sbjct:  301 EDRLSIYQNVLKCVAKREFVTIFCVD--DGGLEVDKAILRALLKS-QHSQLEDQLSLALVWDRADIAKTEIF--TEDQKWEVPMLETAMMEALLHDRVEFVDLLLDNGVSMANFLTVKRLEELYRK---VRGSKANHASSRIFMHYHNDTYTNASTQMNKHTHGIYTQRCTHLHYARTHTYLHGHAHAHIRFCTYPVPLSPLQSMGSVLLFTSEKMPSRVTRYGFFSTSLRFVKQS-TEIYHPPLPP--LSISYLQTEAWDPCVR----GEPQEAQMLQICIKPGNRQETSAKEAAADASCRDMLDSREFYDIALGLLDECYKANDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTEIWMGALKTGYNGSLKVLLGILFPPLIFALEFRSREEMQRVPTTD---DDSADDLPPDFDPYHHREPGSAQYNDGYLGDGVAFVKNRKSSGNEEEPIVEIRLLGLGKRIIGFYNAPITKFWSNLIVYLLFLVVFSHVILIELPPVPSIE----EWVLIGFVFSLCAEEVRQV----RVINVWNFSFFESSDWASNVWNLCDGFAMVLFFLAVGLR--LNPGTLRIGHLVYSLDIMLWIIRLLDIFSVSKDLGPYVVMIGRMTIDMMYFLVIMVVFLLAYGVAQQAILFPHEKP-SWELITKIFFRPYFQVYGELFIEDVDYSSNSRET--------AFSTPK------FDEYGGRLVTVIMAF--YLLVANILLLNLLIAIFNNTFSEVQANSNQIWKF 1022          

HSP 2 Score: 108.612 bits (270), Expect = 1.669e-58
Identity = 75/268 (27.99%), Postives = 127/268 (47.39%), Query Frame = 2
Query:  173 IKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEY----RSQQ-ANSSNQVKLLGICTWGAILNNKILCN---ENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGN------VVQILYEGGSRALESAYNSLK--ASIPLVLIKNSGRAADVI 928
            ++D  W    +T     D FG + F G        Y   IR   +  PE+V    +L+   W    P+L+ISVTGG K    +   ++   +  L++  +    W+I GG N G+   + EAV  +    R +Q  N+++QV L+GI +WG + + ++L N   E   Y  T   +     LD++   F+  D+GT+ +Y  E +FR   E  +             VV ++ EGG   + +   S+    ++P+V+ + SGRAAD++
Sbjct:    1 VQDTKWVPTRHTVTLPTDAFGELEFQGAGQPSRAKY---IRLAHDTDPELV---LRLLCGEWALDLPKLLISVTGGAKNFILSPKIKRVLRE-GLLKAAQTTGAWVITGGTNTGVMRHVGEAVKGHTVMSRGEQLKNTAHQVHLIGIASWGIVDHKEMLVNPKVEVVPYQMTSSMQSRGACLDNNHSHFILVDNGTDGEYGGEISFRASLENLIASKKMAQKFHGVPVVLLVLEGGPNTIRTVLESVSRCPAVPVVIAEGSGRAADIL 261          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 129.798 bits (325), Expect = 7.717e-54
Identity = 162/710 (22.82%), Postives = 296/710 (41.69%), Query Frame = 3
Query:  972 ILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMK-LDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNAD---YQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLY-------NHSLY-----VKPS-------------------------RCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTD-----------EENFEFQSQSFIEVHSKKIT----P-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQ----PTQSERSNESAESQTPEFM-----------YEANS----PFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFL---SQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGEL 2858
            I++  + T N    D     ++L E   K +  I V D+  +  + +D  I++A++   + +  ++++ +T+ ++  DIA+  VF+        SL Q +L       L  ++++FVKL +EN  S+  FLT   L  LY       N +L      VK S                         RC Y    F    +    S R+  ++   P            +Q +          I+T            E+N +   +  +++   +      P  +L +WA+L +  ++++ FW+ GEE++  AL+A  +   M    +K     DTS  L   S  F  +A+ ++ ++  + +     LL   LK W+N TCL++A+S +L  F++ +     +  +W G L+     W  +I        I  L   S  +    P   +    + E     F             EA S      K       +   +P    I  FY  PIVKF  + + Y+ FL+++ Y+ LV++      Q    E  +  Y+     E+IR++   E      K+K + S  +N+ D     + I+TFF+ C L     D F+  R  Y + +    +R++    ++   GP V+MI +M+ ++F+ + I  + ++SYG    A L  N   +  L+   ++ ++PY+  YGE+
Sbjct:  356 IIATIKKTFNFSHSDAIHLFQMLMECM-KSKELITVFDISSEEQQDIDVAILKALLQGTNSSPFDQLV-LTLAWDRVDIAKNHVFVYGQQLLVSSLEQAMLD-----ALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNTKQSPNNPTLLHLVRDVKQSNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGSNRRSGRHAAGPGSHFRKSHEAFSMQADKKEKTRHNHFIKTAQPYKPKVDSSAEQNKKRSKEEIVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKSKAEMAHIPQSQDDHQMTMEDSEHNFQNLHEDIQMDVFKEARSHDHVETKHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKMIQAPSTQ----EWVVIVYIFTSAIEKIREMFMSEAGKISQKIKVWFSDYFNVSD----FLAIVTFFIGCGLRLAGGDAFLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLA--RDVVFQPYWMMYGEV 1048          

HSP 2 Score: 102.449 bits (254), Expect = 7.717e-54
Identity = 80/298 (26.85%), Postives = 137/298 (45.97%), Query Frame = 2
Query:  131 CKCGNIKTDHQDF-------------------PIKD-EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV-------RENDNGNVVQILYEGGSRALESAYNSLKAS--IPLVLIKNSGRAADVI 928
            C CG +   H  F                   P+ + E WS+E +T+    D +G+INF G +    ++   ++R + +  P   E V +LM+  W+   P+++ISV GG++       + K+   + LI+       WI+ GG N G+   + +A+ E+ S+   S+ ++  +GI  WG I N   L  ++   P         K  VL + H   FL  DDGT  +Y  E   R   EK +       R      VV +++EGG   + +    L+ +  +P+V+ + +GRAAD++
Sbjct:   49 CCCGRLVRQHAGFTASLATKYSDVKLGENPNPPMPELEEWSVEKHTEVSPTDAYGVINFQGGSH---SYRAKYVRLSYDSRP---ESVLRLMLKEWHMELPKILISVHGGVQNF-ELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSR---SAKKICTIGIAPWGVIENRNDLIGKDIIAPYQTLLNPLSKLNVLNNLHSH-FLLVDDGTVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADIL 335          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 128.642 bits (322), Expect = 5.726e-53
Identity = 162/710 (22.82%), Postives = 296/710 (41.69%), Query Frame = 3
Query:  972 ILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMK-LDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNAD---YQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLY-------NHSLY-----VKPS-------------------------RCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTD-----------EENFEFQSQSFIEVHSKKIT----P-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQ----PTQSERSNESAESQTPEFM-----------YEANS----PFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFL---SQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGEL 2858
            I++  + T N    D     ++L E   K +  I V D+  +  + +D  I++A++   + +  ++++ +T+ ++  DIA+  VF+        SL Q +L       L  ++++FVKL +EN  S+  FLT   L  LY       N +L      VK S                         RC Y    F    +    S R+  ++   P            +Q +          I+T            E+N +   +  +++   +      P  +L +WA+L +  ++++ FW+ GEE++  AL+A  +   M    +K     DTS  L   S  F  +A+ ++ ++  + +     LL   LK W+N TCL++A+S +L  F++ +     +  +W G L+     W  +I        I  L   S  +    P   +    + E     F             EA S      K       +   +P    I  FY  PIVKF  + + Y+ FL+++ Y+ LV++      Q    E  +  Y+     E+IR++   E      K+K + S  +N+ D     + I+TFF+ C L     D F+  R  Y + +    +R++    ++   GP V+MI +M+ ++F+ + I  + ++SYG    A L  N   +  L+   ++ ++PY+  YGE+
Sbjct:  349 IIATIKKTFNFSHSDAIHLFQMLMECM-KSKELITVFDISSEEQQDIDVAILKALLQGTNSSPFDQLV-LTLAWDRVDIAKNHVFVYGQQLLVSSLEQAMLD-----ALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNTKQSPNNPTLLHLVRDVKQSNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGSNRRSGRHAAGPGSHFRKSHEAFSMQADKKEKTRHNHFIKTAQPYKPKVDSSAEQNKKRSKEEIVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKSKAEMAHIPQSQDDHQMTMEDSEHNFQNLHEDIQMDVFKEARSHDHVETKHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKMIQAPSTQ----EWVVIVYIFTSAIEKIREMFMSEAGKISQKIKVWFSDYFNVSD----FLAIVTFFIGCGLRLAGGDAFLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLA--RDVVFQPYWMMYGEV 1041          

HSP 2 Score: 100.908 bits (250), Expect = 5.726e-53
Identity = 74/261 (28.35%), Postives = 128/261 (49.04%), Query Frame = 2
Query:  182 EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV-------RENDNGNVVQILYEGGSRALESAYNSLKAS--IPLVLIKNSGRAADVI 928
            E WS+E +T+    D +G+INF G +    ++   ++R + +  P   E V +LM+  W+   P+++ISV GG++       + K+   + LI+       WI+ GG N G+   + +A+ E+ S+   S+ ++  +GI  WG I N   L  ++   P         K  VL + H   FL  DDGT  +Y  E   R   EK +       R      VV +++EGG   + +    L+ +  +P+V+ + +GRAAD++
Sbjct:   79 EEWSVEKHTEVSPTDAYGVINFQGGSH---SYRAKYVRLSYDSRP---ESVLRLMLKEWHMELPKILISVHGGVQNF-ELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSR---SAKKICTIGIAPWGVIENRNDLIGKDIIAPYQTLLNPLSKLNVLNNLHSH-FLLVDDGTVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADIL 328          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Medaka
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:101156483])

HSP 1 Score: 128.642 bits (322), Expect = 6.118e-53
Identity = 162/710 (22.82%), Postives = 296/710 (41.69%), Query Frame = 3
Query:  972 ILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLF-DKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNAD---YQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLY-------NHSLY-----VKPS-------------------------RCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTD-----------EENFEFQSQSFIEVHSKKIT----P-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGY-SDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQ----PTQSERSNESAESQTPEFM-----------YEANS----PFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFL---SQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIA-LQDNRSRAMNLSLITEIFYRPYFQTYGEL 2858
            I++  + T N    D     ++L E   K +  I V D+  ++   +D  I++A++   + +  ++++ +T+ ++  DIA+  VF+        SL Q +L       L  ++++FVKL +EN  S+  FLT   L  LY       N +L      VK S                         RC Y    F    +    S R+  ++   P            +Q +          I+T            E+N +   +  +++   +      P  +L +WA+L +  ++++ FW+ GEE++  AL+A  +   M    +K     DTS  L   S  F  +A+ ++ ++  + +     LL   LK W+N TCL++A+S +L  F++ +     +  +W G L+     W  +I        I  L   S  +    P   +    + E     F             EA S      K       +   +P    I  FY  PIVKF  + + Y+ FL+++ Y+ LV++      Q    E  +  Y+     E+IR++   E      K+K + S  +N+ D     + I+TFF+ C L     D F+  R  Y + +    +R++    ++   GP V+MI +M+ ++F+ + I  + ++SYG    A L  N   +  L+   ++ ++PY+  YGE+
Sbjct:  364 IIATIKKTFNFSHSDAIHLFQMLMECM-KSKELITVFDISSEEQQDIDVAILKALLQGTNSSPFDQLV-LTLAWDRVDIAKNHVFVYGQQLLVSSLEQAMLD-----ALVMDRVDFVKLLIENGVSMHRFLTINRLEELYNTKQSPNNPTLLHLVRDVKQSNLPPNYKITLIDVGLVIEYLMGGTYRCNYTRKRFRIIYNNLHGSNRRSGRHAAGPGSHFRKSHEAFSMQADKKEKTRHNHFIKTAQPYKPKVDSSAEQNKKRSKEEIVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFFWQHGEENMAKALVACKLCRSMGYEAKKSDVVDDTSDKLKDYSNDFGTLAVDLLEQSFRQDETMAMKLLTYELKNWSNSTCLKLAVSSHLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILLLEYKSKAEMAHIPQSQDDHQMTMEDSEHNFQNLHEDIQMDVFKEARSHDHVETKHDMEMHVRSRKLPLTRKIYAFYHAPIVKFWSNTLFYLGFLMLYTYVVLVKMIQAPSTQ----EWVVIVYIFTSAIEKIREMFMSEAGKISQKIKVWFSDYFNVSD----FLAIVTFFIGCGLRLAGGDAFLPGRIVYCLNIIFWYVRLLDILAVNQQAGPYVMMIAKMVANMFYIVVIMLVVLLSYGVPRKAILYPNEEPSWTLA--RDVVFQPYWMMYGEV 1056          

HSP 2 Score: 100.908 bits (250), Expect = 6.118e-53
Identity = 74/261 (28.35%), Postives = 128/261 (49.04%), Query Frame = 2
Query:  182 EIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCV-------RENDNGNVVQILYEGGSRALESAYNSLKAS--IPLVLIKNSGRAADVI 928
            E WS+E +T+    D +G+INF G +    ++   ++R + +  P   E V +LM+  W+   P+++ISV GG++       + K+   + LI+       WI+ GG N G+   + +A+ E+ S+   S+ ++  +GI  WG I N   L  ++   P         K  VL + H   FL  DDGT  +Y  E   R   EK +       R      VV +++EGG   + +    L+ +  +P+V+ + +GRAAD++
Sbjct:   94 EEWSVEKHTEVSPTDAYGVINFQGGSH---SYRAKYVRLSYDSRP---ESVLRLMLKEWHMELPKILISVHGGVQNF-ELHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHCSR---SAKKICTIGIAPWGVIENRNDLIGKDIIAPYQTLLNPLSKLNVLNNLHSH-FLLVDDGTVGKYGAEVKLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQETPPVPVVVCEGTGRAADIL 343          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Medaka
Match: trpm5 (transient receptor potential cation channel subfamily M member 5 [Source:NCBI gene;Acc:101161300])

HSP 1 Score: 160.229 bits (404), Expect = 3.294e-49
Identity = 164/657 (24.96%), Postives = 299/657 (45.51%), Query Frame = 3
Query: 1014 DIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVI-----SSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYN--------HSLYVKPSRCGYLLVDFIATTDK--NFDSKRKKSKYLLYPVRRII-----NMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQ-SFIEVHSKKITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQV---------------PIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQ-IIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDE 2870
            DI  + +++++I + + + + VHD   ++ +LD  I++A++      S +  D    LK+ + +N  DIA+  +F N D +      L E     L N++ +FV+LF++N  ++ +FLT   L  LY         H+L +K      LL+    T     ++ S++ K ++ L+ V +++     +   G   +     P  GR           FQSQ +  E+      P +DLFLWA+L    ++A  FW +G E + +AL    IL +M      R  S+  +  S    K+++ A+ V  E ++  ++  Y LL+R    W+  T L +A   +   F +     + + KIW          W  + +      L+     P +      + S+E  ++++      +N  F    S   +KA I     I +   V               P+  F+ ++I Y  FL +F Y+ L++ K   +      EI ++F+V  ++ EEIRQ     E    I K K Y+  +WN  D+  IL++++   + C ++   +   R   ++   +  LR++  + I   LGPK+I++ RM+ D+FFFL   S+++I+YG    AL       ++  +     YRPY   +G++ L+E
Sbjct:  307 DISNWVKLIQKILD-HGHLLTVHDPEQETSELDTVILKALVKACKSQSQEAQDFLDELKLAVAWNRVDIAKSDIF-NGDVE-WKACDLEEVMMDALINDKPDFVRLFVDNGVNLGEFLTYGRLQELYWSVSEKSLLHNLLLKKYDEKQLLLGAARTPGPPGHYPSEQGKPRFTLFEVAKVLKDFLHDSCKGFYQKVPTEKPPKGRL----------FQSQKNLPELEELCEHPWRDLFLWAVLQNRQQMANYFWAMGPEAVAAALAGCKILKEM-----ARLESEAESARSMKEAKYEQFALDVFGECYSNSEDRAYALLVRRTHCWSKSTVLNLATEADAKSFFAHDGVQALLTKIW----------WGAMTTDTAISKLVVSFFCPPLIWTNLIKFSDEELDNRS------SNKQFVELDSLDTEKALIFLLRSILICASVWWRFFLRRWRRFWSAPVTVFLGNVIMYFAFLFLFTYVLLLDFKAPPQGPGV-PEIMLYFWVFTLVLEEIRQSFFTDEEMNIIKKFKLYVEDNWNKCDMVAILLFVVG--VSCRMAAGTYEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKDVFFFLFFLSVWLIAYGVATQALLHPNDPRIDW-VFRRALYRPYLHIFGQIPLEE 925          

HSP 2 Score: 56.9954 bits (136), Expect = 3.294e-49
Identity = 44/217 (20.28%), Postives = 94/217 (43.32%), Query Frame = 2
Query:  332 VYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCN---ENPTYHFTKKTEKGKVL-LDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG---------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            +Y+++   W    P L+++V GG   +       +   ++ L++  +    WI+  G   GI   + +AV ++     +S+ +V  +GI  W  I N + L +   + P  +  +    G V  LD++   F+  ++   +     +  R+K  K +     G          V+ +L  G  + L+    S+  S P +++  SG  AD++  +++
Sbjct:   71 IYQMLTQEWGLSPPHLVVAVVGG-DELAQMKPWLRDTLRKGLVKAAQSTGAWILTNGLRFGITKHLGQAVRDHSLASTSSTVRVVAIGIAPWNMIHNREALLSAKVDEPVVYTPQDLPHGSVYSLDNNHSHFVLVEEDPARP-GATSEMRVKLLKHISLQRTGYGGAGSFEIPVLCLLVHGEPKILKV---SIANSTPWLILAGSGGVADILVTLMN 282          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Medaka
Match: hrc (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:101158642])

HSP 1 Score: 103.605 bits (257), Expect = 3.100e-44
Identity = 73/292 (25.00%), Postives = 134/292 (45.89%), Query Frame = 2
Query:  125 ETCKCGNIKTDHQDFPIKDEI-------WSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSS-NQVKLLGICTWGAILNNKILCNEN---PTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG--------NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILD 943
            + C+CG  K +H    I D         W    ++     D +G + F G     +  + +F+R +    P     +Y LM + W+   P L++SV GG +      N  ++  ++ L++  ++   WII  GF  G+   + EAV ++ +  ++ S N+V  +GI +WG + N + L N     P  +  + + K    LD++   FL  DDG+  +   E +FR K E  +     G         V+ +L  G +  L+    SLK S+P +++  SG  A+ ++ +++
Sbjct:   44 KMCQCGKPKVEHPPQAIGDYFSAAIVNYWDSVRHSSELPTDAYGELQFAG----ASKRHSYFLRLSWGTNPS---TIYNLMTVQWSLPSPNLVVSVVGG-ESQASVKNWVREVIRKGLVKSSQRAGAWIITEGFREGVGKCVGEAVRDHATAASSGSFNKVVAVGIASWGLVYNKEQLINPEGSYPAKYDIRNSPKDSCCLDNNYQAFLLVDDGSVGRKGGEISFRAKLEDHISHQPTGIQESGINVPVLCMLISGDTSMLKRVEISLKKSLPWLVLAGSGGLAEFLSDVVE 327          

HSP 2 Score: 96.6709 bits (239), Expect = 3.100e-44
Identity = 94/389 (24.16%), Postives = 175/389 (44.99%), Query Frame = 3
Query: 1005 DEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMK-LDRKIVEAVIS------SIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFI--------------ATTDKNFDSKRKKS---------KYLLYPVRRIINMMSGNILQN------ENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITP-QDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLS--RASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMW 2054
            +EK+ +K  E+   IY+  ++ I V++   + +   D+ +++A++       S+DD+   + L++ + +N  DIA  ++F N D      K L ++    L N++ +FV+LF EN F+I  +LT + L  LY       PS  G LL   +                 D   DS  +           K  L+ V  +++M+  ++ Q       E  H    R+ ++   +    +S+   E   + + P   LF+WA+L    E+A  FW++  E +  AL    +L +M  L      ++T   LS    ++ F+ +A  + +  ++  +   +TLLI+    W   TCLQ+ + G+   F S     S + +IW G++     +W
Sbjct:  365 NEKETDKVVELTLSIYQN-KDLITVYNGTQERLNDFDKVLLKALVRASKQRVSVDDSPYIEELRLAVTWNRVDIARSELF-NGDIL-WKDKDLKDSMTNALINDKPQFVRLFTENGFNIRSYLTYKKLEKLYQSV----PS--GTLLYQLLERRLLIRHGITALSPAHDSQPDSPNQPKESNQCQPVMKVTLFEVSGVLDMLLDDVCQPFYYDVLELGHFSSRRRALKQAAKLLVGESKYREE---RCVYPWASLFIWAILQRRNEMATFFWEMAGESVLCALSGCKMLREMSKL-----ETETEGKLSLKEMAQSFENLAHDIFSSCYHSDENRAFTLLIKKSPVWGGTTCLQMGMGGDTRLFFSHDGVQSLLSQIWWGDMKRNTEVW 736          

HSP 3 Score: 89.7373 bits (221), Expect = 1.212e-17
Identity = 85/295 (28.81%), Postives = 149/295 (50.51%), Query Frame = 3
Query: 2259 KMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIAL----QDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTI-------GRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSF 3110
            + F+  P+  F+ +++ Y LFL++F Y+ LV+ K         +E  ++F+V  I+ EEIR+           +L++Y+   WN  DI  I ++I+   L C + +  +   R    V   +  LR++  + I   LGPK+I++G+M+ D+FFFL    +++I+YG    AL      N  R     +   +FYRPY   +G++ ++E  +              K +  +   N+T ID              ++    ++LL+TNI+LINLLIA+F HTF+++Q  S  ++ F
Sbjct:  830 RQFWFAPVTSFLGNVLMYFLFLVLFAYVLLVDFKPQPPWGPAVSEYVLYFWVFTIVCEEIRETAFLGTRNWRQRLRSYIQDVWNKIDIVAITLFIVG--LICRMYERSYEFGREVLCVDYMVFTLRLIHIFAIHKQLGPKIIIVGKMMKDVFFFLFFLGVWLIAYGVANQALIYSYDSNPDR-----IFRRVFYRPYLHIFGQIPVEEIDSG-------------KNWDLECTNNMTMIDSGSEPCRVEHSNWVVVVLLIIYLLVTNIVLINLLIAIFSHTFSEVQANSDIYWKF 1104          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Planmine SMEST
Match: SMESG000004977.1 (SMESG000004977.1)

HSP 1 Score: 1389.02 bits (3594), Expect = 0.000e+0
Identity = 742/781 (95.01%), Postives = 744/781 (95.26%), Query Frame = 3
Query:  957 EKIKSILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSFIQLQXXXXXXXXXXXXXXXXXXHYLITGIIYCGNRCCHKQTRNQNSLLLQDLPKEENKKFSYF 3299
            EKIKSILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWKILISIPFSFILIKPLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVD              +  L IALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTN                    DENITDIDRTIGRMTIICGFAVFLLLTNILLINLLIAMFGHTFNKIQVESHKFFSFIQLQLVEEFLEKPLLPPPFNLLHYLITGI+YCGNRCCHKQTRNQNSLLLQDLPKEENKKFSYF
Sbjct:  303 EKIKSILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWKILISIPFSFILIKPLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVD-------------IFFFLTIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTN--------------------DENITDIDRTIGRMTIICGFAVFLLLTNILLINLLIAMFGHTFNKIQVESHKFFSFIQLQLVEEFLEKPLLPPPFNLLHYLITGIVYCGNRCCHKQTRNQNSLLLQDLPKEENKKFSYF 1050          

HSP 2 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 299/299 (100.00%), Postives = 299/299 (100.00%), Query Frame = 2
Query:   59 MDLFIKKYFQIRYCYKYKGEIFETCKCGNIKTDHQDFPIKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 955
            MDLFIKKYFQIRYCYKYKGEIFETCKCGNIKTDHQDFPIKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMNFNTNQQKKNFKQSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT
Sbjct:    1 MDLFIKKYFQIRYCYKYKGEIFETCKCGNIKTDHQDFPIKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMNFNTNQQKKNFKQSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMT 299          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Planmine SMEST
Match: SMESG000004955.1 (SMESG000004955.1)

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 361/792 (45.58%), Postives = 521/792 (65.78%), Query Frame = 3
Query:  972 ILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNF--DSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYE---------ANSP--FKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLK---IQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSFIQLQXXXXXXXXXXXXXXXXXXHYLITGIIYCGNRCCHKQTRNQNSLLLQDLPKEENKKFSYF 3299
            I+   +  + + + D  +  EIL +IY  Y+ +I +HDL D+++ LD+KI++A+ISS +D +LEK L + ++FNC DIA+ KVF ++   +L+QK L   FK +L  NQ E ++LFL NNFSI++F+ +E+L  LY  SL     RC  ++ D I   DK+F  D+     K LL  + +II  +S NIL+ E+                  F  +S    ++ + + ++LFLW+L++ +TE+A+IFW+ G+E++GSALI SIIL+KM+  I+ +G++D S  L + S KFQE+A  ++T+A+   QE T+ +L R L  WNN+TCLQIAI GNLL+FL+ +AC SY R+ W G+LSPFLP WKIL++IPFS +LIKP I+P V+       SN S E    +F++E           SP  +K ++S+S +   + +   +  FY+ PIVKFVI+L+SY+ FL++F YLNLVELK   +   IQN  AE+ ++ ++LG I EEI QI + E+ G IYKLK+Y+SGSWN+YD+  I ++II+  +R  ++ D FI  RCFY+VTLS+  LR MQ+YFIS ++GPKVIMI +MIVD+FFFLSIFSLFIISYGTL+ ++Q+  S+  NL LI+E+FYRPYFQTYGELMLD+F                   PS  +  +      +   T+I GF +FLL+TNILL+NLLIAMFG+TFNKIQ ES KFFSFIQ+QLV+EF  KPL+PPP N+ +Y++  +   G    H  ++ +N+ L++ L  ++N K   F
Sbjct:  268 IVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFV-QENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFES------------------FNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSC--SNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQ---VSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSK-WNLFLISELFYRPYFQTYGELMLDDFK-----------------IPSPCNTTVC----IVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGF 1013          

HSP 2 Score: 246.899 bits (629), Expect = 0.000e+0
Identity = 145/266 (54.51%), Postives = 177/266 (66.54%), Query Frame = 2
Query:  191 SLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEV---VYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTRKDKINIK 979
            S    +    C TFG I F GY DI  N  P FIRF   D     E+    Y+L+  YWNF KPQL+IS+ GG KRMNF  NQQKKNFKQ L+EV++KD TWIIGGGF+VGIH L+SEAV ++R     + NQVKL+ I TWG + NN+ L      Y  +   EKGKV LD + D +LFCDDGTEK+YDKE +FRL FE+ VR+      VQILYEGG RA+ES Y SL+ SIPLV+IK SGRAAD+I  IL+      DK+N++
Sbjct:    8 SAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRD-IGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILE-----TDKMNVE 267          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Planmine SMEST
Match: SMESG000004955.1 (SMESG000004955.1)

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 361/792 (45.58%), Postives = 521/792 (65.78%), Query Frame = 3
Query:  972 ILSANQSTMNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNF--DSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYE---------ANSP--FKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLK---IQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSFIQLQXXXXXXXXXXXXXXXXXXHYLITGIIYCGNRCCHKQTRNQNSLLLQDLPKEENKKFSYF 3299
            I+   +  + + + D  +  EIL +IY  Y+ +I +HDL D+++ LD+KI++A+ISS +D +LEK L + ++FNC DIA+ KVF ++   +L+QK L   FK +L  NQ E ++LFL NNFSI++F+ +E+L  LY  SL     RC  ++ D I   DK+F  D+     K LL  + +II  +S NIL+ E+                  F  +S    ++ + + ++LFLW+L++ +TE+A+IFW+ G+E++GSALI SIIL+KM+  I+ +G++D S  L + S KFQE+A  ++T+A+   QE T+ +L R L  WNN+TCLQIAI GNLL+FL+ +AC SY R+ W G+LSPFLP WKIL++IPFS +LIKP I+P V+       SN S E    +F++E           SP  +K ++S+S +   + +   +  FY+ PIVKFVI+L+SY+ FL++F YLNLVELK   +   IQN  AE+ ++ ++LG I EEI QI + E+ G IYKLK+Y+SGSWN+YD+  I ++II+  +R  ++ D FI  RCFY+VTLS+  LR MQ+YFIS ++GPKVIMI +MIVD+FFFLSIFSLFIISYGTL+ ++Q+  S+  NL LI+E+FYRPYFQTYGELMLD+F                   PS  +  +      +   T+I GF +FLL+TNILL+NLLIAMFG+TFNKIQ ES KFFSFIQ+QLV+EF  KPL+PPP N+ +Y++  +   G    H  ++ +N+ L++ L  ++N K   F
Sbjct:  283 IVDKYEEQLRLTDDDKIRIIEILSDIYSNYKERITIHDLLDQNVHLDKKILDAIISSREDRNLEKTLNLAVRFNCVDIADFKVFQSSRASTLSQKTLGIYFKEMLSKNQHEMLQLFLVNNFSIDEFV-QENLQDLYMTSLRSIKCRCTEMISDLILREDKSFKIDNINNPGKNLLKVIYKIICNLSDNILKFES------------------FNLRSSNSHNANQNSYRELFLWSLISGYTEMALIFWENGKENVGSALIGSIILSKMKSYIKSKGFNDMSDTLLKTSIKFQELACDIITKAYKINQEKTHIVLTRPLNLWNNLTCLQIAIGGNLLDFLNLNACRSYTREAWMGDLSPFLPTWKILVTIPFSPLLIKPFIIPYVSNKKSC--SNLSHEKVKDKFLFEKEKIELNIRKKSPKSWKSYHSESDQ---VSFCRALIKFYRAPIVKFVIYLLSYITFLVIFAYLNLVELKPIKEVKVIQNVTAELLVYIFILGFIVEEINQINNTEKNGLIYKLKSYVSGSWNLYDMLTIFIFIISIIMRFTVNGDSFIFVRCFYAVTLSLFSLRTMQFYFISRSIGPKVIMIRKMIVDVFFFLSIFSLFIISYGTLSHSIQNPNSK-WNLFLISELFYRPYFQTYGELMLDDF-----------------KIPSPCNTTVC----IVQSATLIIGFGIFLLMTNILLLNLLIAMFGYTFNKIQGESEKFFSFIQIQLVDEFHNKPLMPPPLNIAYYILRKLWQSGKIIFHGDSKRKNTFLIKYLNDDQNLKIRGF 1028          

HSP 2 Score: 247.284 bits (630), Expect = 0.000e+0
Identity = 145/266 (54.51%), Postives = 177/266 (66.54%), Query Frame = 2
Query:  191 SLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEV---VYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTRKDKINIK 979
            S    +    C TFG I F GY DI  N  P FIRF   D     E+    Y+L+  YWNF KPQL+IS+ GG KRMNF  NQQKKNFKQ L+EV++KD TWIIGGGF+VGIH L+SEAV ++R     + NQVKL+ I TWG + NN+ L      Y  +   EKGKV LD + D +LFCDDGTEK+YDKE +FRL FE+ VR+      VQILYEGG RA+ES Y SL+ SIPLV+IK SGRAAD+I  IL+      DK+N++
Sbjct:   23 SAPQKSNLSACKTFGKIKFLGYEDISLNTNPQFIRFFPTDGNNFQELTYNAYELITKYWNFPKPQLLISINGGFKRMNFKNNQQKKNFKQGLMEVMRKDTTWIIGGGFHVGIHKLVSEAVNDFRILSDENENQVKLISISTWGVVKNNRSLTVGTCAYDNSNTIEKGKVTLDPNYDCYLFCDDGTEKEYDKEIDFRLDFERNVRD-IGAFAVQILYEGGKRAIESIYRSLQKSIPLVVIKESGRAADLICEILE-----TDKMNVE 282          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Planmine SMEST
Match: SMESG000005057.1 (SMESG000005057.1)

HSP 1 Score: 477.248 bits (1227), Expect = 0.000e+0
Identity = 302/738 (40.92%), Postives = 458/738 (62.06%), Query Frame = 3
Query:  954 QEKIKSILSANQSTMNI-----DEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKS---KYLLYPVRRIINMMSGNILQNE--NIHPKP--GRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXXXXXXXXLIMPSVNQPTQSERSNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKIQN---RWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSFIQLQ 3122
            +E I+ I+  N+ T+ I     ++ ++E+F   L E+Y  ++ QI ++D+ D +M  D+KI++A+I   D + +++ LK+ I+FNC +IA+K VF +  Y  L  +++ E F   LK+N+ EFV LF+ENNF +++F+ +  L  LY  S   +   C  LL D    T   F   +K +   +  L+    II  +SGN+L N+   +  KP   R  +    E F    +S ++ H    + QDLFLWALL+  T+L++I W+I + HIGSAL A+IIL KM  L+  RG ++    L+ ASKK+Q++A +++T+A+NK +  TYTLL+R+L  WN +TCLQIAI+GN+LEFL+ SAC SY  K+W G+LSPFLP WKI+I+IPFS  L+K +IMPS  +  ++ +    A++   + + + N+      +   K   I +   + +FY+ PIVKF IHL+SY++FL+VF Y NLVELK   +I++    WAEI+I+ YVL    EEIRQ+ DQE  G+ +K  +Y  G+WN +D   I+++I +   R  + Q+ F++ RC +S++LSM  +R MQ+YF++ ++GPK+IMI  M+ DI FFLSIF +F+I+YG LA +L+   S   N  L  +I Y P+FQT+GELML+ F      N                       D  +   T++  FAVFLL+TN+LLINLLIAMFG+TFN+IQ +S K + FI++Q
Sbjct:  337 KESIEFIVLENKITLQICTGPEEDAEVEEFTNYLVEMYCNFKKQIVIYDMMDANMSFDKKILQAMIVGADKS-MKRTLKLCIRFNCSNIADKIVFSDPKYDELGLEVIQEMFLYSLKDNKPEFVNLFVENNFDVDNFVNDAILKELYEISFDSEKCPCAELLCDLHRDTKSYFKLNKKSNSTEQNRLFDAGDIIAKLSGNLLNNQYSQLFDKPLIERDFLTDSFEEFAMLYESDVDAHKFSWSTQDLFLWALLSGRTDLSMILWRISKNHIGSALFAAIILKKMADLVLIRGDNNLQRKLTDASKKYQDLASSIITQAYNKSKSKTYTLLVRSLAKWNGLTCLQIAINGNMLEFLNHSACRSYTTKVWMGDLSPFLPTWKIIITIPFSLFLMKLMIMPSFPRKGKNPKDVPDAKNFHNKHLLDENAK-----APPLKSEEITFIKAMSIFYRAPIVKFSIHLLSYIVFLMVFAYCNLVELKPIQEIKSIKQVWAEIYIYIYVLTFAIEEIRQVFDQEINGAKHKFLSYFYGTWNKFDAVIIIIFIASVVARFSIPQNHFMICRCMFSISLSMFLIRSMQFYFVNKSIGPKIIMIRDMLRDILFFLSIFVIFVITYGILARSLKYPNSE-FNTLLFKDIVYTPFFQTFGELMLENFDVAGPCNGT---------------------DCIVSSGTVLISFAVFLLMTNVLLINLLIAMFGYTFNQIQEDSEKLWCFIRIQ 1046          

HSP 2 Score: 271.937 bits (694), Expect = 0.000e+0
Identity = 155/305 (50.82%), Postives = 196/305 (64.26%), Query Frame = 2
Query:   68 FIKKYFQIRYCYKYKGEIFETCKCGNIKTDHQDFPIKDEIWSLENNTKCRTCDTFGIINFTGYNDIITNHYPHFIRFNC-EDAPEIVEVVYKLMI--LYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAI---------LNNKILCNENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDL 946
            FIKK FQ R CYKYK +  + C C     +H D     E WS  NNT    C  FG+INF GY+DI   H P FIRF+C ED       VY+LM    YWN   P+LIIS+ GGLK+M   +NQ KKNFKQ LI V+KKD+TW+IG G + GIH L+SEA+ E+R  Q +  +QV L+G+ TWG +         LN KI  N    Y  T + EKGKV+LD+  D FLFCDDGTEKQYDKE  F LKFE  V++  +G +VQIL+EGG RAL +AY ++K  +PLV+IK SGR A++I+ ++ L
Sbjct:   27 FIKKNFQTRTCYKYKEKRKDFCSCNRELIEHTDKSNDPENWSYSNNTMLNPCTKFGLINFNGYDDIPREHLPKFIRFDCAEDCDATCRSVYELMTNSSYWNIPAPKLIISINGGLKKMRNISNQHKKNFKQGLINVIKKDQTWVIGSGLSAGIHKLVSEAISEFRFHQEDIKDQVSLIGVSTWGTVKNNQRLNRNLNAKIGTNLVFKYENTSEDEKGKVILDALYDTFLFCDDGTEKQYDKEVEFLLKFENFVKKQADGFLVQILFEGGRRALLNAYKAIKDKVPLVVIKGSGRVANMISEVMGL 331          
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Planmine SMEST
Match: SMESG000004911.1 (SMESG000004911.1)

HSP 1 Score: 454.907 bits (1169), Expect = 1.119e-162
Identity = 324/786 (41.22%), Postives = 471/786 (59.92%), Query Frame = 3
Query:  996 MNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSIDDNDL-EKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNNQIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATTDKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEENFEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALIASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQESTYTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFLPMWXXXXXXXXX-----XXXXXXLIMPSVNQPTQSER----------------SNESAESQTPEFMYEANSPFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLNLVELKLNLKI---QNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYLSGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQYYFISPTLGPKVIMIGRMIVDXXXXXXXXXXXXXXYGTLAIALQDNRSRAMNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*VLRYM*KAFPSKSDENITDIDRTIGRMTIICGFAVFXXXXXXXXXXXXXAMFGHTFNKIQVESHKFFSFIQLQXXXXXXXXXXXXXXXXXXHYLITGIIYCGNRCCHKQTRNQNSLLLQDLPKEE 3278
            MN DE  + K+QEI  EI+ + +N + +  +  K + L + + + +IS   D+D+  K+  ++I+FNC ++ E ++F + ++  L  + L +N   +L  NQI+F++LF   N  I + +T E+L  LY  SL  K    G LL D I + +K F  + K S  LL    +I+  +S NIL++         Q+                  H+  +T QDLFLWALLT  TE+++IFW+  ++++G A++ +II NKM+ LI  +G +  S  L  +SKKF+E+AIAV+ EA+ + Q +T  +L R L+T NNM+CLQIA++GNLL FL+ SAC SY ++ W G+LSPF PMWKIL++I FS       +I  LI  S N    +++                S  S  ++   F   +N   K  Y +   K S      ++ FY+ P+VKF+I+LISYV+FLL FIYLNLVELK   ++   QN   E F++ Y+LG I +E++QI +  +  + Y+ KA +SG+WN+YD   ILV II   +R  + Q+ FI+ RC + +T  + CLR MQ+YFISP++GPKVIMI +MIVDIFFFL IF LFI+SYGTL  +LQ N +     SL+  IFYRP+FQT+GELMLDEF  +     + +++Y                       T+I GFA+FLLLTN+LL+NLLIAMFG TFN+IQ ES K FS IQ+QLVEEF +KP++PPPFNL++Y +  I    NR   K    ++S+ ++ L   E
Sbjct:  294 MNDDE--LVKYQEIAFEIFSQCKNLVTIKQIVRKDLILYKSVFDVIISRNKDHDMIAKLFDLSIRFNCPNVVETRIFQSPNFSQLKPEHLKKNLLGILSRNQIKFLELFFMFNIEITELITMENLETLYMISLESKDCPYGDLLNDLIISKNKTFGFQNKTSGNLLDETYKIVQFLSENILKSSLTDKSIKNQV-----------------SHNLAVTYQDLFLWALLTGHTEMSLIFWRKCKDNVGLAMVGAIIKNKMKNLILYKGQTVISNQLVESSKKFEELAIAVIQEANERSQRNTRCILTRPLETLNNMSCLQIAVTGNLLHFLNHSACRSYTKEHWMGDLSPFFPMWKILLTILFSPFLLPVFVIFSLIYKSENNSNSTDKFINGNSFSTNKEVFKISFASKNNENKRFSNISNGLIKTKYYEVITKKS------LEAFYKAPVVKFIIYLISYVVFLLAFIYLNLVELKPIEQVKRYQNMTMEFFVYIYILGFIVKEVKQINNNGKLETFYRFKAGISGTWNVYDFSTILVSIICVVVRFSVPQEFFILARCLFGLTFCLYCLRTMQFYFISPSIGPKVIMIKKMIVDIFFFLCIFLLFIVSYGTLFNSLQ-NPNCEFGFSLVANIFYRPFFQTFGELMLDEFQDSVCKTTSCIIQY----------------------RTVIFGFAIFLLLTNVLLLNLLIAMFGSTFNEIQNESEKIFSSIQIQLVEEFHQKPMVPPPFNLIYYFLKKIWNTRNRIFKKSNTRKSSIFIKYLADCE 1031          

HSP 2 Score: 140.198 bits (352), Expect = 1.119e-162
Identity = 88/253 (34.78%), Postives = 141/253 (55.73%), Query Frame = 2
Query:  221 CDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYWNFFKPQLIISVTGGLKRMXXXXXXXXXXXXXSLIEVLKKDKTWIIGGGFNVGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYHFTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNGNVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTRKDKINIK 979
            CD FG I F G +++ ++ +P+F+RF         +  Y+L+   W +  P L+ISV GGLK   F  +Q ++NFK++L E++K   TWIIG G +VG+  ++ E +  YR Q +   NQ  L+G+ + G + N + L + N TY    +   G   L+   D +LFCDDG+      +  F + FEK ++      V++I+  G    LE+ + SL  ++PL+LIKNSG  +D  + I +     ++KINIK
Sbjct:   37 CDMFGTITFEGNDNLSSDQHPNFMRFYSPKTNTPHKEAYELINKLWQYPSPNLVISVLGGLKNQLFKNSQLERNFKRNLCEIMKTSTTWIIGSGLDVGVSKIVGETIGAYR-QGSRGQNQACLIGVSSCGVVKNIEKLISNNCTYPRASEFSNGTFNLNEFYDCYLFCDDGSTNLCQNDKEFLVDFEKYLQNILGVPVIRIMLGGERCELETIHMSLMENLPLILIKNSGGLSDFFSEIFE-----QEKINIK 283          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM22.149e-6725.26transient receptor potential cation channel subfam... [more]
TRPM22.149e-6725.26transient receptor potential cation channel subfam... [more]
TRPM22.184e-6725.26transient receptor potential cation channel subfam... [more]
TRPM26.214e-6725.35transient receptor potential cation channel subfam... [more]
TRPM68.214e-6124.17transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtl-12.004e-3925.78GTL-1; Gon-Two Like (TRP subfamily) [Source:UniPr... [more]
gtl-21.450e-2722.93Gon-Two Like (TRP subfamily) [Source:UniProtKB/Tr... [more]
gon-21.996e-1731.22Transient receptor potential channel [Source:UniP... [more]
gon-22.306e-1731.22Transient receptor potential channel [Source:UniP... [more]
gon-22.394e-1731.22Transient receptor potential channel [Source:UniP... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm3.856e-5523.68gene:FBgn0265194 transcript:FBtr0339082[more]
Trpm1.444e-4027.27gene:FBgn0265194 transcript:FBtr0339075[more]
Trpm1.836e-3827.27gene:FBgn0265194 transcript:FBtr0339074[more]
Trpm1.897e-3827.27gene:FBgn0265194 transcript:FBtr0339077[more]
Trpm1.977e-3827.27gene:FBgn0265194 transcript:FBtr0339078[more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm63.670e-5523.59transient receptor potential cation channel, subfa... [more]
trpm55.048e-5323.58transient receptor potential cation channel, subfa... [more]
trpm55.134e-5323.58transient receptor potential cation channel, subfa... [more]
trpm51.342e-5223.22transient receptor potential cation channel, subfa... [more]
trpm25.439e-4326.74transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shc21.121e-7525.61SHC (Src homology 2 domain containing) transformin... [more]
shc27.755e-7525.08SHC (Src homology 2 domain containing) transformin... [more]
shc21.604e-7325.23SHC (Src homology 2 domain containing) transformin... [more]
shc25.086e-7325.42SHC (Src homology 2 domain containing) transformin... [more]
shc21.721e-6825.94SHC (Src homology 2 domain containing) transformin... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm21.579e-7024.27transient receptor potential cation channel, subfa... [more]
Trpm49.509e-4324.44transient receptor potential cation channel, subfa... [more]
Trpm41.657e-4224.12transient receptor potential cation channel, subfa... [more]
Trpm51.923e-4023.85transient receptor potential cation channel, subfa... [more]
Trpm52.776e-4023.85transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7T1N0|TMP2L_NEMVE3.933e-7025.06Transient receptor potential cation channel subfam... [more]
sp|Q91YD4|TRPM2_MOUSE9.638e-7024.27Transient receptor potential cation channel subfam... [more]
sp|E9PTA2|TRPM2_RAT3.105e-6924.70Transient receptor potential cation channel subfam... [more]
sp|O94759|TRPM2_HUMAN9.504e-6725.26Transient receptor potential cation channel subfam... [more]
sp|Q9BX84|TRPM6_HUMAN3.633e-6024.17Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F5R19.757e-9427.31Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A2T7Q0254.002e-7924.51LSDAT_euk domain-containing protein OS=Pomacea can... [more]
A0A1S3HH511.359e-7626.84transient receptor potential cation channel subfam... [more]
A0A1S3HED02.182e-7626.72transient receptor potential cation channel subfam... [more]
A0A2C9K6283.201e-7627.86Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm72.354e-6023.68transient receptor potential cation channel subfam... [more]
trpm4a1.446e-5325.53transient receptor potential cation channel subfam... [more]
trpm4a1.471e-5325.53transient receptor potential cation channel subfam... [more]
trpm31.563e-3625.35transient receptor potential cation channel, subfa... [more]
trpm64.015e-3522.77transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpm74.274e-4921.51transient receptor potential cation channel, subfa... [more]
trpm24.261e-3625.16transient receptor potential cation channel, subfa... [more]
trpm73.302e-3423.32transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO301351.747e-7125.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476581.669e-5824.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm77.717e-5422.82transient receptor potential cation channel subfam... [more]
trpm75.726e-5322.82transient receptor potential cation channel subfam... [more]
trpm76.118e-5322.82transient receptor potential cation channel subfam... [more]
trpm53.294e-4924.96transient receptor potential cation channel subfam... [more]
hrc3.100e-4425.00transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004977.10.000e+095.01SMESG000004977.1[more]
SMESG000004955.10.000e+045.58SMESG000004955.1[more]
SMESG000004955.10.000e+045.58SMESG000004955.1[more]
SMESG000005057.10.000e+040.92SMESG000005057.1[more]
SMESG000004911.11.119e-16241.22SMESG000004911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000186 ID=SMED30000186|Name=Transient receptor potential cation channel subfamily M member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=3387bp
GGCGTATTTGGTTTTTCAAAACAAGTCCTGATTAAAATTTAGATTATATT
TTTTGTAAATGGATTTATTTATTAAAAAGTACTTTCAAATTAGATATTGT
TATAAGTATAAAGGTGAAATTTTTGAAACTTGCAAATGTGGAAACATAAA
AACGGATCATCAGGATTTTCCAATTAAAGATGAAATTTGGTCTTTAGAAA
ATAACACAAAGTGTAGAACCTGTGACACTTTCGGAATAATTAATTTTACC
GGTTACAATGACATAATAACCAATCATTATCCACATTTTATTCGATTTAA
CTGCGAAGATGCGCCAGAAATTGTTGAAGTTGTATATAAACTCATGATTT
TATATTGGAATTTTTTTAAGCCACAGTTAATAATATCAGTTACTGGAGGC
TTAAAAAGAATGAATTTCAATACAAATCAACAGAAAAAAAATTTTAAACA
GAGTTTGATTGAAGTTTTGAAAAAGGACAAAACATGGATAATTGGTGGAG
GTTTCAATGTTGGTATTCATAATTTAATCAGTGAAGCAGTTTATGAATAT
CGAAGTCAACAAGCGAATTCTTCAAATCAAGTTAAACTTCTCGGAATTTG
TACTTGGGGGGCGATTTTAAACAACAAGATTCTCTGTAACGAAAATCCAA
CTTACCATTTTACGAAAAAAACGGAAAAAGGAAAAGTTTTATTAGATTCT
CATTGTGATGGATTTCTATTTTGTGACGATGGGACAGAAAAACAATATGA
TAAAGAAACAAATTTTAGACTGAAATTTGAAAAATGTGTGAGAGAAAATG
ATAATGGAAATGTAGTTCAAATTCTTTACGAAGGAGGCTCGCGCGCATTA
GAAAGTGCCTATAATTCTTTAAAAGCATCTATACCTTTAGTTCTCATTAA
AAATTCTGGACGAGCTGCAGACGTAATTAATGCAATTTTAGATTTAAAAA
TGACAAGAAAAGATAAAATCAATATTAAGTGCCAACCAATCAACAATGAA
TATTGATGAAAAAGACATTGAGAAATTTCAAGAAATTCTTCGTGAAATTT
ATGAAAAATACAGAAATCAAATATTTGTTCATGATCTTTTCGACAAGTCG
ATGAAATTGGATAGAAAAATTGTCGAAGCTGTTATATCGAGCATCGATGA
CAATGACCTAGAGAAAATTCTGAAAATTACAATAAAGTTCAATTGTTTTG
ACATAGCAGAAAAAAAAGTTTTCCTCAATGCAGATTATCAATCTTTGAAT
CAGAAAATATTGCATGAAAATTTCAAATTAGTGCTGAAAAATAACCAAAT
CGAATTTGTCAAGCTTTTCTTAGAAAATAACTTTAGTATTGAGGATTTTC
TAACCGAAGAGGATCTAAATGGTTTGTATAATCATTCGTTATACGTAAAG
CCTTCTCGGTGTGGTTATTTATTAGTAGATTTTATAGCAACTACGGATAA
AAATTTTGATTCTAAACGAAAAAAATCAAAATATTTGTTGTATCCTGTTC
GAAGAATAATTAATATGATGAGTGGTAATATTTTACAAAATGAAAATATT
CATCCGAAACCAGGACGCCAACTGATCAGAACAGACGAAGAAAATTTCGA
ATTTCAATCACAAAGCTTTATTGAAGTTCATTCCAAAAAGATTACCCCCC
AAGATTTATTTCTTTGGGCTCTTCTTACTGAATTTACAGAACTAGCAATA
ATCTTTTGGAAAATCGGAGAAGAGCACATAGGTTCTGCCTTGATTGCCTC
AATTATATTAAATAAAATGGAAGGCCTTATTAGAAAAAGAGGTTATAGTG
ATACTTCTGCAATGCTTTCCAGGGCTTCAAAAAAGTTTCAAGAAATGGCT
ATAGCAGTAGTGACCGAAGCTCACAATAAAAGACAAGAAAGTACCTACAC
GCTACTGATAAGGACGTTAAAGACTTGGAATAATATGACATGTCTGCAAA
TTGCTATTAGTGGCAATTTATTAGAATTTTTAAGTCAAAGTGCTTGCGAT
TCTTATATAAGAAAAATTTGGAGGGGAGAATTATCGCCTTTTCTGCCAAT
GTGGAAAATTTTGATTAGTATTCCTTTCAGCTTTATTTTAATCAAACCTC
TTATAATGCCTTCAGTTAATCAACCAACACAAAGTGAAAGATCAAATGAA
TCAGCAGAATCACAAACACCTGAATTTATGTATGAAGCAAATTCTCCTTT
TAAAAGACATTATTCACAATCGAAAAAGAAAGCCTCCATTCCTTATAAAG
ACATGATCAAAATGTTTTATCAAGTTCCTATAGTTAAATTTGTAATTCAC
TTGATTTCCTACGTTTTGTTTTTATTGGTATTTATATATTTGAATTTGGT
GGAATTGAAATTAAATTTGAAAATTCAAAATAGATGGGCAGAAATATTTA
TTTTTTTTTACGTATTAGGAATAATTACTGAAGAAATCAGACAAATTATT
GATCAAGAAAGAACCGGTTCAATTTACAAATTAAAAGCTTATTTGTCAGG
ATCTTGGAATATTTATGATATTTGTGGCATTTTAGTTTATATCATCACTT
TTTTTCTGAGATGTTTTCTTAGTCAAGATTTATTTATTGTCACTCGTTGT
TTTTATTCAGTTACATTGAGTATGAATTGCCTTCGAATTATGCAATATTA
TTTTATCAGCCCGACCCTTGGACCTAAAGTAATAATGATAGGACGAATGA
TCGTTGATATTTTTTTCTTTTTAAGTATATTTTCGCTATTCATTATATCT
TATGGTACCTTAGCCATTGCCTTGCAAGATAATAGGAGTAGAGCAATGAA
TTTATCGCTGATTACTGAAATTTTCTACCGTCCATATTTTCAGACTTATG
GAGAATTGATGTTGGATGAATTTCATACTAATGAAAGCACAAATCAAGCA
TAAGTTTTACGATATATGTAGAAAGCTTTCCCATCAAAATCAGATGAAAA
TATAACAGATATTGACCGAACAATTGGGCGCATGACAATTATTTGTGGTT
TTGCAGTCTTTCTATTACTTACAAATATCCTACTAATTAATTTATTAATT
GCAATGTTTGGACATACTTTCAACAAAATTCAAGTGGAATCCCATAAGTT
TTTCTCTTTCATCCAATTACAACTTGTTGAAGAATTTCTTGAAAAACCAT
TGCTGCCACCCCCTTTTAACTTGCTACATTATTTGATAACAGGCATTATT
TATTGCGGAAACAGGTGCTGCCACAAGCAAACACGAAATCAAAATAGTCT
TTTACTGCAGGACTTGCCAAAGGAGGAAAACAAGAAATTTTCATATTTTG
AAAAACTCAGCATGGAAAGCTCAATTTTAGAATTGGAATCATTTAATAAT
AATAATAATGATAATAAAAATAATAATCATGTTTTAG
back to top

protein sequence of SMED30000186-orf-1

>SMED30000186-orf-1 ID=SMED30000186-orf-1|Name=SMED30000186-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=316bp
MDLFIKKYFQIRYCYKYKGEIFETCKCGNIKTDHQDFPIKDEIWSLENNT
KCRTCDTFGIINFTGYNDIITNHYPHFIRFNCEDAPEIVEVVYKLMILYW
NFFKPQLIISVTGGLKRMNFNTNQQKKNFKQSLIEVLKKDKTWIIGGGFN
VGIHNLISEAVYEYRSQQANSSNQVKLLGICTWGAILNNKILCNENPTYH
FTKKTEKGKVLLDSHCDGFLFCDDGTEKQYDKETNFRLKFEKCVRENDNG
NVVQILYEGGSRALESAYNSLKASIPLVLIKNSGRAADVINAILDLKMTR
KDKINIKCQPINNEY*
back to top

protein sequence of SMED30000186-orf-2

>SMED30000186-orf-2 ID=SMED30000186-orf-2|Name=SMED30000186-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=636bp
MNIDEKDIEKFQEILREIYEKYRNQIFVHDLFDKSMKLDRKIVEAVISSI
DDNDLEKILKITIKFNCFDIAEKKVFLNADYQSLNQKILHENFKLVLKNN
QIEFVKLFLENNFSIEDFLTEEDLNGLYNHSLYVKPSRCGYLLVDFIATT
DKNFDSKRKKSKYLLYPVRRIINMMSGNILQNENIHPKPGRQLIRTDEEN
FEFQSQSFIEVHSKKITPQDLFLWALLTEFTELAIIFWKIGEEHIGSALI
ASIILNKMEGLIRKRGYSDTSAMLSRASKKFQEMAIAVVTEAHNKRQEST
YTLLIRTLKTWNNMTCLQIAISGNLLEFLSQSACDSYIRKIWRGELSPFL
PMWKILISIPFSFILIKPLIMPSVNQPTQSERSNESAESQTPEFMYEANS
PFKRHYSQSKKKASIPYKDMIKMFYQVPIVKFVIHLISYVLFLLVFIYLN
LVELKLNLKIQNRWAEIFIFFYVLGIITEEIRQIIDQERTGSIYKLKAYL
SGSWNIYDICGILVYIITFFLRCFLSQDLFIVTRCFYSVTLSMNCLRIMQ
YYFISPTLGPKVIMIGRMIVDIFFFLSIFSLFIISYGTLAIALQDNRSRA
MNLSLITEIFYRPYFQTYGELMLDEFHTNESTNQA*
back to top

protein sequence of SMED30000186-orf-3

>SMED30000186-orf-3 ID=SMED30000186-orf-3|Name=SMED30000186-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=135bp
MTIICGFAVFLLLTNILLINLLIAMFGHTFNKIQVESHKFFSFIQLQLVE
EFLEKPLLPPPFNLLHYLITGIIYCGNRCCHKQTRNQNSLLLQDLPKEEN
KKFSYFEKLSMESSILELESFNNNNNDNKNNNHVL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005821Ion_trans_dom
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0034220ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane