Nucleoside diphosphate kinase

Overview
NameNucleoside diphosphate kinase
Smed IDSMED30000184
Length (bp)779
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleoside diphosphate kinase (SMED30000184) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleoside diphosphate kinase (SMED30000184) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleoside diphosphate kinase (SMED30000184) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleoside diphosphate kinase (SMED30000184) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000184

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000184SMESG000039529.1 SmedASXL_005466SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000184SMESG000039529.1 dd_Smed_v4_3890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000184SMESG000039529.1 dd_Smed_v4_3890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000184SMESG000039529.1 dd_Smed_v4_3890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000184SMESG000039529.1 dd_Smed_v6_3890_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30000184SMESG000039529.1 OX_Smed_1.0.04249ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000184SMESG000039529.1 dd_Smed_v4_3890_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME5 (NME/NM23 family member 5 [Source:HGNC Symbol;Acc:HGNC:7853])

HSP 1 Score: 262.307 bits (669), Expect = 2.318e-88
Identity = 118/198 (59.60%), Postives = 156/198 (78.79%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKHQ 691
            PQI+VE+TLAIIKPD + + +EI   IL  GF I+Q++++ L+PE+ S+FY E +GK+FFP+L AYMSSGP+  ++L+   AIS W +++GP N++ AK T P+SLRAIYGTDD RN  HGS+ F++AEREIRF FPE ++EPIP+G AAKDYL  ++ P LL+GLTE+CK KP +PLIWLADWLL NNPNKP + H 
Sbjct:    8 PQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIRFMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHH 205          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:HGNC Symbol;Acc:HGNC:20567])

HSP 1 Score: 120.939 bits (302), Expect = 1.953e-33
Identity = 57/143 (39.86%), Postives = 91/143 (63.64%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            + PQ  ++ TLA+IKPDA+      + + ++IL + F I++ + +    E+   FY EH G+ F+  L+ +M+SGP+   +L+H++AI LWR ++GPT   +A+  +P+S+R  +G  D RN  HGSDS  SA REI  FFP+
Sbjct:    6 RSPQA-LQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPD 147          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:HGNC Symbol;Acc:HGNC:20567])

HSP 1 Score: 120.939 bits (302), Expect = 3.139e-33
Identity = 57/143 (39.86%), Postives = 91/143 (63.64%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            + PQ  ++ TLA+IKPDA+      + + ++IL + F I++ + +    E+   FY EH G+ F+  L+ +M+SGP+   +L+H++AI LWR ++GPT   +A+  +P+S+R  +G  D RN  HGSDS  SA REI  FFP+
Sbjct:   14 RSPQA-LQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPD 155          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:HGNC Symbol;Acc:HGNC:20567])

HSP 1 Score: 120.553 bits (301), Expect = 3.444e-33
Identity = 57/143 (39.86%), Postives = 91/143 (63.64%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            + PQ  ++ TLA+IKPDA+      + + ++IL + F I++ + +    E+   FY EH G+ F+  L+ +M+SGP+   +L+H++AI LWR ++GPT   +A+  +P+S+R  +G  D RN  HGSDS  SA REI  FFP+
Sbjct:    6 RSPQA-LQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPD 147          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Match: NME6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:HGNC Symbol;Acc:HGNC:20567])

HSP 1 Score: 120.553 bits (301), Expect = 3.444e-33
Identity = 57/143 (39.86%), Postives = 91/143 (63.64%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            + PQ  ++ TLA+IKPDA+      + + ++IL + F I++ + +    E+   FY EH G+ F+  L+ +M+SGP+   +L+H++AI LWR ++GPT   +A+  +P+S+R  +G  D RN  HGSDS  SA REI  FFP+
Sbjct:    6 RSPQA-LQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPD 147          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 84.3445 bits (207), Expect = 3.780e-20
Identity = 48/139 (34.53%), Postives = 74/139 (53.24%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVI 520
             ERT   IKPD +HR    +I+ R  + G+ ++  K++  +       Y +   K FFPSLI YMSSGPV  +V    + +   R ++G TN +    ++P ++R  +     RN  HGSD+  SA REI  +F ++ I
Sbjct:    4 TERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLA---SAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEI 139          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 84.3445 bits (207), Expect = 3.780e-20
Identity = 48/139 (34.53%), Postives = 74/139 (53.24%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVI 520
             ERT   IKPD +HR    +I+ R  + G+ ++  K++  +       Y +   K FFPSLI YMSSGPV  +V    + +   R ++G TN +    ++P ++R  +     RN  HGSD+  SA REI  +F ++ I
Sbjct:    4 TERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLA---SAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEI 139          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 84.3445 bits (207), Expect = 3.780e-20
Identity = 48/139 (34.53%), Postives = 74/139 (53.24%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVI 520
             ERT   IKPD +HR    +I+ R  + G+ ++  K++  +       Y +   K FFPSLI YMSSGPV  +V    + +   R ++G TN +    ++P ++R  +     RN  HGSD+  SA REI  +F ++ I
Sbjct:    4 TERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLA---SAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEI 139          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Match: ndk-1 (Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:Q93576])

HSP 1 Score: 84.3445 bits (207), Expect = 3.780e-20
Identity = 48/139 (34.53%), Postives = 74/139 (53.24%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVI 520
             ERT   IKPD +HR    +I+ R  + G+ ++  K++  +       Y +   K FFPSLI YMSSGPV  +V    + +   R ++G TN +    ++P ++R  +     RN  HGSD+  SA REI  +F ++ I
Sbjct:    4 TERTFIAIKPDGVHRGLVGKIIARFEERGYKLVALKQMTASKAHLEVHYQDLKDKPFFPSLIEYMSSGPVVAMVWQGLDVVKQGRSMLGATNPLA---SAPGTIRGDFCIQTGRNICHGSDAVDSANREIAHWFKQEEI 139          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Match: R05G6.5 (pep chromosome:WBcel235:IV:7508514:7509475:1 gene:WBGene00019899.1 transcript:R05G6.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R05G6.5)

HSP 1 Score: 70.0922 bits (170), Expect = 1.977e-14
Identity = 50/190 (26.32%), Postives = 89/190 (46.84%), Query Frame = 2
Query:   95 KPQI----FVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWL 652
            KPQ+     V+R + II P+  +  + ++K I    F II++   H   EE  ++ +         +L   +  GP  +++    NA    +++    N +  +++S              +G + S +  +A  +I FFFP+ + E   +   AKDYL+  V P L +GL  +   +P NP+ WLAD+L
Sbjct:    8 KPQLENPNLVDRIIVIILPNYFYEYESVLKHITKENFGIIEKTVKHFKTEEVMEWKSADLESQDIWNLSDRLIDGPCMLLLCQRANAFIEMKEVAKYHNVIAKRMSSS-------------DGIYYSKTTIAAYHDIIFFFPKYIDERAMLK-HAKDYLSVEVWPKLSQGLARVAVERPDNPIKWLADYL 183          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: nmdyn-D6 (gene:FBgn0030573 transcript:FBtr0073933)

HSP 1 Score: 122.094 bits (305), Expect = 1.996e-34
Identity = 57/136 (41.91%), Postives = 82/136 (60.29%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHRTDEI--VKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            +E TLA+IKP  +  T  +  ++ ++   F I+ QK V +T E +  FY EH GK F+  L ++M+SGP + ++L  E  I  WR ++GPT   +A  + P  +RA+YG  D RN  HGSDS +SA REI   FPE
Sbjct:    1 MEITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSDSEASALREISILFPE 136          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0346611)

HSP 1 Score: 83.9593 bits (206), Expect = 7.757e-20
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYL 559
            ERT  ++KPD + R    +I++R    GF ++  K    + E     Y +   + FFP L+ YM+SGPV  +V    N +   R ++G TN      + P ++R  +     RN  HGSD+  SAE+EI  +F E   E +    AAKD++
Sbjct:    6 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPAD---SLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEK--ELVTWTPAAKDWI 151          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0346150)

HSP 1 Score: 83.9593 bits (206), Expect = 1.196e-19
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYL 559
            ERT  ++KPD + R    +I++R    GF ++  K    + E     Y +   + FFP L+ YM+SGPV  +V    N +   R ++G TN      + P ++R  +     RN  HGSD+  SAE+EI  +F E   E +    AAKD++
Sbjct:   21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPAD---SLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEK--ELVTWTPAAKDWI 166          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: awd (gene:FBgn0000150 transcript:FBtr0339146)

HSP 1 Score: 83.9593 bits (206), Expect = 1.196e-19
Identity = 50/151 (33.11%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYL 559
            ERT  ++KPD + R    +I++R    GF ++  K    + E     Y +   + FFP L+ YM+SGPV  +V    N +   R ++G TN      + P ++R  +     RN  HGSD+  SAE+EI  +F E   E +    AAKD++
Sbjct:   21 ERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPAD---SLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEK--ELVTWTPAAKDWI 166          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Match: CG15547 (gene:FBgn0039809 transcript:FBtr0085715)

HSP 1 Score: 69.707 bits (169), Expect = 1.849e-13
Identity = 53/196 (27.04%), Postives = 97/196 (49.49%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIW---LADWLLDNNPNKPDIKHQ 691
            E +L IIKPD +H+   ++ ++L  GF I   +R+  +PE A++FY ++  +  F   +  +S G     +++ ENA+    +I      M     S         +D +RN     +S+S A REI F FP  + EP  +     ++  R +   LL+ + ++ +N   +   W   ++D+L+ +NP  P+I +Q
Sbjct:    3 ENSLFIIKPDYLHKRRPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLSKGVSEAFIVTKENAVQELLNI------MICYFGS--------ASDLERNIHVTKNSYSVA-REINFIFPNYIHEPHQM-FDHNNFCNRPMLKPLLEEIYDIMQNTDCSQENWKVRVSDYLVRSNPKMPEISNQ 182          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme5 (NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE-040718-221])

HSP 1 Score: 266.929 bits (681), Expect = 3.470e-90
Identity = 121/196 (61.73%), Postives = 156/196 (79.59%), Query Frame = 2
Query:   95 KPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDI 682
            +P+IFVERTLA+IKPDAIH+TDEI   IL  GF I+Q++R+ L+PE+ SDFY EH+GKL FP L A+MSSGPV  + L+ + AI+ W+ I+GP +++KA+ T P+ LRA +GT D RN  HGS++FS+AEREIRF FP  VIEPIP+G AAKDYL+R +NP LL GLTE+CK KP +P  WLADWL++NNPNKP +
Sbjct:   17 EPRIFVERTLALIKPDAIHKTDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSGPVVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMFPHSVIEPIPMGEAAKDYLSRFINPTLLVGLTELCKIKPEDPYTWLADWLMNNNPNKPKV 212          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme7 (NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE-000210-35])

HSP 1 Score: 130.954 bits (328), Expect = 2.055e-35
Identity = 64/146 (43.84%), Postives = 93/146 (63.70%), Query Frame = 2
Query:   71 GDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFP 508
            GD Y  A K     ERTLA+IKPDA+ +  +I++ I D    + + K   LT ++A+DFY EH  K FF +L+ ++SSGPV  + L  + A+S WR ++GPT++  A+  +  SLR  +GTD  +N  HGSDS +SA RE+ +FFP
Sbjct:   77 GDQY-TANKLGSKKERTLAMIKPDAVSKVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSGPVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFGTDGTKNAGHGSDSLASAARELEYFFP 221          

HSP 2 Score: 64.3142 bits (155), Expect = 1.691e-11
Identity = 38/136 (27.94%), Postives = 71/136 (52.21%), Query Frame = 2
Query:  107 FVERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLF-FPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            + + T  IIKP AI    T +I+K I+++GF I   +  ++    A +F   + G +  +  ++  + SGP   + +   +A   +R+  GP +   A+   P++LRA+YG +  +NG H +D       E+++FF
Sbjct:  234 YSDCTCCIIKPHAISEALTGKILKSIIENGFEISALQMFNMDRANAEEFLEVYKGVVAEYTKMVDELCSGPCMALEIHATDAPRTFREFCGPADPEIARHLRPKTLRALYGKNKLQNGVHCTDLPEDGILEVQYFF 369          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 124.79 bits (312), Expect = 3.564e-35
Identity = 68/167 (40.72%), Postives = 102/167 (61.08%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTE 601
            ++ TLA+IKPDA+      + + ++IL+  F II++K +     ++  FY EH G+ FF  L+ +MSSGP+   +L+ E+AI+ WR ++GPT   +A+ +SPE+LR  YG  D RN  HGSDS  SA+REI FFFPE          +A++++ R   P    G TE
Sbjct:    7 LQLTLAVIKPDAMAHPLILEALHQKILE-NFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREISFFFPE---------FSAEEWMMRE-EPHFRLGHTE 162          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme8 (NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE-070410-39])

HSP 1 Score: 119.398 bits (298), Expect = 2.189e-30
Identity = 61/136 (44.85%), Postives = 82/136 (60.29%), Query Frame = 2
Query:  119 TLAIIKPDAIH--RTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSH----ENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFP 508
            T+AIIKPD +   + DEI+ +I D GF I+  +   LT  EA DFY     + +F  L+ +MSSGP HV+V+S     E+ I  WR+ IGP +  +A+   PESLRA YG++   NG HGS     A RE+ FFFP
Sbjct:  162 TVAIIKPDVVAHGKADEIIMKIQDAGFVILAHEERTLTEAEAQDFYQHKAAEPYFQELVQFMSSGPSHVLVISKTEGCEDVIPAWREFIGPADVEEARREQPESLRAQYGSESLLNGLHGSSDRERASRELAFFFP 297          

HSP 2 Score: 100.523 bits (249), Expect = 8.980e-24
Identity = 62/143 (43.36%), Postives = 87/143 (60.84%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHRT-DEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQR-NGFHGSDSFSSAEREIRFFF-PEDVIEPI 529
            VERTLA+++PDA     +EI+ RI   GF +  QK + LT E+   FY+ H  + +F SL+  M+SG V  + L  E A+  WR+I+GP + +KAK   P+SLRA +  ++   N  HGS S   AE+EI FFF PED +  I
Sbjct:  313 VERTLALVRPDAARENREEILSRIRQAGFRVAMQKELMLTEEQVRLFYSTHVEEEYFNSLMENMTSGLVLALALVKEGAVEHWRNILGPKDPIKAKNEQPDSLRAQFSVENSSINQLHGSSSSEEAEKEISFFFPPEDTLAVI 455          

HSP 3 Score: 53.9138 bits (128), Expect = 5.918e-8
Identity = 30/63 (47.62%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMS 301
            E TLA+IKPD  H+ +EI++ I   GF I Q K   L+ E A +FY EH  K FF  L+ YM 
Sbjct:  449 EDTLAVIKPDTQHK-EEILEEIQAQGFTISQLKDTILSREMAEEFYKEHREKPFFSQLVDYMC 510          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Match: nme2a (NME/NM23 nucleoside diphosphate kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-7656])

HSP 1 Score: 86.6557 bits (213), Expect = 9.089e-21
Identity = 50/138 (36.23%), Postives = 71/138 (51.45%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVI 520
            ERT   IKPD + R    EI+KR    GF ++  K +    +     Y++   + FFP L++YMS+GPV  +V    N I   R ++G TN + +K   P ++R  +     RN  HGSDS  SA  EI  +F  D I
Sbjct:    6 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFKLVAMKLIQADEDLLRQHYSDLKDRPFFPGLVSYMSAGPVVAMVWEGFNVIKTGRVMLGETNPIDSK---PGTIRGDFCVQVGRNIIHGSDSVESANTEINLWFKPDEI 140          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: nme5 (NME/NM23 family member 5 [Source:NCBI gene;Acc:780075])

HSP 1 Score: 279.641 bits (714), Expect = 4.227e-95
Identity = 124/201 (61.69%), Postives = 160/201 (79.60%), Query Frame = 2
Query:   83 ENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIK 685
            ++ K P+I+VERTLAIIKPD +H+ +EI   IL  GFHI+Q+++VHL+PE+ SDFY++ +GK+FFPSL AYMSSGP+  + L+  NAIS W+++IGPTN++KAK T PESLRA+YGTDD RN  HGS  F+SAEREIRF FPE +IEP+P+G AA  YL   VN  L+ GLTE+CK KP +P IWLADWLL +NPNKP ++
Sbjct:   11 QSMKAPKIYVERTLAIIKPDVLHKAEEIEDIILRCGFHIVQKRKVHLSPEQCSDFYSDQYGKMFFPSLTAYMSSGPIIAMTLARYNAISYWKELIGPTNSLKAKETHPESLRAVYGTDDLRNALHGSYCFTSAEREIRFMFPEALIEPVPIGQAANTYLNLFVNSTLIAGLTELCKQKPTDPYIWLADWLLKHNPNKPAVE 211          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:100170458])

HSP 1 Score: 132.109 bits (331), Expect = 8.311e-38
Identity = 60/134 (44.78%), Postives = 90/134 (67.16%), Query Frame = 2
Query:  119 TLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            TLA+IKPDA+     ++ + ++IL++ F II+ K +H    ++  FY EH G+ F+  L+ +MSSGP+   +L+HE+A+ LWR+++GPT   +A+I +P ++R   G  D RN  HGSDS  SA REI FFFPE
Sbjct:   13 TLALIKPDAVANPVISEAVHQKILENNFLIIRHKELHWRSTDSQRFYCEHKGRFFYQRLVEFMSSGPMQAYILAHEDAVQLWRNLMGPTKVFRARIVAPGTVRGDLGLTDTRNTTHGSDSVESACREITFFFPE 146          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 137.502 bits (345), Expect = 9.385e-38
Identity = 65/132 (49.24%), Postives = 90/132 (68.18%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFP 508
            E+TLA+IKPDA+ +   I++ ILD GF I + K V L   EA DFY EH  K FF  LI++M+SGP+  + +  + A+S WR ++GPTN+  A+   P+S+RA +GTD  +N  HGSDS +SA RE+ FFFP
Sbjct:   92 EKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFP 223          

HSP 2 Score: 61.6178 bits (148), Expect = 2.445e-10
Identity = 42/139 (30.22%), Postives = 65/139 (46.76%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLF-FPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRF 499
            K    F + T  IIKP AI    T +I+  ILD GF I   +   +    A +F   + G +  F  +I  + SGP   + +    A   +RD  GP +   A+   P++LRA +G +  +N  H +D    A  E+R+
Sbjct:  231 KNTAKFTDCTCCIIKPHAISEGLTGKILNAILDAGFEISAMQMFTIERANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEIRDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTDLPEDAPLEVRY 369          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 137.117 bits (344), Expect = 1.039e-37
Identity = 65/132 (49.24%), Postives = 90/132 (68.18%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFP 508
            E+TLA+IKPDA+ +   I++ ILD GF I + K V L   EA DFY EH  K FF  LI++M+SGP+  + +  + A+S WR ++GPTN+  A+   P+S+RA +GTD  +N  HGSDS +SA RE+ FFFP
Sbjct:   92 EKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFP 223          

HSP 2 Score: 51.2174 bits (121), Expect = 5.478e-7
Identity = 37/137 (27.01%), Postives = 61/137 (44.53%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLF-FPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRF 499
            K    F + T  IIKP AI   +     +L   +  + Q   + T   A +F   + G +  F  +I  + SGP   + +    A   +RD  GP +   A+   P++LRA +G +  +N  H +D    A  E+R+
Sbjct:  231 KNTAKFTDCTCCIIKPHAISEGE--YNTMLLFTYQRMTQNSENFTRANAEEFCEIYKGVVAEFSDMIVELCSGPCIALEIRDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTDLPEDAPLEVRY 365          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:394498])

HSP 1 Score: 136.732 bits (343), Expect = 1.601e-37
Identity = 65/132 (49.24%), Postives = 90/132 (68.18%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFP 508
            E+TLA+IKPDA+ +   I++ ILD GF I + K V L   EA DFY EH  K FF  LI++M+SGP+  + +  + A+S WR ++GPTN+  A+   P+S+RA +GTD  +N  HGSDS +SA RE+ FFFP
Sbjct:   92 EKTLALIKPDAVTKMGSIIEAILDSGFVISKAKMVLLLRTEAMDFYNEHHSKSFFSDLISFMTSGPIVAMEVVGDEAVSSWRKLLGPTNSSIARSELPQSIRARFGTDGTKNAAHGSDSIASAARELEFFFP 223          

HSP 2 Score: 48.9062 bits (115), Expect = 3.936e-6
Identity = 39/149 (26.17%), Postives = 65/149 (43.62%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTP-----EEASDFYTEHFGKLF------FPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            K    F + T  IIKP AI   +     +L   +  + Q   + T      E A+    E F +++      F  +I  + SGP   + +    A   +RD  GP +   A+   P++LRA +G +  +N  H +D    A  E+++FF
Sbjct:  231 KNTAKFTDCTCCIIKPHAISEGE--YNTMLLFTYQRMTQNSENFTAGYFTIERAN---AEEFCEIYKGVVAEFSDMIVELCSGPCIALEIRDAEAPKRFRDFCGPADPEIARHLRPKTLRARFGKNKIKNAVHCTDLPEDAPLEVQYFF 374          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Nme5 (NME/NM23 family member 5 [Source:MGI Symbol;Acc:MGI:1922783])

HSP 1 Score: 259.61 bits (662), Expect = 2.094e-87
Identity = 114/197 (57.87%), Postives = 155/197 (78.68%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKH 688
            PQI+VE+TLA+IKPD + + +EI   IL  GF IIQ++++HL+PE  S+FY E +GK+FFP+L AYMSSGP+  ++L+   AIS W++++GP+N++ AK T P+SLRAIYGTD+ RN  HGS+ F+++EREIRF FP  +IEPIP+G AAKDY+   V P LL+GLTE+CK KP +P +WLADWL+ NNPNKP + H
Sbjct:    8 PQIYVEKTLALIKPDVVDKEEEIQDIILGSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNLTAYMSSGPLVAMILARHKAISYWKELMGPSNSLVAKETHPDSLRAIYGTDELRNALHGSNDFAASEREIRFMFPAVIIEPIPIGQAAKDYINLYVAPTLLQGLTELCKEKPPDPYLWLADWLMKNNPNKPKLCH 204          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Nme5 (NME/NM23 family member 5 [Source:MGI Symbol;Acc:MGI:1922783])

HSP 1 Score: 128.642 bits (322), Expect = 2.739e-37
Identity = 55/105 (52.38%), Postives = 82/105 (78.10%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPES 412
            PQI+VE+TLA+IKPD + + +EI   IL  GF IIQ++++HL+PE  S+FY E +GK+FFP+L AYMSSGP+  ++L+   AIS W++++GP+N++ AK T P+S
Sbjct:    8 PQIYVEKTLALIKPDVVDKEEEIQDIILGSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNLTAYMSSGPLVAMILARHKAISYWKELMGPSNSLVAKETHPDS 112          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Nme7 (NME/NM23 family member 7 [Source:MGI Symbol;Acc:MGI:2449121])

HSP 1 Score: 124.405 bits (311), Expect = 8.044e-34
Identity = 59/146 (40.41%), Postives = 96/146 (65.75%), Query Frame = 2
Query:   71 GDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFP 508
            GD Y  A++     E+TLA+IKPDA+ +  EI++ I   GF I + + + LT +EA+DF+ +H  + F+  LI +++SGPV  + +  ++AI  W+ ++GP N+  ++  +P S+RA++GTD  RN  HG D+F+SA RE+  FFP
Sbjct:   98 GDQY-TARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFP 242          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:MGI Symbol;Acc:MGI:1861676])

HSP 1 Score: 120.939 bits (302), Expect = 9.028e-34
Identity = 57/143 (39.86%), Postives = 90/143 (62.94%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            + PQ  ++ TLA+IKPDA+      + + ++IL + F I++ + +    E+   FY EH G+ F+  L+ +M+SGP+   +L+H++AI LWR ++GPT   +A+  +P+S+R   G  D RN  HGSDS  SA REI  FFP+
Sbjct:    6 RSPQA-LQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRTRELQWKLEDCRRFYREHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSIRGSLGLTDTRNTTHGSDSVVSASREIAAFFPD 147          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Match: Nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:MGI Symbol;Acc:MGI:1861676])

HSP 1 Score: 120.168 bits (300), Expect = 3.977e-33
Identity = 57/143 (39.86%), Postives = 90/143 (62.94%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            + PQ  ++ TLA+IKPDA+      + + ++IL + F I++ + +    E+   FY EH G+ F+  L+ +M+SGP+   +L+H++AI LWR ++GPT   +A+  +P+S+R   G  D RN  HGSDS  SA REI  FFP+
Sbjct:    6 RSPQA-LQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRTRELQWKLEDCRRFYREHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSIRGSLGLTDTRNTTHGSDSVVSASREIAAFFPD 147          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|P56597|NDK5_HUMAN (Nucleoside diphosphate kinase homolog 5 OS=Homo sapiens OX=9606 GN=NME5 PE=1 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.113e-87
Identity = 118/198 (59.60%), Postives = 156/198 (78.79%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKHQ 691
            PQI+VE+TLAIIKPD + + +EI   IL  GF I+Q++++ L+PE+ S+FY E +GK+FFP+L AYMSSGP+  ++L+   AIS W +++GP N++ AK T P+SLRAIYGTDD RN  HGS+ F++AEREIRF FPE ++EPIP+G AAKDYL  ++ P LL+GLTE+CK KP +PLIWLADWLL NNPNKP + H 
Sbjct:    8 PQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIRFMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHH 205          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|Q99MH5|NDK5_MOUSE (Nucleoside diphosphate kinase homolog 5 OS=Mus musculus OX=10090 GN=Nme5 PE=1 SV=2)

HSP 1 Score: 259.61 bits (662), Expect = 1.465e-86
Identity = 114/197 (57.87%), Postives = 155/197 (78.68%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKH 688
            PQI+VE+TLA+IKPD + + +EI   IL  GF IIQ++++HL+PE  S+FY E +GK+FFP+L AYMSSGP+  ++L+   AIS W++++GP+N++ AK T P+SLRAIYGTD+ RN  HGS+ F+++EREIRF FP  +IEPIP+G AAKDY+   V P LL+GLTE+CK KP +P +WLADWL+ NNPNKP + H
Sbjct:    8 PQIYVEKTLALIKPDVVDKEEEIQDIILGSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNLTAYMSSGPLVAMILARHKAISYWKELMGPSNSLVAKETHPDSLRAIYGTDELRNALHGSNDFAASEREIRFMFPAVIIEPIPIGQAAKDYINLYVAPTLLQGLTELCKEKPPDPYLWLADWLMKNNPNKPKLCH 204          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|Q6NLG3|NDK5_ARATH (Probable nucleoside diphosphate kinase 5 OS=Arabidopsis thaliana OX=3702 GN=At1g17410 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.068e-41
Identity = 70/133 (52.63%), Postives = 96/133 (72.18%), Query Frame = 2
Query:  128 IIKPDAI--HRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVI 520
            +IKPD +  + T+EI   +++ GF+I+++    L  E AS FY EH  + FFP L+ YM+SGPV V+VL   NA+S WRD+IGPT+A KAKI+ P S+RA+ G + Q+N  HGSDS SSAEREI+FFF +DV+
Sbjct:    1 MIKPDGVSGNYTEEIKTIVVEAGFNIVKEMLTQLDKETASAFYEEHSSRSFFPHLVTYMTSGPVLVMVLEKRNAVSDWRDLIGPTDAEKAKISHPHSIRALCGKNSQKNCVHGSDSTSSAEREIKFFF-KDVV 132          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|B3DL53|NDK6_XENTR (Nucleoside diphosphate kinase 6 OS=Xenopus tropicalis OX=8364 GN=nme6 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.403e-37
Identity = 60/134 (44.78%), Postives = 90/134 (67.16%), Query Frame = 2
Query:  119 TLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            TLA+IKPDA+     ++ + ++IL++ F II+ K +H    ++  FY EH G+ F+  L+ +MSSGP+   +L+HE+A+ LWR+++GPT   +A+I +P ++R   G  D RN  HGSDS  SA REI FFFPE
Sbjct:   13 TLALIKPDAVANPVISEAVHQKILENNFLIIRHKELHWRSTDSQRFYCEHKGRFFYQRLVEFMSSGPMQAYILAHEDAVQLWRNLMGPTKVFRARIVAPGTVRGDLGLTDTRNTTHGSDSVESACREITFFFPE 146          
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Match: sp|Q7MNF4|NDK_VIBVY (Nucleoside diphosphate kinase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=ndk PE=3 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.402e-36
Identity = 71/141 (50.35%), Postives = 89/141 (63.12%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHRT--DEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEP 526
            +ERT +IIKPDA+ R    EI  RI   G  II  K VHL  E+AS FY EH GK FFP+L  +M+SGP+ V VL  ENAI+ +R+++G TN  +A      ++RA Y    + N  HGSDS +SA REI FFFPE  I P
Sbjct:    3 LERTFSIIKPDAVERNLIGEIYHRIEKAGLRIIAAKMVHLNDEQASGFYAEHEGKEFFPALKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACG---TIRADYALSMRHNSVHGSDSPASAAREIAFFFPESEICP 140          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: K1R1K7 (Nucleoside diphosphate kinase-like protein 5 OS=Crassostrea gigas OX=29159 GN=CGI_10021162 PE=3 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 5.346e-107
Identity = 140/197 (71.07%), Postives = 174/197 (88.32%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKH 688
            PQI+VERTLAI+KPDAIH+++EI   IL  GF I+Q++RVHLTPE+ASDFY EH+GK+FFPSL+AYMSSGPV  IV++ + AIS WR++IGPTNA+KA+ T P+ LRA+YGTDDQRN  HGSDSFSS+E+EIRFFFP+ VIEP+PVG AAKDYLA++VNP LLKGLTE+CK KP++P+IWLADWLL+NNPNKP ++ 
Sbjct:    4 PQIYVERTLAIVKPDAIHKSEEIEDIILRSGFAILQKRRVHLTPEQASDFYAEHYGKMFFPSLVAYMSSGPVLAIVIARDQAISYWRELIGPTNALKARQTHPDCLRAVYGTDDQRNALHGSDSFSSSEKEIRFFFPDSVIEPVPVGQAAKDYLAKSVNPCLLKGLTELCKQKPIDPVIWLADWLLENNPNKPKVRQ 200          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: A0A1S3HVK6 (nucleoside diphosphate kinase homolog 5 OS=Lingula unguis OX=7574 GN=LOC106158554 PE=3 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 4.805e-104
Identity = 139/196 (70.92%), Postives = 169/196 (86.22%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIK 685
            PQI+VE+TLAIIKPDAIH+ DEI   IL  GF I+Q++RVHLTPE+ASDFY EH+GKLFFPSL+AYMSSGP+ V+VLS +NAIS WR+++GPTN +KA+ T P+SLRAIYGTDDQRN  HGSDSFS+A REIRFFF + ++EP+ VG AAKDYLAR VNP LL+GLT++CK KP +P++WLADWLL NNPNKP +K
Sbjct:    6 PQIYVEKTLAIIKPDAIHKCDEIEDIILRSGFCILQKRRVHLTPEQASDFYAEHYGKLFFPSLVAYMSSGPIIVLVLSRDNAISYWRELVGPTNTLKARETHPDSLRAIYGTDDQRNALHGSDSFSNAAREIRFFFSDSIVEPVAVGQAAKDYLARTVNPTLLRGLTQLCKEKPSDPVVWLADWLLQNNPNKPKVK 201          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: V4AX29 (NDK domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_226200 PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 2.025e-99
Identity = 133/198 (67.17%), Postives = 166/198 (83.84%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKHQ 691
            P I+VE+TLA+IKPD IH ++EI   IL  GF II+++RVHLTPE+ASDFY EH+GKLFFPSL+AYMSSGP+  + LS + AIS WR++IGPTN  KA+ T P+SLRAIYGTDDQRN  HGSDSFSS++REIRFFFP+ ++EP+ VG AAKDYL++ VNP LLKGLT +CK KP +PL+WLADWL++NNPNKP + +Q
Sbjct:   14 PHIYVEQTLALIKPDCIHNSEEIEDIILRSGFAIIKKRRVHLTPEQASDFYAEHYGKLFFPSLVAYMSSGPIIAMALSRDRAISYWRELIGPTNTYKARNTHPDSLRAIYGTDDQRNALHGSDSFSSSQREIRFFFPDSIVEPVAVGQAAKDYLSKVVNPTLLKGLTSLCKQKPQDPLVWLADWLIENNPNKPRVINQ 211          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: A0A210QX70 (Nucleoside diphosphate kinase-like 5 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05367 PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 2.647e-99
Identity = 130/197 (65.99%), Postives = 167/197 (84.77%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKH 688
            P I+VERTLAIIKPDA+ + +EI   IL  GF I+Q++RVHLTPE+ASDFY EH+GKLFFPSL+AYMS GP+  +V+S +NAIS W+++IGP N +KA+ T P+ LR+IYGTDDQRN  HGS+SF+S+ERE RFFFP+ ++EP+P+G AAKDYLA++VNP LLKGLTE+CK KP++P+IWLADWLL+NNPNKP +  
Sbjct:   51 PHIYVERTLAIIKPDALQKAEEIEDIILRSGFAILQKRRVHLTPEQASDFYAEHYGKLFFPSLVAYMSHGPIIALVISRDNAISYWKELIGPNNTLKARQTHPDCLRSIYGTDDQRNALHGSESFTSSERETRFFFPDSIVEPVPIGQAAKDYLAKSVNPTLLKGLTELCKQKPIDPVIWLADWLLENNPNKPCVNQ 247          
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Match: A0A2C9JFT3 (NDK domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106057913 PE=3 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 2.937e-99
Identity = 132/206 (64.08%), Postives = 169/206 (82.04%), Query Frame = 2
Query:   71 GDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKH 688
             D     + P I+VERTLAIIKPDA+H+ DEI   IL  GF ++Q++RVHLTPE+ASDFY EH+GKLFFPSL+AYMSSGP+  ++++ + AIS WR++IGPTN +KA+ T PE LRAIYGTDDQRN  HGSDSFSSA+REIRFFFP+ ++EP+  G AAKDYL++ VNP LLKGLT++ K KP +P++WLADWLL+NNPNKP +++
Sbjct:    5 ADEQVTMEAPHIYVERTLAIIKPDALHKADEIEDIILRSGFAVLQKRRVHLTPEQASDFYAEHYGKLFFPSLVAYMSSGPIITLMIARDQAISYWRELIGPTNTLKARQTHPECLRAIYGTDDQRNALHGSDSFSSAQREIRFFFPDSIVEPVATGQAAKDYLSKVVNPTLLKGLTDLAKKKPEDPVLWLADWLLENNPNKPRVRN 210          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: nme5 (NME/NM23 family member 5 [Source:NCBI gene;Acc:103028979])

HSP 1 Score: 268.855 bits (686), Expect = 3.454e-91
Identity = 119/194 (61.34%), Postives = 153/194 (78.87%), Query Frame = 2
Query:  101 QIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDI 682
            ++F+ERTLA+IKPD++ + +EI   IL  GF I+Q+KR+ L+PE+ SDFY EH+GKLFFPSL A+MSSGPV  + L+   AIS W+D++GP N+ KAK T P+ LRA YGT D RN  HGS++FS+AERE+RF FP  VIEPIP+G AAKDYL+R +NP LL GLTE+CK KP +P  WLADWL++NNPNKP +
Sbjct:   11 RLFLERTLALIKPDSVDKAEEIENIILQSGFTILQKKRLQLSPEQCSDFYAEHYGKLFFPSLTAFMSSGPVIALALARHQAISTWKDLMGPANSSKAKDTHPDCLRARYGTSDLRNAVHGSETFSAAERELRFMFPNSVIEPIPLGEAAKDYLSRYINPTLLIGLTELCKRKPADPFAWLADWLMNNNPNKPTV 204          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 136.732 bits (343), Expect = 4.644e-38
Identity = 66/146 (45.21%), Postives = 97/146 (66.44%), Query Frame = 2
Query:   71 GDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFP 508
            GD Y  A K     ERTLA+IKPDA+ +  +I++ I D G  + + +   L+ ++A+DFY EH  K FF +L+ ++SSGPV V+ L  + A+S+WR ++GPT++  A+  +  SLRA +GTD  +N  HGSDS +SA RE+ FFFP
Sbjct:   43 GDQY-TANKLGSQKERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFP 187          

HSP 2 Score: 61.2326 bits (147), Expect = 1.627e-10
Identity = 40/136 (29.41%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  107 FVERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLF-FPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            F + T  IIKP A+    T +I+  I + GF I   +   L    A +F   + G +  + SL+A + SGP   + +   +A   +R   GP +   A+   P +LRA+YG +  +N  H +D       E+++FF
Sbjct:  200 FSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTEYTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTDLPEDGLLEVQYFF 335          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 136.346 bits (342), Expect = 5.550e-38
Identity = 66/146 (45.21%), Postives = 97/146 (66.44%), Query Frame = 2
Query:   71 GDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFP 508
            GD Y  A K     ERTLA+IKPDA+ +  +I++ I D G  + + +   L+ ++A+DFY EH  K FF +L+ ++SSGPV V+ L  + A+S+WR ++GPT++  A+  +  SLRA +GTD  +N  HGSDS +SA RE+ FFFP
Sbjct:   46 GDQY-TANKLGSQKERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFP 190          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: nme7 (NME/NM23 family member 7 [Source:NCBI gene;Acc:103037659])

HSP 1 Score: 136.346 bits (342), Expect = 1.361e-37
Identity = 66/146 (45.21%), Postives = 97/146 (66.44%), Query Frame = 2
Query:   71 GDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFP 508
            GD Y  A K     ERTLA+IKPDA+ +  +I++ I D G  + + +   L+ ++A+DFY EH  K FF +L+ ++SSGPV V+ L  + A+S+WR ++GPT++  A+  +  SLRA +GTD  +N  HGSDS +SA RE+ FFFP
Sbjct:   77 GDQY-TANKLGSQKERTLAMIKPDAVTKVGDIIQMIYDAGLIVTKARMTRLSGKQAADFYMEHQSKSFFNNLVQFVSSGPVIVMELMGDEAVSVWRKVLGPTDSSVARKDASASLRAQFGTDGTKNAGHGSDSMASAARELEFFFP 221          

HSP 2 Score: 60.8474 bits (146), Expect = 2.110e-10
Identity = 40/136 (29.41%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  107 FVERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLF-FPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            F + T  IIKP A+    T +I+  I + GF I   +   L    A +F   + G +  + SL+A + SGP   + +   +A   +R   GP +   A+   P +LRA+YG +  +N  H +D       E+++FF
Sbjct:  234 FSDCTCCIIKPHAVSEGLTGKILNSITEAGFEISALQMFSLDRANAEEFLEVYKGVVTEYTSLVAELCSGPCMALEILSTDAPREFRMFCGPADPEIARHLRPTTLRALYGKNKVQNAVHCTDLPEDGLLEVQYFF 369          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 127.487 bits (319), Expect = 4.347e-36
Identity = 61/137 (44.53%), Postives = 93/137 (67.88%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            ++ TLA+IKPDA+      + + +RIL++ F I+++K +     ++  FY EH G+ F+  L+ +MSSGP+   +L+ E+AI+ WR+++GPT   +A+ TSP ++RA YG  D RN  HGSDS  SA+REI FFFPE
Sbjct:   12 LQLTLAVIKPDAVAHPLILEALHQRILENDFLIVRKKDLIWRIGDSERFYAEHEGRFFYQRLVEFMSSGPMRAYILAREDAITRWRELMGPTKVYRARYTSPSTIRAQYGLTDTRNTTHGSDSEESAKREIAFFFPE 148          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Sea Lamprey
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:58120])

HSP 1 Score: 126.331 bits (316), Expect = 1.661e-36
Identity = 60/137 (43.80%), Postives = 90/137 (65.69%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            ++ TLA++KPDA+      + + + +L + F I++ K + L   ++  FY  H GK FF  L+ +M+SGP+ V VL+H +A+  WR+++GPT   +A  T+PES+RA YG  D RN  HGSDS +SA +EI FFFPE
Sbjct:   10 LQLTLALLKPDALAHGIAWEAVHQDVLKNKFLIVKSKELRLKRSDSERFYAAHKGKFFFQRLVEFMASGPIRVYVLAHHDAVRGWRELMGPTKVFRAVHTAPESIRACYGLTDTRNTTHGSDSSASALQEISFFFPE 146          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008106.1 (pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 gene:ENSPMAG00000007330.1 transcript:ENSPMAT00000008106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 3.225e-25
Identity = 45/117 (38.46%), Postives = 70/117 (59.83%), Query Frame = 2
Query:  155 TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
             D ++  I + GFHI  QK V LT E+A +FY EH G+ +F +L+ +M+ GP  ++VL+ E+A+  WR ++GP +   A+ T+PESLRA +      N  HG+ +   A+  I   F
Sbjct:    4 ADTVLGAIKEAGFHIAMQKEVILTEEQAREFYREHEGQDYFGTLVKHMTRGPSLMLVLNREDAVEEWRRLMGPADPDVARKTAPESLRARFARSLLENALHGASNLHHAQENIHLLF 120          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Sea Lamprey
Match: nme3 (NME/NM23 nucleoside diphosphate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-000210-34])

HSP 1 Score: 75.0998 bits (183), Expect = 4.519e-17
Identity = 46/139 (33.09%), Postives = 72/139 (51.80%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF-PEDVI 520
            ERTL  IKPD + R    +IVKR    G  ++  K +          Y +   K F+ SL+ +M+SGPV  +V      +   R ++G T+      ++P ++R  +  D  RN  HGSDS  SA++EI  +F PE+++
Sbjct:   21 ERTLLAIKPDGVQRRLMGDIVKRFEGKGLKLVAMKFLKPPVALLQQHYIDLKDKAFYSSLVQFMNSGPVLAMVWEGNGVVRTCRRMLGETDPAD---SAPGTIRGDFCIDIGRNVIHGSDSEESAQKEISLWFQPEELV 156          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Yeast
Match: YNK1 (Nucleoside diphosphate kinase; catalyzes the transfer of gamma phosphates from nucleoside triphosphates, usually ATP, to nucleoside diphosphates by a mechanism that involves formation of an autophosphorylated enzyme intermediate; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001550])

HSP 1 Score: 93.9745 bits (232), Expect = 1.952e-24
Identity = 48/137 (35.04%), Postives = 74/137 (54.01%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPED 514
             ERT   +KPD + R    +I+ R    G+ ++  K V    +     Y EH GK FFP ++++M SGP+   V   ++ +   R I+G TN +    ++P ++R  +G D  RN  HGSDS  SAEREI  +F ++
Sbjct:    5 TERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLG---SAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKE 138          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO39201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT1])

HSP 1 Score: 286.574 bits (732), Expect = 1.630e-98
Identity = 126/195 (64.62%), Postives = 158/195 (81.03%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDI 682
            P I +ERTLA+IKPDA+H++DEI + IL HGF I+Q++R HLTPE+ SDFY EH+GK+FFPSL+AYMSSGP+  +VL+ ENAIS WR +IGPTN  KA+  +PESLRAIYGTD  RN  HGSD   SA++EI FFFP+ ++EP+  G AAKDYL R VNP LLKGLTE+CK KP +P+++LADWL+ NNPNKP +
Sbjct:   13 PAIHIERTLALIKPDAVHKSDEIEEIILQHGFTILQKRRAHLTPEQTSDFYAEHYGKMFFPSLVAYMSSGPIMALVLARENAISYWRQLIGPTNTQKARDQAPESLRAIYGTDSTRNALHGSDGTVSADKEIHFFFPDSIVEPVSTGQAAKDYLTRTVNPTLLKGLTELCKMKPEDPILYLADWLIANNPNKPRV 207          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO30526 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0J8])

HSP 1 Score: 134.42 bits (337), Expect = 1.261e-39
Identity = 64/137 (46.72%), Postives = 95/137 (69.34%), Query Frame = 2
Query:  110 VERTLAIIKPD-AIH--RTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            ++ TLAI+KPD  +H  RT  +   ++D+ F I++ + +  + E+A  FYTEH G+ F+  L+ +MSSGP+  ++L  ENAI+ WR ++GPT+A KA+  +P+S+RA+YG  D RN  HGSDS  SA +EI FFFPE
Sbjct:    8 LQLTLAILKPDLMLHPVRTQAVKNILVDNQFMIVRSRVLKWSREDAECFYTEHKGRFFYNRLVGFMSSGPMTAMILGRENAITHWRKLMGPTHAYKARSIAPKSIRALYGISDTRNATHGSDSDESARKEIEFFFPE 144          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO50065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA5])

HSP 1 Score: 124.79 bits (312), Expect = 2.226e-34
Identity = 60/131 (45.80%), Postives = 85/131 (64.89%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            E+TLA+IKPDA+     I++ I   GF + + K V L  +EASDFY EH  + F+  L+ ++SSGPV    L    A+  WR ++GPT++  A+  +P S+RA +GTD+ +N  HGSDS  SAERE+ FFF
Sbjct:   89 EKTLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFF 219          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO34502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP47])

HSP 1 Score: 125.176 bits (313), Expect = 7.863e-34
Identity = 60/131 (45.80%), Postives = 85/131 (64.89%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            E+TLA+IKPDA+     I++ I   GF + + K V L  +EASDFY EH  + F+  L+ ++SSGPV    L    A+  WR ++GPT++  A+  +P S+RA +GTD+ +N  HGSDS  SAERE+ FFF
Sbjct:   89 EKTLAMIKPDAVGCLGGIMEMIDQAGFKLCRAKMVRLNRKEASDFYQEHASQPFYDRLVEFISSGPVVAFELKGPGAVDSWRKVLGPTDSATARNQAPLSVRAKFGTDNTKNAAHGSDSTESAEREVSFFF 219          

HSP 2 Score: 63.5438 bits (153), Expect = 9.474e-12
Identity = 38/133 (28.57%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  119 TLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKL--FFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            TL ++KP A+    +  IV  I D GF I   +  HL    A +F+  + G +  +  +++  + SGP   + +  ++    +RD +GP +   A+   P+SLRA +G D  +N  H +D       E+ +FF
Sbjct:  233 TLCVVKPHAVADGLSGRIVLAIQDAGFEISALQMFHLERANAEEFHEVYKGVVNEYERNMVEELCSGPCLAVEVRGQDVTKTFRDFVGPADPEIARHLRPKSLRAKFGKDKIKNAVHCTDLPEDGLLEVEYFF 365          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Match: EDO42234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S268])

HSP 1 Score: 127.487 bits (319), Expect = 1.444e-33
Identity = 63/141 (44.68%), Postives = 94/141 (66.67%), Query Frame = 2
Query:   92 KKPQIFVERTLAIIKPDAIH-RTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQR-NGFHGSDSFSSAEREIRFFFP 508
            K+ +  ++RTLA+I+PDA+  R + I+ +I + GF I   K +HLT E+A +FY+EH  + FF +L+  MSSGP+  + L+ E+AI  WR ++GP    KAK  +PESLRA +  +D   N  HGSD+  +AE+EI+ FFP
Sbjct:  278 KRKKRQLQRTLALIRPDALRSRRESIMSKIQEAGFEIAMSKEMHLTREQAEEFYSEHKDQEFFDTLVTNMSSGPMMALCLAREDAIEGWRGMLGPKEVEKAKDEAPESLRAQFQVEDSPINPLHGSDTAENAEKEIQKFFP 418          

HSP 2 Score: 122.479 bits (306), Expect = 8.219e-32
Identity = 78/188 (41.49%), Postives = 105/188 (55.85%), Query Frame = 2
Query:   74 DTYENAKKP-QIF--VERTLAIIKPDAIHRTDEIVK-RILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMN 625
            DT ENA+K  Q F  ++ T+A+IKP+      E++K RI + GF I  QK V L+ E AS FY EH GK FF  L  YMSSGP   +VLS E+A+S WR ++GP +  +AK  +PES+RA  G D  +N  HG      A + I+ FFPE  I P        D   + V P   +   E  ++KP +
Sbjct:  404 DTAENAEKEIQKFFPMQSTVAVIKPEVEPDQRELIKQRIKEAGFKIQLQKEVTLSKELASQFYHEHEGKDFFEGLTDYMSSGPTMFMVLSKEDAVSGWRSLMGPVDPEQAKEMAPESIRAALGKDVMKNVVHGPSDPEKAGKVIKEFFPEAKILP--------DGTVKKVQPDKAEEGQEGGESKPAD 583          

HSP 3 Score: 114.775 bits (286), Expect = 4.829e-29
Identity = 63/161 (39.13%), Postives = 91/161 (56.52%), Query Frame = 2
Query:  119 TLAIIKPDAIHR--TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSH--------ENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNV 571
            T+A+IKPDA+     +EI++++ + G  +++ +   LT EEA++FY +H G   F  L+ +MSSGP+  + LS         E  I  +R++IGP +   AK  +P SLRA+YGTD   N  HG DS  SA RE+ FFFP D   P       K  L R +
Sbjct:  129 TVAVIKPDAVKAGLVEEIIRKVEEAGIEVLKMEERTLTREEAAEFYKQHEGTEHFDQLVEFMSSGPLMTLALSKAGETPEALEGVIDNFRELIGPKDVNVAKEEAPNSLRAMYGTDTVMNAVHGCDSNESAARELAFFFP-DFAAPTVANKRKKRQLQRTL 288          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme5 (NME/NM23 family member 5 [Source:NCBI gene;Acc:101162299])

HSP 1 Score: 230.72 bits (587), Expect = 2.481e-76
Identity = 107/193 (55.44%), Postives = 139/193 (72.02%), Query Frame = 2
Query:  101 QIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPD 679
            QI VERTLAIIKPD   + ++I   IL  G  I+Q +R+ L+ E+ SDFY++  GK FFPSL+AYMSSGP+  +VL+ E+A++ W+ IIGP +   AK + PE LRA YGT D +N  HGS+SF  A REI+F FP   IEP P     K+YL+R + P+LL+GLTE+CK KP+NP+IWLADWLL NNPN+P 
Sbjct:    9 QIRVERTLAIIKPDIYEKAEKIEGFILQSGLTILQ-RRLQLSQEQCSDFYSDCSGKPFFPSLMAYMSSGPIVAMVLACEDAVTRWKSIIGPASITNAKESQPECLRAKYGTSDLKNALHGSESFQEAVREIKFMFPNSFIEPSPSKHETKEYLSRCLKPVLLRGLTELCKEKPLNPVIWLADWLLQNNPNQPQ 200          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme5 (NME/NM23 family member 5 [Source:NCBI gene;Acc:101162299])

HSP 1 Score: 199.904 bits (507), Expect = 2.359e-64
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 2
Query:  113 ERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPL 631
            ERTLAIIKPD   + ++I   IL  G  I+Q++R+ L+ E+ SDFY++  GK FFPSL+AYMSSGP+  +VL+ E+A++ W+ IIGP +   AK + PE LRA YGT D +N  HGS+SF  A REI+F FP   IEP P     K+YL+R + P+LL+GLTE+CK KP+NP+
Sbjct:    9 ERTLAIIKPDIYEKAEKIEGFILQSGLTILQKRRLQLSQEQCSDFYSDCSGKPFFPSLMAYMSSGPIVAMVLACEDAVTRWKSIIGPASITNAKESQPECLRAKYGTSDLKNALHGSESFQEAVREIKFMFPNSFIEPSPSKHETKEYLSRCLKPVLLRGLTELCKEKPLNPV 181          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 126.331 bits (316), Expect = 1.124e-35
Identity = 60/137 (43.80%), Postives = 90/137 (65.69%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            ++ TLA+IKPDA+      + + ++ILD+ F I++ K +    +++  FY EH G+ F+  L+ +MSSGP+   VL+ E+AI  WR ++GPT   +A+ T P S+RA +G  D RN  HGSDS  SA+REI FFFP+
Sbjct:   10 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPD 146          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 125.946 bits (315), Expect = 1.657e-35
Identity = 60/137 (43.80%), Postives = 90/137 (65.69%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            ++ TLA+IKPDA+      + + ++ILD+ F I++ K +    +++  FY EH G+ F+  L+ +MSSGP+   VL+ E+AI  WR ++GPT   +A+ T P S+RA +G  D RN  HGSDS  SA+REI FFFP+
Sbjct:   12 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPD 148          
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Match: nme6 (NME/NM23 nucleoside diphosphate kinase 6 [Source:NCBI gene;Acc:101167585])

HSP 1 Score: 125.946 bits (315), Expect = 1.657e-35
Identity = 60/137 (43.80%), Postives = 90/137 (65.69%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHR---TDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            ++ TLA+IKPDA+      + + ++ILD+ F I++ K +    +++  FY EH G+ F+  L+ +MSSGP+   VL+ E+AI  WR ++GPT   +A+ T P S+RA +G  D RN  HGSDS  SA+REI FFFP+
Sbjct:   12 LQLTLAVIKPDAVAHPLMMEALHQKILDNDFKIVRCKDLVWERQDSEKFYAEHSGRFFYQRLVEFMSSGPMRAYVLAREDAIRHWRGLMGPTKVFRARYTDPNSIRAQFGLTDTRNTTHGSDSPESAQREISFFFPD 148          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000039529.1 (SMESG000039529.1)

HSP 1 Score: 434.106 bits (1115), Expect = 1.281e-156
Identity = 209/209 (100.00%), Postives = 209/209 (100.00%), Query Frame = 2
Query:   65 MEGDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKHQ 691
            MEGDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKHQ
Sbjct:    1 MEGDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKPDIKHQ 209          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000015141.1 (SMESG000015141.1)

HSP 1 Score: 184.496 bits (467), Expect = 4.072e-58
Identity = 92/193 (47.67%), Postives = 122/193 (63.21%), Query Frame = 2
Query:   98 PQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPEDVIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNNPNKP 676
            P+I+ E TLAI+KPDAI + DEI + I   GF II +KRV LT E+A + Y+ H  K +F  L  +M+S  + V VL   +AIS WR ++GPT+ ++A   +P SLRAIYG     N  HGS +  S   E+   FP +++EPI     A DY    + P+LLKGLTE+CK KP  PL+WLADWL +NNP  P
Sbjct:    7 PRIYYEHTLAIVKPDAISKADEIHEIIEKQGFSIINKKRVQLTAEQACEIYSNHTDKSYFACLCRHMASNHIQVFVLGRHDAISGWRTLMGPTDPVEAYHCNPTSLRAIYGRSRIDNAVHGSSNLESFRNEMSIIFPTEIVEPILHDELAVDYYNVKLVPVLLKGLTELCKQKPKFPLLWLADWLDNNNPFSP 199          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000069915.1 (SMESG000069915.1)

HSP 1 Score: 117.857 bits (294), Expect = 5.615e-31
Identity = 59/135 (43.70%), Postives = 80/135 (59.26%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPED 514
             E+TL IIKP A+    +I+  I    F I+  K   L  E+A + Y  H GK F  +L+  M+SGP+    L  ENA++ W D+IGPT+ + AK  +P SLRA YG D   NG HGS+  ++A REI FFF E+
Sbjct:   55 TEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN 189          

HSP 2 Score: 63.1586 bits (152), Expect = 2.225e-11
Identity = 41/142 (28.87%), Postives = 71/142 (50.00%), Query Frame = 2
Query:  107 FVERTLAIIKPDAI--HRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLF-FPSLIAYMSSGPVHV------IVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            F + T A++KP  +   +   I+  I++ GF I   +  +L    A +F   + G L  + +++  + SGP         I L ++ A   +R+ +GP +   A+   P +LRA+YG D   NG H +D    AE E+++FF
Sbjct:  199 FSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMYNLDKANAEEFLEVYKGVLAEYAAILLELISGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 340          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000069915.1 (SMESG000069915.1)

HSP 1 Score: 117.472 bits (293), Expect = 1.278e-30
Identity = 59/135 (43.70%), Postives = 80/135 (59.26%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPED 514
             E+TL IIKP A+    +I+  I    F I+  K   L  E+A + Y  H GK F  +L+  M+SGP+    L  ENA++ W D+IGPT+ + AK  +P SLRA YG D   NG HGS+  ++A REI FFF E+
Sbjct:   92 TEKTLGIIKPQALSNMGQIISDIEKANFVIVNLKMFQLKREQAIELYAPHKGKPFMENLLNLMTSGPIMAFELMRENAVNGWLDMIGPTDPLLAKREAPHSLRAKYGLDSVSNGLHGSECVNAAIREINFFFREN 226          

HSP 2 Score: 63.1586 bits (152), Expect = 2.979e-11
Identity = 41/142 (28.87%), Postives = 71/142 (50.00%), Query Frame = 2
Query:  107 FVERTLAIIKPDAI--HRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLF-FPSLIAYMSSGPVHV------IVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            F + T A++KP  +   +   I+  I++ GF I   +  +L    A +F   + G L  + +++  + SGP         I L ++ A   +R+ +GP +   A+   P +LRA+YG D   NG H +D    AE E+++FF
Sbjct:  236 FSKSTCAVVKPHLVTNGQLGSIILSIVNAGFEITALRMYNLDKANAEEFLEVYKGVLAEYAAILLELISGPCVAMEISTGIRLKNQIAQKSFREFVGPMDPEMARHLRPNTLRAMYGKDKVCNGIHCTDLPEDAELEVQYFF 377          
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Match: SMESG000043677.1 (SMESG000043677.1)

HSP 1 Score: 120.168 bits (300), Expect = 1.510e-30
Identity = 57/132 (43.18%), Postives = 84/132 (63.64%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFF 505
            VE+T+A IKPD I   +EI  +ILD  F I++ KR+ +    A +FY++   + +F  LIA+M SGP + +VLS E+AI  WR +IGP +   A+ T P+S+RAIYG D  +N  +GSD+ S  +R +   F
Sbjct:  443 VEQTIAAIKPDGIENEEEIFNKILDAKFKIVKIKRITMEKSLAEEFYSDQSHQEYFNDLIAHMESGPTYFMVLSREDAIRGWRSLIGPKDPKTAEDTYPDSIRAIYGRDINKNAVYGSDNESEVQRVMNLIF 574          

HSP 2 Score: 114.775 bits (286), Expect = 1.213e-28
Identity = 59/135 (43.70%), Postives = 84/135 (62.22%), Query Frame = 2
Query:  110 VERTLAIIKPDAIHRTDE-IVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQR-NGFHGSDSFSSAEREIRFFFP 508
            V+RTLA+++P A     E I+++I + GF +  QK V LT EEA+ FY +H  K FF  LI  MS G +  + L  +NA+  WR ++GP +  KAK   P SLRA +  +D + N  HGSDS  +AE E+++FFP
Sbjct:  308 VQRTLALVRPAAYTEYRESILEKINNAGFKVAMQKEVQLTKEEAALFYNQHKDKPFFEELIKEMSKGTLLALALEKQNAVQGWRGMLGPKDVEKAKEIDPNSLRAQFSKEDIKVNLIHGSDSDETAETELKYFFP 442          

HSP 3 Score: 110.153 bits (274), Expect = 3.915e-27
Identity = 58/141 (41.13%), Postives = 90/141 (63.83%), Query Frame = 2
Query:  101 QIFVERTLAIIKPDAIH--RTDEIVKRILDHGFHIIQQKRVHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENA--ISLWRDIIGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPE 511
            +I  E TLA+IKPD +   + DEI+ ++ ++G  I+ Q+  +LT EEA +FY        F  LI +++SGP  ++VL+  +A  I  +R++IGP    +AK  SP+S+RAIYGT+   N  HG+D   +A+RE+ FFFP+
Sbjct:  152 EIEREVTLALIKPDIVKAGKVDEIIAKLQENGIEILAQQDRNLTIEEAKEFYHHMADSEIFEDLIKFIASGPSKILVLAKGDAGIIHEFRELIGPKFLDEAKENSPQSIRAIYGTNSIENAIHGADDRDTAQRELAFFFPD 292          
The following BLAST results are available for this feature:
BLAST of Nucleoside diphosphate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NME52.318e-8859.60NME/NM23 family member 5 [Source:HGNC Symbol;Acc:H... [more]
NME61.953e-3339.86NME/NM23 nucleoside diphosphate kinase 6 [Source:H... [more]
NME63.139e-3339.86NME/NM23 nucleoside diphosphate kinase 6 [Source:H... [more]
NME63.444e-3339.86NME/NM23 nucleoside diphosphate kinase 6 [Source:H... [more]
NME63.444e-3339.86NME/NM23 nucleoside diphosphate kinase 6 [Source:H... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndk-13.780e-2034.53Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-13.780e-2034.53Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-13.780e-2034.53Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
ndk-13.780e-2034.53Nucleoside diphosphate kinase [Source:UniProtKB/T... [more]
R05G6.51.977e-1426.32pep chromosome:WBcel235:IV:7508514:7509475:1 gene:... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmdyn-D61.996e-3441.91gene:FBgn0030573 transcript:FBtr0073933[more]
awd7.757e-2033.11gene:FBgn0000150 transcript:FBtr0346611[more]
awd1.196e-1933.11gene:FBgn0000150 transcript:FBtr0346150[more]
awd1.196e-1933.11gene:FBgn0000150 transcript:FBtr0339146[more]
CG155471.849e-1327.04gene:FBgn0039809 transcript:FBtr0085715[more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme53.470e-9061.73NME/NM23 family member 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme72.055e-3543.84NME/NM23 family member 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme63.564e-3540.72NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme82.189e-3044.85NME/NM23 family member 8 [Source:ZFIN;Acc:ZDB-GENE... [more]
nme2a9.089e-2136.23NME/NM23 nucleoside diphosphate kinase 2a [Source:... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme54.227e-9561.69NME/NM23 family member 5 [Source:NCBI gene;Acc:780... [more]
nme68.311e-3844.78NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme79.385e-3849.24NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
nme71.039e-3749.24NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
nme71.601e-3749.24NME/NM23 family member 7 [Source:NCBI gene;Acc:394... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nme52.094e-8757.87NME/NM23 family member 5 [Source:MGI Symbol;Acc:MG... [more]
Nme52.739e-3752.38NME/NM23 family member 5 [Source:MGI Symbol;Acc:MG... [more]
Nme78.044e-3440.41NME/NM23 family member 7 [Source:MGI Symbol;Acc:MG... [more]
Nme69.028e-3439.86NME/NM23 nucleoside diphosphate kinase 6 [Source:M... [more]
Nme63.977e-3339.86NME/NM23 nucleoside diphosphate kinase 6 [Source:M... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56597|NDK5_HUMAN1.113e-8759.60Nucleoside diphosphate kinase homolog 5 OS=Homo sa... [more]
sp|Q99MH5|NDK5_MOUSE1.465e-8657.87Nucleoside diphosphate kinase homolog 5 OS=Mus mus... [more]
sp|Q6NLG3|NDK5_ARATH2.068e-4152.63Probable nucleoside diphosphate kinase 5 OS=Arabid... [more]
sp|B3DL53|NDK6_XENTR4.403e-3744.78Nucleoside diphosphate kinase 6 OS=Xenopus tropica... [more]
sp|Q7MNF4|NDK_VIBVY2.402e-3650.35Nucleoside diphosphate kinase OS=Vibrio vulnificus... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1R1K75.346e-10771.07Nucleoside diphosphate kinase-like protein 5 OS=Cr... [more]
A0A1S3HVK64.805e-10470.92nucleoside diphosphate kinase homolog 5 OS=Lingula... [more]
V4AX292.025e-9967.17NDK domain-containing protein OS=Lottia gigantea O... [more]
A0A210QX702.647e-9965.99Nucleoside diphosphate kinase-like 5 OS=Mizuhopect... [more]
A0A2C9JFT32.937e-9964.08NDK domain-containing protein OS=Biomphalaria glab... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme53.454e-9161.34NME/NM23 family member 5 [Source:NCBI gene;Acc:103... [more]
nme74.644e-3845.21NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
nme75.550e-3845.21NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
nme71.361e-3745.21NME/NM23 family member 7 [Source:NCBI gene;Acc:103... [more]
nme64.347e-3644.53NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nme61.661e-3643.80NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
ENSPMAT00000008106.13.225e-2538.46pep scaffold:Pmarinus_7.0:GL476850:19893:22834:-1 ... [more]
nme34.519e-1733.09NME/NM23 nucleoside diphosphate kinase 3 [Source:Z... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YNK11.952e-2435.04Nucleoside diphosphate kinase; catalyzes the trans... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO392011.630e-9864.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305261.261e-3946.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500652.226e-3445.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345027.863e-3445.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422341.444e-3344.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nme52.481e-7655.44NME/NM23 family member 5 [Source:NCBI gene;Acc:101... [more]
nme52.359e-6452.60NME/NM23 family member 5 [Source:NCBI gene;Acc:101... [more]
nme61.124e-3543.80NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme61.657e-3543.80NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
nme61.657e-3543.80NME/NM23 nucleoside diphosphate kinase 6 [Source:N... [more]
back to top
BLAST of Nucleoside diphosphate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039529.11.281e-156100.00SMESG000039529.1[more]
SMESG000015141.14.072e-5847.67SMESG000015141.1[more]
SMESG000069915.15.615e-3143.70SMESG000069915.1[more]
SMESG000069915.11.278e-3043.70SMESG000069915.1[more]
SMESG000043677.11.510e-3043.18SMESG000043677.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000184 ID=SMED30000184|Name=Nucleoside diphosphate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=779bp
AGTCCTTGACCGACATTTGAAAATTGTTTAAATTGTTAATTTCATAACAA
CCACTTAAATAGTTATGGAAGGCGATACTTATGAGAATGCTAAAAAACCA
CAAATTTTTGTAGAAAGAACATTAGCTATTATTAAACCTGATGCTATTCA
TAGAACTGATGAAATAGTAAAGCGAATATTGGATCATGGTTTTCATATCA
TTCAACAAAAGCGTGTTCACTTAACGCCAGAAGAAGCGAGTGACTTTTAT
ACTGAGCATTTTGGAAAATTATTTTTCCCAAGTTTAATTGCTTATATGAG
TAGTGGACCAGTTCACGTTATTGTTTTGAGTCATGAAAATGCTATATCAT
TGTGGCGAGATATCATTGGACCAACTAATGCAATGAAAGCAAAAATTACA
TCTCCTGAAAGTTTAAGAGCTATTTATGGGACAGATGATCAGAGAAACGG
TTTCCATGGCAGTGATAGCTTTTCAAGCGCTGAAAGAGAGATAAGATTTT
TTTTCCCGGAAGATGTTATTGAACCGATTCCCGTTGGCTTAGCAGCCAAG
GATTATTTGGCACGAAATGTCAACCCAATTTTACTCAAAGGTTTAACGGA
AATGTGTAAAAATAAACCCATGAATCCATTGATTTGGCTAGCTGATTGGC
TATTGGACAATAATCCAAATAAACCAGATATTAAACATCAATAACTCATT
TTGTGGTGGAACTTTTCAATAAATTTTGACTATTGTGATAATGATTTCAT
AAATATTAATTCTTGTATTTGCAAAAAAA
back to top

protein sequence of SMED30000184-orf-1

>SMED30000184-orf-1 ID=SMED30000184-orf-1|Name=SMED30000184-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MEGDTYENAKKPQIFVERTLAIIKPDAIHRTDEIVKRILDHGFHIIQQKR
VHLTPEEASDFYTEHFGKLFFPSLIAYMSSGPVHVIVLSHENAISLWRDI
IGPTNAMKAKITSPESLRAIYGTDDQRNGFHGSDSFSSAEREIRFFFPED
VIEPIPVGLAAKDYLARNVNPILLKGLTEMCKNKPMNPLIWLADWLLDNN
PNKPDIKHQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:00044301-phosphatidylinositol 4-kinase activity
GO:0016740transferase activity
GO:0004550nucleoside diphosphate kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0046854phosphatidylinositol phosphorylation
GO:0006228UTP biosynthetic process
GO:0006241CTP biosynthetic process
GO:0006165nucleoside diphosphate phosphorylation
GO:0006183GTP biosynthetic process
GO:0016310phosphorylation
GO:0048515spermatid differentiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR034907NDK-like_dom
IPR036850NDK-like_dom_sf
IPR001564Nucleoside_diP_kinase
IPR007858Dpy-30_motif
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001564Nucleoside diphosphate kinasePRINTSPR01243NUCDPKINASEcoord: 128..147
score: 56.45
coord: 81..98
score: 34.41
coord: 61..80
score: 41.05
IPR034907Nucleoside diphosphate kinase-like domainSMARTSM00562ndk_5coord: 16..154
e-value: 1.6E-65
score: 233.7
IPR034907Nucleoside diphosphate kinase-like domainPFAMPF00334NDKcoord: 17..150
e-value: 6.4E-45
score: 152.5
NoneNo IPR availableGENE3DG3DSA:1.20.890.10coord: 158..205
e-value: 4.0E-12
score: 47.6
NoneNo IPR availablePANTHERPTHR46161FAMILY NOT NAMEDcoord: 14..208
IPR036850Nucleoside diphosphate kinase-like domain superfamilyGENE3DG3DSA:3.30.70.141coord: 7..157
e-value: 1.3E-52
score: 179.6
IPR036850Nucleoside diphosphate kinase-like domain superfamilySUPERFAMILYSSF54919Nucleoside diphosphate kinase, NDKcoord: 14..159
IPR007858Dpy-30 motifPFAMPF05186Dpy-30coord: 161..201
e-value: 5.1E-17
score: 61.3