MFS domain-containing protein

Overview
NameMFS domain-containing protein
Smed IDSMED30000179
Length (bp)1593
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS domain-containing protein (SMED30000179) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30000179) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS domain-containing protein (SMED30000179) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30000179) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000179

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000179SMESG000060699.1 Contig942newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000179SMESG000060699.1 Contig942uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000179SMESG000044157.1 Contig942newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000179SMESG000044157.1 Contig942uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
neuronSMED30000179SMESG000060699.1 dd_Smed_v4_5351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000179SMESG000060699.1 dd_Smed_v4_5351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000179SMESG000060699.1 dd_Smed_v4_5351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30000179SMESG000060699.1 dd_Smed_v4_5351_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000179SMESG000060699.1 dd_Smed_v4_5351_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 197.593 bits (501), Expect = 4.650e-57
Identity = 133/468 (28.42%), Postives = 243/468 (51.92%), Query Frame = 3
Query:   81 IMVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAF-SALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLT 1481
            I+ RL   AR  + + GG     + G  YT GN+ PY+ SY +++     + +G ++W+    S L +G++  +GG++E+K G R   L+G    ++G   T+Y+++ +  A ++T G I   GS + YS  +  A +WFP   G+  G +  GYG G+ I + +QT +INP +   N     + +FT E +L  VP+ F+++   + + Q IG+I +      +P  ++ +         E E  +     +             ++QA++ P+           ++     +L  +   N + + + S LYK++GQ FI +D + S++G++++IFN+  R+ WG + D  SY+  M+I+    +V+  S     +V ++    +++   VCL+F C+ G+F++FP IT +CF   N +++YG +    +V+G+I  LI +  LS I +  LFIV     + SL LT
Sbjct:    7 ILKRLPRGARPWAVLVGGVMCMVTFGIVYTCGNLLPYLVSYFRWKMYPD-MRTGQLIWLQTLLSGLPMGMV--IGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVND----QGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFI-----GQPEGDIHV---------ETENLIGTNSEI------------RVEQARVWPQ-----------LRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSND----VLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSEIGFEYLFIVCGCFMLTSLFLT 426          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693542:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 197.593 bits (501), Expect = 4.650e-57
Identity = 133/468 (28.42%), Postives = 243/468 (51.92%), Query Frame = 3
Query:   81 IMVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAF-SALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLT 1481
            I+ RL   AR  + + GG     + G  YT GN+ PY+ SY +++     + +G ++W+    S L +G++  +GG++E+K G R   L+G    ++G   T+Y+++ +  A ++T G I   GS + YS  +  A +WFP   G+  G +  GYG G+ I + +QT +INP +   N     + +FT E +L  VP+ F+++   + + Q IG+I +      +P  ++ +         E E  +     +             ++QA++ P+           ++     +L  +   N + + + S LYK++GQ FI +D + S++G++++IFN+  R+ WG + D  SY+  M+I+    +V+  S     +V ++    +++   VCL+F C+ G+F++FP IT +CF   N +++YG +    +V+G+I  LI +  LS I +  LFIV     + SL LT
Sbjct:    7 ILKRLPRGARPWAVLVGGVMCMVTFGIVYTCGNLLPYLVSYFRWKMYPD-MRTGQLIWLQTLLSGLPMGMV--IGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVND----QGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFI-----GQPEGDIHV---------ETENLIGTNSEI------------RVEQARVWPQ-----------LRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSND----VLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSEIGFEYLFIVCGCFMLTSLFLT 426          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 197.593 bits (501), Expect = 6.104e-57
Identity = 133/468 (28.42%), Postives = 243/468 (51.92%), Query Frame = 3
Query:   81 IMVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAF-SALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLT 1481
            I+ RL   AR  + + GG     + G  YT GN+ PY+ SY +++     + +G ++W+    S L +G++  +GG++E+K G R   L+G    ++G   T+Y+++ +  A ++T G I   GS + YS  +  A +WFP   G+  G +  GYG G+ I + +QT +INP +   N     + +FT E +L  VP+ F+++   + + Q IG+I +      +P  ++ +         E E  +     +             ++QA++ P+           ++     +L  +   N + + + S LYK++GQ FI +D + S++G++++IFN+  R+ WG + D  SY+  M+I+    +V+  S     +V ++    +++   VCL+F C+ G+F++FP IT +CF   N +++YG +    +V+G+I  LI +  LS I +  LFIV     + SL LT
Sbjct:   21 ILKRLPRGARPWAVLVGGVMCMVTFGIVYTCGNLLPYLVSYFRWKMYPD-MRTGQLIWLQTLLSGLPMGMV--IGGLVERKFGGRAGALLGSIIYTIGVGSTFYSIQHSYAATLLTMGGIASVGSSIAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVND----QGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFI-----GQPEGDIHV---------ETENLIGTNSEI------------RVEQARVWPQ-----------LRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLAFSMPLVKMVSND----VLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSEIGFEYLFIVCGCFMLTSLFLT 440          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: Y59A8B.21 (pep chromosome:WBcel235:V:17986260:17994546:1 gene:WBGene00013353.1 transcript:Y59A8B.21.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y59A8B.21)

HSP 1 Score: 179.874 bits (455), Expect = 2.041e-50
Identity = 130/442 (29.41%), Postives = 226/442 (51.13%), Query Frame = 3
Query:  129 GGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATL 1454
            G   +H ++GT++TFGN+ PYMASY++  T  + V   HM+W+  F   F    M +GG+       R++  IG + ++    L+ YA++ +     + YG++FG GSG+ Y  A+S A+ W P K G+++G VAAG+GL S IF  +QT  +NP N+   K    + YF    +L+ VP  F  +   Y I+Q + +I++ D  F+K SR     L    ++ + + +      + DN+               D  + +T S   E +K    + L ++ F       +  +LYK++G++FI +D + ++  ++A++ N++ R+ WG L D+ S++  ++  T   SV    F     +  E+G +  +  W+   F C+  + A+F   T +CFG  + A  YG + L    SG++ A I    L  I Y  LFI+ ++
Sbjct:   30 GAVSIHLTIGTYHTFGNMLPYMASYMRNFTDPS-VRIEHMMWIPTFQGCF-PFAMVIGGLTSSTFSPRVSAFIGCFLVTSSVALSAYAIQHSFALFFIVYGLLFGLGSGIAYVTAVSTAINWAPDKIGVISGIVAAGFGLSSSIFAPIQTMIVNPLNLPATK----DGYFLQPELLHRVPALFTKLAVIYGIMQAMALIVVCDPPFRK-SRSTESILEEDDEDMDEDYE----RPVFDNDE--------------DTTIQMTSS---EMLKSPTFYCLFASLFCCSFYANMFYNLYKTYGESFIEDDMFMAMAFSIASVANAIARIGWGYLTDRTSFQIALSTATCLASV----FLLTMPMTRELGKM-AFLFWLVGTFICMGATHALFITATVKCFGNRHKANNYGYLILSTTTSGILLAAISQFYLKAIGYTYLFIITSI 438          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: mct-6 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:O17328])

HSP 1 Score: 51.6026 bits (122), Expect = 1.219e-6
Identity = 50/160 (31.25%), Postives = 77/160 (48.12%), Query Frame = 3
Query:  123 VTGGFFLH-FSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLE---KKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYIN 590
            V G FF+H F+ G  Y+FG +   +    ++  SNT              +L  GL +  G +      K G RIT + G     +G  L+Y+A  T +W +++T GVI G G GL Y  AI     +F  K+ +  G   AG G+G+++F  +   +IN
Sbjct:   27 VLGSFFVHVFADGFVYSFGVLVETLME--EFHASNTMAA--------LIISLLTGLTLGSGPLASAVCNKYGCRITTITGAGVAFVGCALSYFA--TAMWHIVITVGVIMGTGFGLMYCPAIVIVTMYFENKRSLATGIAVAGAGVGTVLFAPINAFFIN 174          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|P37662|YHJX_ECOLI (Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) OX=83333 GN=yhjX PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.595e-17
Identity = 108/427 (25.29%), Postives = 188/427 (44.03%), Query Frame = 3
Query:  144 HFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMS--LGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFF---LNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVA--AIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICS 1403
             F+LG+ YT+   +  +++ L    S            F+F  L LGL +S  + G L+++ G +   +  G  + LG  LT ++   N+  + ++ GV+ G   G  Y + +S  +KWFP +KG+++      YGLGSL F  + T+ +        +T  +EK              FVI G    ++ + G  L+ D+    P +EV+      T    VEK                                  D ++ E+++  + W+L   F    ++G+ +I ++   K   Q+    D   S   AV   +I N  GRLV G L DKI+  +++TI  +   V M +  F       +  +  +A   C+ F    G+  +FP++ S+ FG  N+A  YG+++LGF +  + G++I S
Sbjct:   21 QFALGSVYTWSLFNGALSAKLDAPVSQV---------AFSFGLLSLGLAISSSVAGKLQERFGVKRVTMASGILLGLGFFLTAHS--DNLMMLWLSAGVLVGLADGAGYLLTLSNCVKWFPERKGLISAFAIGSYGLGSLGFKFIDTQLL--------ETVGLEK-------------TFVIWGAIALLMIVFGATLMKDA----PKQEVK------TSNGVVEK----------------------------------DYTLAESMRKPQYWMLAVMFLTACMSGLYVIGVA---KDIAQSLAHLD-VVSAANAVTVISIANLSGRLVLGILSDKIARIRVITIGQVISLVGMAALLFA-----PLNAVTFFAAIACVAF-NFGGTITVFPSLVSEFFGLNNLAKNYGVIYLGFGIGSICGSIIAS 361          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q51330|OXLT_OXAFO (Oxalate:formate antiporter OS=Oxalobacter formigenes OX=847 GN=oxlT PE=1 SV=3)

HSP 1 Score: 60.077 bits (144), Expect = 2.643e-8
Identity = 51/211 (24.17%), Postives = 96/211 (45.50%), Query Frame = 3
Query:  864 ELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFF---LNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQF 1487
              P  + AK    V   D +  E ++  + W+L + FF     G++++  S  Y   G++        +I  ++  +FN   R  WG + DKI   K M+++    +V++  F     +  ++  + M AI     FF   GS+A+FP+  S  FGT   A  YG  +   A + + G  + +++ +   +   F++  ++S I+  L  F
Sbjct:  193 RFPGQQGAKKQIVVTDKDFNSGEMLRTPQFWVLWTAFFSVNFGGLLLVANSVPY---GRSLGLAAGVLTIGVSIQNLFNGGCRPFWGFVSDKIGRYKTMSVVFGINAVVLALFPTIAAL-GDVAFIAMLAI----AFFTWGGSYALFPSTNSDIFGTAYSARNYGFFWAAKATASIFGGGLGAAIATNFGWNTAFLITAITSFIAFALATF 395          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A0H3YF06 (Slc16a-5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc16a-5 PE=2 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.348e-120
Identity = 210/472 (44.49%), Postives = 301/472 (63.77%), Query Frame = 3
Query:   69 LLYFIMVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKT-STVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLT 1481
            L  F+M+R     +G  C+ GGF +HFSLG+ YTFGNISPY+ASY++ R     V +  MVW+FAF+    GL MS GG+L+KKVG+R T LIG   MS   ILTY+ ++ NI+  I+TYGVIFG G G+ YSV ++A++KWFP  KG+V G V AG+GLGSL FN +QT YINP N+SPN T    ++YFT+E VL  VP+CF+  G  YA IQLIG I+L    F     E+ +++++ T  +  E          D+E      LP+             DS++ +AIK +  WIL   F   G + +  +SLYK+FGQ FI++D Y ++VG+VA+IFN++GR+ WG+++D+ SY+  +  + I+ +++MG+FY C LV + +G  +M+ IWVC +F  + G FA+ PAIT++ FG   +  IYGI+F   A +G+ GAL  S  LS INY G+F +    + I+L+LT
Sbjct:    1 LFKFLMIR---NFKGYLCILGGFLIHFSLGSIYTFGNISPYIASYMRSRPVTQSVKNSDMVWIFAFALASQGLTMSFGGVLDKKVGSRFTVLIGCCIMSASVILTYFTIQANIYVTILTYGVIFGFGVGIAYSVVLAASIKWFPNNKGLVIGVVVAGFGLGSLAFNQIQTLYINPQNISPNFTKEDTDRYFTDEKVLEKVPYCFLYTGIIYASIQLIGCIIL----FSPSQTEMMISILSNTGSSNSELSTNFISETYDDENNIQSLLPKDNH----------DSNIFKAIKQRDFWILWFIFMFCGTINVYATSLYKTFGQLFITSDYYLALVGSVASIFNAMGRIFWGQVMDRFSYKVAIRSIIINSTILMGTFYLCHLVPNSIGARVMFLIWVCGIFANICGIFAVMPAITAKLFGLKKVVTIYGILFSANAFAGIFGALTTSIFLSKINYFGIFGIGAGLTTIALILT 455          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HYG0 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 1.451e-106
Identity = 180/466 (38.63%), Postives = 291/466 (62.45%), Query Frame = 3
Query:  108 RGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTST-VEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSR---EVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELP-EIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFF 1490
            +GI  V GGF +HF+LGT YTFGN+SPY+ SY++  + + W+      W+F  S    G  M+ GG++EK++GAR+T L+G W MSLG +L+Y+AVK+++  ++VTYG++FG G+G+ Y+VAI+A+M WFP+++G+V G V AG+G GSL+F+  QT YINP NV  N T+   E+YF    +++ VP CFV +G  YA++Q +GV LL     ++P+    E R  L+    ++   +     E  LD   +G    P  ++ ++   +   +DS+  + ++  + W+L +TF +N   ++ I++ YKSFG +   ND Y +IVG++AA FN+  R++WG L D+++YR +M +L+  M+V+M +F   G   +       Y +WVC +F   +G+FA+FPA  ++ +G TN+ + YG++F   A SG+IGAL+ + L   I + GLF++    S +  V T  F
Sbjct:    6 KGIGAVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKWIGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALL-----RRPTAAELEERQELVGEAGDDTAAQ-----ETALD---EGSPSKPVAMETSEHGNRGGESDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTLSGAPWY-------YLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFTLLF 451          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HL50 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 5.704e-106
Identity = 180/466 (38.63%), Postives = 290/466 (62.23%), Query Frame = 3
Query:  108 RGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTS-TVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSR---EVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELP-EIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFF 1490
            +GI  V GGF +HF+LGT YTFGN+SPY+ SY++  + + W+      W+F  S    G  M+ GG++EK++GAR+T L+G W MSLG +L+Y+AVK+++  ++VTYG++FG G+G+ Y+VAI+A+M WFP+++G+V G V AG+G GSL+F+  QT YINP NV  N T+   E+YF    +++ VP CFV +G  YA++Q +GV LL     ++P+    E R  L+    ++   +     E  LD   +G    P  ++ ++   +    DS+  + ++  + W+L +TF +N   ++ I++ YKSFG +   ND Y +IVG++AA FN+  R++WG L D+++YR +M +L+  M+V+M +F   G   +       Y +WVC +F   +G+FA+FPA  ++ +G TN+ + YG++F   A SG+IGAL+ + L   I + GLF++    S +  V T  F
Sbjct:    6 KGIGAVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKWIGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALL-----RRPTAAELEERQELVGEAGDDTAAQ-----ETALD---EGSPSKPVAMETSEHGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTLSGAPWY-------YLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFTLLF 451          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A267H5U2 (MFS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000477g2 PE=4 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 6.756e-106
Identity = 180/466 (38.63%), Postives = 290/466 (62.23%), Query Frame = 3
Query:  108 RGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTS-TVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSR---EVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELP-EIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFF 1490
            +GI  V GGF +HF+LGT YTFGN+SPY+ SY++  + + W+      W+F  S    G  M+ GG++EK++GAR+T L+G W MSLG +L+Y+AVK+++  ++VTYG++FG G+G+ Y+VAI+A+M WFP+++G+V G V AG+G GSL+F+  QT YINP NV  N T+   E+YF    +++ VP CFV +G  YA++Q +GV LL     ++P+    E R  L+    ++   +     E  LD   +G    P  ++ ++   +    DS+  + ++  + W+L +TF +N   ++ I++ YKSFG +   ND Y +IVG++AA FN+  R++WG L D+++YR +M +L+  M+V+M +F   G   +       Y +WVC +F   +G+FA+FPA  ++ +G TN+ + YG++F   A SG+IGAL+ + L   I + GLF++    S +  V T  F
Sbjct:    8 KGIGAVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKWIGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALL-----RRPTAAELEERQELVGEAGDDTAAQ-----ETALD---EGSPSKPVAMETSEHGNRGGELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTLSGAPWY-------YLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFTLLF 453          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A267DK45 (MFS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000477g4 PE=4 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 5.719e-105
Identity = 183/471 (38.85%), Postives = 289/471 (61.36%), Query Frame = 3
Query:  114 ISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTS-TVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVE----KQLKNGERLLDNEAK--GLKELPEIKQAKLDP-----KVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFF 1490
            I  V GGF +HF+LGT YTFGN+SPY+ SY++  + + W+      W+F  S    G  M+ GG++EK++GAR+T L+G W MSLG +L+Y+AVK+++  ++VTYG++FG G+G+ Y+VAI+A+M WFP+++G+V G V AG+G GSL+F+  QT YINP NV  N T+   E+YF    +++ VP CFV +G  YA++Q +GV LL     ++P+    L  +N  K N       +Q   GE   D  A+   L E    K   ++      +   +DS+  + ++  + W+L +TF +N   ++ I++ YKSFG +   ND Y +IVG++AA FN+  R++WG L D+++YR +M +L+  M+V+M +F   G   +       Y +WVC +F   +G+FA+FPA  ++ +G TN+ + YG++F   A SG+IGAL+ + L   I + GLF++    S +  V T  F
Sbjct:    1 IGAVIGGFLIHFTLGTLYTFGNMSPYVVSYMRLHSHSKWIGYPDATWIFGLSIFGQGASMAFGGLIEKRIGARLTALLGSWIMSLGVLLSYFAVKSHLGLLVVTYGLLFGVGTGIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALL-----RRPT-AAELEEVNRRKNNGYMYMPLRQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGESDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTLSGAPWY-------YLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFTLLF 458          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060699.1 (SMESG000060699.1)

HSP 1 Score: 931.398 bits (2406), Expect = 0.000e+0
Identity = 478/481 (99.38%), Postives = 480/481 (99.79%), Query Frame = 3
Query:   84 MVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFPKPFNEDLPEKP 1526
            MVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKGMVAGAVAAGYGLGSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLIN+TKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNS GRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFP+PFNEDLPEKP
Sbjct:    1 MVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKGMVAGAVAAGYGLGSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINSTKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSGGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFPRPFNEDLPEKP 481          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060699.1 (SMESG000060699.1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 465/481 (96.67%), Postives = 466/481 (96.88%), Query Frame = 3
Query:   84 MVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFPKPFNEDLPEKP 1526
            MVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKGMVAGAVAAGYGLGSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSRE              EKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNS GRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFP+PFNEDLPEKP
Sbjct:    1 MVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKGMVAGAVAAGYGLGSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSRE--------------EKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSGGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFPRPFNEDLPEKP 467          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060694.1 (SMESG000060694.1)

HSP 1 Score: 516.153 bits (1328), Expect = 2.087e-180
Identity = 266/480 (55.42%), Postives = 350/480 (72.92%), Query Frame = 3
Query:   90 RLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIG-GWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFPKPFNEDLPEKP 1526
            ++    +GI CV G F LHFSLGT YTFGN+SPY+ASYLKYRT NTW+N+GH+VWVF+ +  FLGL MS GG LEKK+GARITCL    +  S+GTI TY+++K+ IW VI +YG+ +G G+G+TYSVA++ A+KWFP ++GMV+G V  G+GLGSLIFN++QT YINP NV+PN T   EKYF +++VL+ VPFCFV+IG  YAIIQLIGV++L D    K  +E+         +NE+   ++   ++  ++A+ LKE     +          D +VKEA+K+ R WIL  TFF NG+ I+I SS YKSFGQTFIS+DRYFSIVGAVAAIFNSVGR++WG L+D  SYRK+MT LT+  S+ +GSF+FC  ++ E+G  IMY +WVC LFFCLSGSF +FPAITSQCFG  N+AIIYG++ + +++S +IGALI S LL  I YGG+F++A +SS+ S VLTQ F     + L  K 
Sbjct:    7 KVDRKIKGIFCVIGAFLLHFSLGTVYTFGNLSPYIASYLKYRTDNTWINNGHLVWVFSLNVFFLGLTMSFGGFLEKKIGARITCLCDIQFFYSIGTISTYFSIKSGIWLVIFSYGIAYGFGTGITYSVAVATAIKWFPKRRGMVSGIVTGGFGLGSLIFNLIQTAYINPKNVAPNSTDLYEKYFVDDSVLDKVPFCFVLIGGMYAIIQLIGVVMLTDPTPDKEHKEM-------CSDNEILTDIE--FKIQSDDAEMLKETKSFSKE--------FDFNVKEAVKNCRFWILSFTFFFNGMFIVIHSSYYKSFGQTFISDDRYFSIVGAVAAIFNSVGRIIWGTLVDFFSYRKVMTSLTVLKSLFIGSFFFCQFIEAEVGAKIMYFLWVCFLFFCLSGSFGLFPAITSQCFGNKNLAIIYGLIVISYSISAIIGALISSLLLPRIQYGGVFLIAVVSSLCSTVLTQCFRNSITDKLHSKD 469          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060693.1 (SMESG000060693.1)

HSP 1 Score: 510.375 bits (1313), Expect = 1.378e-178
Identity = 277/450 (61.56%), Postives = 347/450 (77.11%), Query Frame = 3
Query:  180 ISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNK--TSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFPKPFNEDLPEK 1523
            +SPY+ASYLK RT+N+WVNSGHMVW+F+ +       MSLGG+LEKKVGARITCL+G W+MS+GTILTY+A+K N+WAVI TYG+IFG G+GLTYSVA++  MKWFP +KG+VAG V AGYGLGSLIFN+VQTK+INP N+SPN   T T +KYFT+  VL+N+P CFV+IG +YA+IQLIGVI+L DS+ +K S EV + +++      VEK L   +  LD E    K        K   + +  D +VK+A+K++R WIL +TFF NGIVI+ ISSLYKS+GQTFI+ND++FS VGAVAAIFNS GRLVWGRLLD + Y++MMT LTI+M+VMMGSFY C  +    G   MY IWVCLLFFCLSGSFAMFP +TSQ FG  NMAIIYG+VF G+A+S ++ ALI S LL  I YGGLFIVAT+S++ISLVLTQFFP   ++ + +K
Sbjct:    1 MSPYVASYLKTRTNNSWVNSGHMVWIFSIAVFSQAFTMSLGGVLEKKVGARITCLVGSWTMSIGTILTYFAIKANLWAVIATYGLIFGMGTGLTYSVALATPMKWFPNRKGLVAGTVVAGYGLGSLIFNLVQTKFINPNNISPNPNSTKTADKYFTDPKVLDNIPICFVVIGVSYAVIQLIGVIILTDSSQRKSSGEVLMPVVSKKNGVIVEKGLVEKDSELDEEITKSKAYSATLNEK--RQSISQDLTVKDALKERRFWILWTTFFFNGIVIVAISSLYKSYGQTFITNDQFFSTVGAVAAIFNSGGRLVWGRLLDVVPYKRMMTALTITMAVMMGSFYGCSSIDSIAGRQAMYFIWVCLLFFCLSGSFAMFPTVTSQSFGNKNMAIIYGLVFSGYAISSIMSALIFSLLLKTIMYGGLFIVATISAMISLVLTQFFPLQTSKPVMKK 448          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060693.1 (SMESG000060693.1)

HSP 1 Score: 501.13 bits (1289), Expect = 3.655e-175
Identity = 275/450 (61.11%), Postives = 347/450 (77.11%), Query Frame = 3
Query:  180 ISPYMASYLKYRTSNTWVNSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILTYYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKXXXXXXXXXXXXXXSLIFNIVQTKYINPFNVSPNK--TSTVEKYFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGERLLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFPKPFNEDLPEK 1523
            +SPY+ASYLK RT+N+WVNSGHMVW+F+ +       MSLGG+LEKKVGARITCL+G W+MS+GTILTY+A+K N+WAVI TYG+IFG G+GLTYSVA++  MKWFP +KG+VAG V AGYGLGSLIFN+VQTK+INP N+SPN   T T +KYFT+  VL+N+P CFV+IG +YA+IQLIGVI+L DS+ +K S E         ++  VEK  +  E +  ++A     L E +Q+      +  D +VK+A+K++R WIL +TFF NGIVI+ ISSLYKS+GQTFI+ND++FS VGAVAAIFNS GRLVWGRLLD + Y++MMT LTI+M+VMMGSFY C  +    G   MY IWVCLLFFCLSGSFAMFP +TSQ FG  NMAIIYG+VF G+A+S ++ ALI S LL  I YGGLFIVAT+S++ISLVLTQFFP   ++ + +K
Sbjct:    1 MSPYVASYLKTRTNNSWVNSGHMVWIFSIAVFSQAFTMSLGGVLEKKVGARITCLVGSWTMSIGTILTYFAIKANLWAVIATYGLIFGMGTGLTYSVALATPMKWFPNRKGLVAGTVVAGYGLGSLIFNLVQTKFINPNNISPNPNSTKTADKYFTDPKVLDNIPICFVVIGVSYAVIQLIGVIILTDSSQRKSSGE---------EKGLVEKDSELDEEITKSKAYS-ATLNEKRQS------ISQDLTVKDALKERRFWILWTTFFFNGIVIVAISSLYKSYGQTFITNDQFFSTVGAVAAIFNSGGRLVWGRLLDVVPYKRMMTALTITMAVMMGSFYGCSSIDSIAGRQAMYFIWVCLLFFCLSGSFAMFPTVTSQSFGNKNMAIIYGLVFSGYAISSIMSALIFSLLLKTIMYGGLFIVATISAMISLVLTQFFPLQTSKPVMKK 434          
The following BLAST results are available for this feature:
BLAST of MFS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F10G7.54.650e-5728.42pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
F10G7.54.650e-5728.42pep chromosome:WBcel235:II:4693542:4696408:1 gene:... [more]
F10G7.56.104e-5728.42pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
Y59A8B.212.041e-5029.41pep chromosome:WBcel235:V:17986260:17994546:1 gene... [more]
mct-61.219e-631.25MonoCarboxylate Transporter family [Source:UniPro... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P37662|YHJX_ECOLI2.595e-1725.29Uncharacterized MFS-type transporter YhjX OS=Esche... [more]
sp|Q51330|OXLT_OXAFO2.643e-824.17Oxalate:formate antiporter OS=Oxalobacter formigen... [more]
back to top
BLAST of MFS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF061.348e-12044.49Slc16a-5 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A1I8HYG01.451e-10638.63MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HL505.704e-10638.63MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267H5U26.756e-10638.63MFS domain-containing protein (Fragment) OS=Macros... [more]
A0A267DK455.719e-10538.85MFS domain-containing protein (Fragment) OS=Macros... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060699.10.000e+099.38SMESG000060699.1[more]
SMESG000060699.10.000e+096.67SMESG000060699.1[more]
SMESG000060694.12.087e-18055.42SMESG000060694.1[more]
SMESG000060693.11.378e-17861.56SMESG000060693.1[more]
SMESG000060693.13.655e-17561.11SMESG000060693.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000179 ID=SMED30000179|Name=MFS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1593bp
GTTTTTCTACACTATATATTTATCTTGAATTTTCAAGTTAAAATATTTTA
TTTAAATCATTGTATAATCTATTATATTTTATCATGGTTCGACTAGGAAA
TACTGCAAGAGGTATTTCATGCGTAACTGGCGGTTTCTTTTTGCATTTTT
CTCTGGGAACATTCTATACGTTTGGCAATATTTCACCCTACATGGCCTCA
TATTTGAAATATCGCACCAGCAATACCTGGGTTAACAGTGGACACATGGT
CTGGGTATTTGCCTTCTCAGCGCTTTTTCTAGGATTAATCATGTCTTTGG
GAGGTATGCTAGAAAAGAAAGTAGGAGCAAGAATCACTTGTTTAATCGGT
GGCTGGTCAATGAGTTTGGGAACGATACTGACGTATTATGCTGTGAAAAC
CAACATTTGGGCCGTAATTGTCACGTACGGAGTGATATTTGGCGGCGGGT
CAGGATTGACTTATTCTGTCGCAATCAGTGCTGCAATGAAGTGGTTTCCA
ACTAAAAAAGGAATGGTCGCCGGAGCGGTGGCTGCTGGCTATGGGTTGGG
ATCGTTGATTTTCAACATTGTTCAAACCAAATACATAAATCCTTTCAATG
TATCTCCTAATAAAACTTCAACTGTAGAAAAGTATTTCACAAACGAGACT
GTTCTGAATAATGTTCCATTTTGTTTTGTCATTATTGGTACTGCATACGC
AATTATTCAGCTGATTGGGGTCATCCTCCTCATGGACTCCGCATTCAAGA
AGCCTAGCAGAGAAGTACGACTGACATTAATTAATGCAACAAAAGAAAAT
GAAGTGGAAAAACAACTAAAAAATGGAGAACGTCTCTTGGACAATGAGGC
AAAAGGTCTAAAGGAATTACCGGAAATAAAACAAGCAAAGCTTGATCCAA
AAGTTCTTCTAACTGATAGTTCAGTAAAAGAAGCTATAAAAGACAAAAGA
TTGTGGATTCTTTGTTCAACCTTCTTCTTAAATGGCATCGTCATTATCAT
AATATCATCCCTTTACAAGAGCTTTGGACAAACCTTTATCAGCAATGATC
GTTATTTTTCAATTGTTGGAGCAGTAGCGGCGATATTTAATTCGGTAGGC
AGATTGGTATGGGGTCGGCTTTTGGATAAGATTTCATATCGAAAAATGAT
GACAATACTCACAATTTCAATGTCTGTTATGATGGGCTCATTTTACTTTT
GTGGTCTCGTCAAGCATGAAATGGGGGTTTTAATTATGTACGCAATATGG
GTCTGCTTGCTGTTCTTTTGCTTATCAGGTAGTTTTGCAATGTTTCCAGC
AATCACATCGCAATGTTTCGGAACTACAAATATGGCCATCATATATGGGA
TAGTATTTCTTGGCTTTGCTGTTTCGGGTGTCATTGGAGCTCTGATATGT
AGTAGCTTGTTGAGTCTCATCAACTATGGCGGATTATTCATAGTTGCAAC
CCTATCTTCCATCATAAGTCTAGTATTAACACAATTTTTTCCAAAACCTT
TCAACGAAGATCTACCAGAAAAGCCGATTTAATGTACAATTTATATAATA
ATTATGTAGATTTGATAAATTATTAAATTATTGTTAATAAAAA
back to top

protein sequence of SMED30000179-orf-1

>SMED30000179-orf-1 ID=SMED30000179-orf-1|Name=SMED30000179-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=483bp
MVRLGNTARGISCVTGGFFLHFSLGTFYTFGNISPYMASYLKYRTSNTWV
NSGHMVWVFAFSALFLGLIMSLGGMLEKKVGARITCLIGGWSMSLGTILT
YYAVKTNIWAVIVTYGVIFGGGSGLTYSVAISAAMKWFPTKKGMVAGAVA
AGYGLGSLIFNIVQTKYINPFNVSPNKTSTVEKYFTNETVLNNVPFCFVI
IGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINATKENEVEKQLKNGER
LLDNEAKGLKELPEIKQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLN
GIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSVGRLVWGRLLDKI
SYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGS
FAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGG
LFIVATLSSIISLVLTQFFPKPFNEDLPEKPI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 26..406
e-value: 1.7E-27
score: 96.3
NoneNo IPR availablePANTHERPTHR11360:SF3OXALATE/FORMATE ANTIPORTERcoord: 14..467
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 14..467
NoneNo IPR availableCDDcd17353MFS_OFA_likecoord: 16..469
e-value: 1.32631E-73
score: 235.582
NoneNo IPR availableTMHMMTMhelixcoord: 419..441
NoneNo IPR availableTMHMMTMhelixcoord: 53..75
NoneNo IPR availableTMHMMTMhelixcoord: 194..216
NoneNo IPR availableTMHMMTMhelixcoord: 358..375
NoneNo IPR availableTMHMMTMhelixcoord: 80..102
NoneNo IPR availableTMHMMTMhelixcoord: 382..404
NoneNo IPR availableTMHMMTMhelixcoord: 324..343
NoneNo IPR availableTMHMMTMhelixcoord: 289..311
NoneNo IPR availableTMHMMTMhelixcoord: 448..470
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 144..163
NoneNo IPR availableTMHMMTMhelixcoord: 109..131
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 9..474
score: 11.42
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 23..473