Formin-like protein 15

Overview
NameFormin-like protein 15
Smed IDSMED30000165
Length (bp)3800
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Formin-like protein 15 (SMED30000165) t-SNE clustered cells

Violin plots show distribution of expression levels for Formin-like protein 15 (SMED30000165) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Formin-like protein 15 (SMED30000165) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Formin-like protein 15 (SMED30000165) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000165

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000165SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000165SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000165SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000165SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000165SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000165SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000165SMESG000035694.1 SMESG000035692.1 dd_Smed_v4_8222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000165SMESG000035694.1 SMESG000035692.1 Contig14096uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000165SMESG000035694.1 SMESG000035692.1 Contig14096newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD3 (formin homology 2 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26178])

HSP 1 Score: 318.161 bits (814), Expect = 3.337e-94
Identity = 208/542 (38.38%), Postives = 312/542 (57.56%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSN----RT---IPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT--RRLAGTRERKSMRRT 3562
            G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L                 D     N +A   ++ P  E ++     RT     R S+S      + SP +++          D +D+++D + + AT    +R     R      RKS+RRT
Sbjct:   96 GQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGL-------------SYAEDAAEHENMKAVLKTSSPSVEDATPALGVRTRSRASRGSTSSWTMGTDDSPNVTD----------DAADEIMDRIVKSATQVPSQRVVPRERKRSRANRKSLRRT 612          
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD3 (formin homology 2 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26178])

HSP 1 Score: 307.76 bits (787), Expect = 8.004e-92
Identity = 203/530 (38.30%), Postives = 305/530 (57.55%), Query Frame = 2
Query: 2027 RLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSN----RT---IPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT--RRLAGTRERKSMRRT 3562
            RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L                 D     N +A   ++ P  E ++     RT     R S+S      + SP +++          D +D+++D + + AT    +R     R      RKS+RRT
Sbjct:    1 RLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGL-------------SYAEDAAEHENMKAVLKTSSPSVEDATPALGVRTRSRASRGSTSSWTMGTDDSPNVTD----------DAADEIMDRIVKSATQVPSQRVVPRERKRSRANRKSLRRT 505          
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD3 (formin homology 2 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26178])

HSP 1 Score: 318.931 bits (816), Expect = 4.633e-90
Identity = 211/561 (37.61%), Postives = 316/561 (56.33%), Query Frame = 2
Query: 1934 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSN----RT---IPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT--RRLAGTRERKSMRRT 3562
            PP P   +           G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L                 D     N +A   ++ P  E ++     RT     R S+S      + SP +++          D +D+++D + + AT    +R     R      RKS+RRT
Sbjct:  642 PPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGLSYA-------------EDAAEHENMKAVLKTSSPSVEDATPALGVRTRSRASRGSTSSWTMGTDDSPNVTD----------DAADEIMDRIVKSATQVPSQRVVPRERKRSRANRKSLRRT 1177          

HSP 2 Score: 109.768 bits (273), Expect = 2.112e-23
Identity = 55/131 (41.98%), Postives = 83/131 (63.36%), Query Frame = 2
Query:  710 FIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRA 1102
            F+EY+   E +A  +I ++     K G KPWS +++IL + +  D+EL+ YA+T +NK LS +PDQDTFY+V D LEE  + ++++  LNK   D+D+++Q  IYE ALR EDG++       G R   RA
Sbjct:   16 FVEYS---ESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRA 143          
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD3 (formin homology 2 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26178])

HSP 1 Score: 320.472 bits (820), Expect = 1.003e-89
Identity = 169/355 (47.61%), Postives = 244/355 (68.73%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRA 1102
            M    C++ + +D DPF++T+  PEP+  P + F +D  +   L  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +ETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I ++     K G KPWS +++IL + +  D+EL+ YA+T +NK LS +PDQDTFY+V D LEE  + ++++  LNK   D+D+++Q  IYE ALR EDG++       G R   RA
Sbjct:    1 MATLACRVQFLDDTDPFNSTN-FPEPSRPPLFTFREDLALGTQLAGVHRLLQAPHKLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRA 344          

HSP 2 Score: 318.546 bits (815), Expect = 4.264e-89
Identity = 211/561 (37.61%), Postives = 316/561 (56.33%), Query Frame = 2
Query: 1934 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSN----RT---IPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT--RRLAGTRERKSMRRT 3562
            PP P   +           G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L                 D     N +A   ++ P  E ++     RT     R S+S      + SP +++          D +D+++D + + AT    +R     R      RKS+RRT
Sbjct:  864 PPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGLSYA-------------EDAAEHENMKAVLKTSSPSVEDATPALGVRTRSRASRGSTSSWTMGTDDSPNVTD----------DAADEIMDRIVKSATQVPSQRVVPRERKRSRANRKSLRRT 1399          
BLAST of Formin-like protein 15 vs. Ensembl Human
Match: FHOD3 (formin homology 2 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:26178])

HSP 1 Score: 320.087 bits (819), Expect = 1.431e-89
Identity = 169/355 (47.61%), Postives = 244/355 (68.73%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRA 1102
            M    C++ + +D DPF++T+  PEP+  P + F +D  +   L  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +ETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I ++     K G KPWS +++IL + +  D+EL+ YA+T +NK LS +PDQDTFY+V D LEE  + ++++  LNK   D+D+++Q  IYE ALR EDG++       G R   RA
Sbjct:    1 MATLACRVQFLDDTDPFNSTN-FPEPSRPPLFTFREDLALGTQLAGVHRLLQAPHKLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRA 344          

HSP 2 Score: 318.161 bits (814), Expect = 6.899e-89
Identity = 211/561 (37.61%), Postives = 316/561 (56.33%), Query Frame = 2
Query: 1934 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSN----RT---IPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT--RRLAGTRERKSMRRT 3562
            PP P   +           G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L                 D     N +A   ++ P  E ++     RT     R S+S      + SP +++          D +D+++D + + AT    +R     R      RKS+RRT
Sbjct:  881 PPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGLSYA-------------EDAAEHENMKAVLKTSSPSVEDATPALGVRTRSRASRGSTSSWTMGTDDSPNVTD----------DAADEIMDRIVKSATQVPSQRVVPRERKRSRANRKSLRRT 1416          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 261.922 bits (668), Expect = 4.691e-71
Identity = 147/339 (43.36%), Postives = 220/339 (64.90%), Query Frame = 2
Query:   41 IDDMENFKCKICYYNDIDPFSTTST-VPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQ-FLDFDLTVQEQIEDLDGY-IESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 1048
            +DD + F C+I Y ND DPF+TTS+   EP     + F     + + L+++   L  PHK  ++ LQ+ +  +        +LD D+T+ +Q E+LD    ++  C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL   FRLVVK ALKLL+VFIEY  +  L     I ++++     G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+Y+  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:    1 MDDDDTFTCRIQYINDADPFATTSSSYLEPMRPVTFKFRLHECISDQLQDVIRTLRAPHKAGDSSLQVYRGLEGGGGELHTYLDNDMTLTDQQEELDILKADTRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPFRLVVKTALKLLLVFIEYNDNNALLVLTAIQTVDKSK---GQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 334          

HSP 2 Score: 237.654 bits (605), Expect = 1.855e-63
Identity = 178/545 (32.66%), Postives = 284/545 (52.11%), Query Frame = 2
Query: 2015 KRTTRLHWKTFGPQVSNG----DIGSTIWSKMKNV--DFDYERFESLFENKPHDFKKHEAGPKK--------LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQ 3607
            K   +LHWK    +  +G        + W+ +      FD ++   LFE K    K+ EA  KK        L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S+ +  +++ ++  D ++RI ++K IY     +++  L Y G+   +          K++++F++EYRTTR+KILQ   +  + ++R +TRG     I +L+  S E  + +       + R+N       +   +   R              +N    RP+ S+ ++  N    + ++    S       D++L+ L + AT     R  RR A    RKS+RRT+       +K +D Q
Sbjct:  823 KGVLKLHWKPATVEQPDGIPSLKQKGSFWNTVDGAVPTFDAKKIVQLFETK----KEKEAPVKKVAETKTQTLSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNSNMK--QKINDYLADVAQRIHQLKAIYTVTKNRWHSFLLYFGYSVDEIPNQTPNDVFKMVTEFSLEYRTTRDKILQQRKRLAEKRERNKTRGK----IWALEGSSAEGGAGD----AAPLRRRNHGPGTV-APVQNSQQRHDDMSKMLASMADDNNSLRRRPAGSNGVNGRNFGGSVKDLVDTESP-----EDEILNGLVKAATLQTDPRDQRRRARQFNRKSLRRTR------TLKMVDGQ 1341          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 260.766 bits (665), Expect = 4.917e-71
Identity = 147/339 (43.36%), Postives = 220/339 (64.90%), Query Frame = 2
Query:   41 IDDMENFKCKICYYNDIDPFSTTST-VPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQ-FLDFDLTVQEQIEDLDGY-IESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 1048
            +DD + F C+I Y ND DPF+TTS+   EP     + F     + + L+++   L  PHK  ++ LQ+ +  +        +LD D+T+ +Q E+LD    ++  C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL   FRLVVK ALKLL+VFIEY  +  L     I ++++     G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+Y+  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:    1 MDDDDTFTCRIQYINDADPFATTSSSYLEPMRPVTFKFRLHECISDQLQDVIRTLRAPHKAGDSSLQVYRGLEGGGGELHTYLDNDMTLTDQQEELDILKADTRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPFRLVVKTALKLLLVFIEYNDNNALLVLTAIQTVDKSK---GQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 334          

HSP 2 Score: 238.81 bits (608), Expect = 4.856e-64
Identity = 178/545 (32.66%), Postives = 284/545 (52.11%), Query Frame = 2
Query: 2015 KRTTRLHWKTFGPQVSNG----DIGSTIWSKMKNV--DFDYERFESLFENKPHDFKKHEAGPKK--------LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQ 3607
            K   +LHWK    +  +G        + W+ +      FD ++   LFE K    K+ EA  KK        L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S+ +  +++ ++  D ++RI ++K IY     +++  L Y G+   +          K++++F++EYRTTR+KILQ   +  + ++R +TRG     I +L+  S E  + +       + R+N       +   +   R              +N    RP+ S+ ++  N    + ++    S       D++L+ L + AT     R  RR A    RKS+RRT+       +K +D Q
Sbjct:  665 KGVLKLHWKPATVEQPDGIPSLKQKGSFWNTVDGAVPTFDAKKIVQLFETK----KEKEAPVKKVAETKTQTLSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNSNMK--QKINDYLADVAQRIHQLKAIYTVTKNRWHSFLLYFGYSVDEIPNQTPNDVFKMVTEFSLEYRTTRDKILQQRKRLAEKRERNKTRGK----IWALEGSSAEGGAGD----AAPLRRRNHGPGTV-APVQNSQQRHDDMSKMLASMADDNNSLRRRPAGSNGVNGRNFGGSVKDLVDTESP-----EDEILNGLVKAATLQTDPRDQRRRARQFNRKSLRRTR------TLKMVDGQ 1183          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 250.751 bits (639), Expect = 1.664e-67
Identity = 147/356 (41.29%), Postives = 220/356 (61.80%), Query Frame = 2
Query:   41 IDDMENFKCKICYYNDIDPFSTTST-VPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQ-FLDFDLTVQEQIEDLDGY-IESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGK-----------------FRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 1048
            +DD + F C+I Y ND DPF+TTS+   EP     + F     + + L+++   L  PHK  ++ LQ+ +  +        +LD D+T+ +Q E+LD    ++  C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL                    FRLVVK ALKLL+VFIEY  +  L     I ++++     G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+Y+  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:    1 MDDDDTFTCRIQYINDADPFATTSSSYLEPMRPVTFKFRLHECISDQLQDVIRTLRAPHKAGDSSLQVYRGLEGGGGELHTYLDNDMTLTDQQEELDILKADTRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPLYIDEERKEMSPFRLEWFRLVVKTALKLLLVFIEYNDNNALLVLTAIQTVDKSK---GQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 351          

HSP 2 Score: 237.269 bits (604), Expect = 2.524e-63
Identity = 178/545 (32.66%), Postives = 284/545 (52.11%), Query Frame = 2
Query: 2015 KRTTRLHWKTFGPQVSNG----DIGSTIWSKMKNV--DFDYERFESLFENKPHDFKKHEAGPKK--------LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQ 3607
            K   +LHWK    +  +G        + W+ +      FD ++   LFE K    K+ EA  KK        L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S+ +  +++ ++  D ++RI ++K IY     +++  L Y G+   +          K++++F++EYRTTR+KILQ   +  + ++R +TRG     I +L+  S E  + +       + R+N       +   +   R              +N    RP+ S+ ++  N    + ++    S       D++L+ L + AT     R  RR A    RKS+RRT+       +K +D Q
Sbjct:  840 KGVLKLHWKPATVEQPDGIPSLKQKGSFWNTVDGAVPTFDAKKIVQLFETK----KEKEAPVKKVAETKTQTLSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNSNMK--QKINDYLADVAQRIHQLKAIYTVTKNRWHSFLLYFGYSVDEIPNQTPNDVFKMVTEFSLEYRTTRDKILQQRKRLAEKRERNKTRGK----IWALEGSSAEGGAGD----AAPLRRRNHGPGTV-APVQNSQQRHDDMSKMLASMADDNNSLRRRPAGSNGVNGRNFGGSVKDLVDTESP-----EDEILNGLVKAATLQTDPRDQRRRARQFNRKSLRRTR------TLKMVDGQ 1358          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 249.98 bits (637), Expect = 1.748e-67
Identity = 147/356 (41.29%), Postives = 220/356 (61.80%), Query Frame = 2
Query:   41 IDDMENFKCKICYYNDIDPFSTTST-VPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQ-FLDFDLTVQEQIEDLDGY-IESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGK-----------------FRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 1048
            +DD + F C+I Y ND DPF+TTS+   EP     + F     + + L+++   L  PHK  ++ LQ+ +  +        +LD D+T+ +Q E+LD    ++  C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL                    FRLVVK ALKLL+VFIEY  +  L     I ++++     G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+Y+  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:    1 MDDDDTFTCRIQYINDADPFATTSSSYLEPMRPVTFKFRLHECISDQLQDVIRTLRAPHKAGDSSLQVYRGLEGGGGELHTYLDNDMTLTDQQEELDILKADTRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPLYIDEERKEMSPFRLEWFRLVVKTALKLLLVFIEYNDNNALLVLTAIQTVDKSK---GQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 351          

HSP 2 Score: 238.81 bits (608), Expect = 5.220e-64
Identity = 178/545 (32.66%), Postives = 284/545 (52.11%), Query Frame = 2
Query: 2015 KRTTRLHWKTFGPQVSNG----DIGSTIWSKMKNV--DFDYERFESLFENKPHDFKKHEAGPKK--------LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQ 3607
            K   +LHWK    +  +G        + W+ +      FD ++   LFE K    K+ EA  KK        L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S+ +  +++ ++  D ++RI ++K IY     +++  L Y G+   +          K++++F++EYRTTR+KILQ   +  + ++R +TRG     I +L+  S E  + +       + R+N       +   +   R              +N    RP+ S+ ++  N    + ++    S       D++L+ L + AT     R  RR A    RKS+RRT+       +K +D Q
Sbjct:  682 KGVLKLHWKPATVEQPDGIPSLKQKGSFWNTVDGAVPTFDAKKIVQLFETK----KEKEAPVKKVAETKTQTLSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNSNMK--QKINDYLADVAQRIHQLKAIYTVTKNRWHSFLLYFGYSVDEIPNQTPNDVFKMVTEFSLEYRTTRDKILQQRKRLAEKRERNKTRGK----IWALEGSSAEGGAGD----AAPLRRRNHGPGTV-APVQNSQQRHDDMSKMLASMADDNNSLRRRPAGSNGVNGRNFGGSVKDLVDTESP-----EDEILNGLVKAATLQTDPRDQRRRARQFNRKSLRRTR------TLKMVDGQ 1200          
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Match: fhod-1 (Formin HOmology Domain [Source:UniProtKB/TrEMBL;Acc:A0A0K3AR77])

HSP 1 Score: 238.039 bits (606), Expect = 1.953e-63
Identity = 179/545 (32.84%), Postives = 284/545 (52.11%), Query Frame = 2
Query: 2015 KRTTRLHWKTFGPQVSNGDIG----STIWSKMKNV--DFDYERFESLFENKPHDFKKHEAGPKK--------LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQ 3607
            K   +LHWK    +  +G        + W+ +      FD ++   LFE K    K+ EA  KK        L VL +KRS AINIG+  L  I+ +  AI+   S V+N++G+EK+LKTM+P+ +EI+ I+     N +  LG AE+ LL L +I  L ERL +WLF LD +  E+DI EPLMD++L +KE+ +S T    +  +L +GN L+ T++  F L+YL K  EVKD  +KH+L YH+   +V  + + TDL+SE  A+ R  RVD++EL   L +LEKD   SW  L  I K+D S+ +  +++ ++  D ++RI ++K IY     +++  L Y G+   +          K++++F++EYRTTR+KILQ   +  + ++R +TRG     I +L+  S E  + +   L     R+N       +   +   R              +N    RP+ S+ ++  N    + ++    S       D++L+ L + AT     R  RR A    RKS+RRT+       +K +D Q
Sbjct: 1000 KGVLKLHWKPATVEQPDGIPSLKQKGSFWNTVDGAVPTFDAKKIVQLFETK----KEKEAPVKKVAETKTQTLSVLPLKRSQAINIGLTKLPPINVIPAAIMKFDSLVLNKDGIEKILKTMMPSPKEIEEIEIKAAENPEMTLGNAEQLLLKLSQIPCLLERLRLWLFTLDYKNSEKDIAEPLMDMQLAMKEMEESRTFKVAMGMLLAIGNSLSGTDIKGFYLDYLTKASEVKDPVYKHTLTYHLAEYMVEHFSEGTDLYSEFGAVARSARVDYKELLDNLIRLEKDCKSSWECLATISKNDNSNMK--QKINDYLADVAQRIHQLKAIYTVTKNRWHSFLLYFGYSVDEIPNQTPNDVFKMVTEFSLEYRTTRDKILQQRKRLAEKRERNKTRG----KIWALEGSSAEGGAGDAAPLR----RRNHGPGTV-APVQNSQQRHDDMSKMLASMADDNNSLRRRPAGSNGVNGRNFGGSVKDLVDTESP-----EDEILNGLVKAATLQTDPRDQRRRARQFNRKSLRRTR------TLKMVDGQ 1518          

HSP 2 Score: 222.631 bits (566), Expect = 1.545e-58
Identity = 134/332 (40.36%), Postives = 203/332 (61.14%), Query Frame = 2
Query:  101 STTSTVPEPTIKPNY-----LFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDL--------DGYIESG---NCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 1048
            S +S +  PTIKP+      L  ++   +  ++ I + +S P   +  V  +  +   +    +     +  Q+ +ED         D Y+ SG    C ++LRT+ S+RV+ +IDK+ N +G++ RRALFSLKQIFQDD+DLV EFV   GL C+ ++G  +DQNHQNYILRALGQLMLYVDGMNG++  + TI+WLY LL   FRLVVK ALKLL+VFIEY  +  L    ++ +I    +  G   WS ++K+L + ++ D+E + Y +T +NK L  IPD+DT+Y+  D L+   ME   K++   +N +++  +Q ++YE+ L+ ED
Sbjct:  349 SQSSYIAPPTIKPSVQSNSSLHRREDSGYRSMENIRK-MSIPEAAQPVVAMITPYTSKEPTSSK-----VESQDSVEDFHEDPFDWGDEYLNSGAKRRCSLVLRTQTSLRVKTIIDKLLNCSGRDQRRALFSLKQIFQDDQDLVHEFVQNQGLDCMIRLGRTADQNHQNYILRALGQLMLYVDGMNGIIAHNGTIQWLYELLDSPFRLVVKTALKLLLVFIEYNDNNALL---VLTAIQTVDKSKGQADWSGLMKVLTEKDSPDAETLVYGMTVVNKALHGIPDRDTYYDAVDTLDTLGMEDAIKSMSRSNNKELE--EQCRLYERELKEED 669          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0306631)

HSP 1 Score: 283.878 bits (725), Expect = 1.223e-78
Identity = 194/539 (35.99%), Postives = 294/539 (54.55%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAG-PKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT---RRLAGTRERKSMRRT-KPNITED 3583
            G +   K K+T +L WK     +    +G TIW ++ + + D ++ E LFE++  D    K+ E    K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D       ++L +F  D ++RI+ ++I++RRV+ +Y   L +LG P     E     FC+ LS+FA+EYRTTRE++ Q   KK   ++R +TRG +I D+            E   LL+                                  +++      R   + Q+ +P        +T  + E   D  D++L+ L + AT +   RTT   R+     +RKS+RRT K  +TE+
Sbjct:  642 GNNTIKKNKKTVKLFWKEVREDMIPQVVGKTIWDELPDANVDTQKLEHLFESRAKDLMTKKQQELNKSKEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLL-NMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHDCPPPLK-QKLVDFLADCAERIIILQIVHRRVMNRYRKFLLWLGMPQHSVAESRPNEFCRTLSEFALEYRTTRERVQQQLEKKANHRERNKTRGKLIIDMAKFKTKDDVADDELKKLLDT------------------------------SSADQADGTLTWRRRRAEQLRSP--------ITRQSEEQFTDGDDEILESLVKTATKAPGTRTTPRERKRTRHADRKSLRRTLKNGLTEE 1140          

HSP 2 Score: 272.707 bits (696), Expect = 4.997e-75
Identity = 158/382 (41.36%), Postives = 245/382 (64.14%), Query Frame = 2
Query:   44 DDMENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 1189
            D++  F+ +  Y  D DP S  +  P P   P Y F     + N L  I  +L+ P  +++A +Q+ K  D    YG +LD + ++ EQ E+++G   S    +++RT+L++RV+A+I+K+ +A G +LRRALFSLKQ+FQ+DKDLV  FVA  GL CL ++G+ +DQN+QNYILRALGQ+MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FY+ +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct:    8 DELITFRVQ--YLVDSDPLSACTAFPIPVRAPTYAFATTMPLANQLGTILRLLNAPQSIDDAAIQVYKDGD----YGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 366          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0302085)

HSP 1 Score: 283.878 bits (725), Expect = 4.390e-78
Identity = 199/543 (36.65%), Postives = 297/543 (54.70%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAG-PKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT---RRLAGTRERKSMRRT-KPNITED 3583
            G +   K K+T +L WK       PQV    +G TIW ++ + + D ++ E LFE++  D    K+ E    K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D       ++L +F  D ++RI+ ++I++RRV+ +Y   L +LG P     E     FC+ LS+FA+EYRTTRE++ Q   KK   ++R +TRG +I D+            E   LL+          S  D                     ++      R   + Q+ +P        +T  + E   D  D++L+ L + AT +   RTT   R+     +RKS+RRT K  +TE+
Sbjct:  883 GNNTIKKNKKTVKLFWKEVREDMIPQV----VGKTIWDELPDANVDTQKLEHLFESRAKDLMTKKQQELNKSKEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLL-NMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHDCPPPLK-QKLVDFLADCAERIIILQIVHRRVMNRYRKFLLWLGMPQHSVAESRPNEFCRTLSEFALEYRTTRERVQQQLEKKANHRERNKTRGKLIIDMAKFKTKDDVADDELKKLLDT---------SSAD---------------------QADGTLTWRRRRAEQLRSP--------ITRQSEEQFTDGDDEILESLVKTATKAPGTRTTPRERKRTRHADRKSLRRTLKNGLTEE 1381          

HSP 2 Score: 273.478 bits (698), Expect = 1.266e-74
Identity = 158/382 (41.36%), Postives = 245/382 (64.14%), Query Frame = 2
Query:   44 DDMENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 1189
            D++  F+ +  Y  D DP S  +  P P   P Y F     + N L  I  +L+ P  +++A +Q+ K  D    YG +LD + ++ EQ E+++G   S    +++RT+L++RV+A+I+K+ +A G +LRRALFSLKQ+FQ+DKDLV  FVA  GL CL ++G+ +DQN+QNYILRALGQ+MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FY+ +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct:    8 DELITFRVQ--YLVDSDPLSACTAFPIPVRAPTYAFATTMPLANQLGTILRLLNAPQSIDDAAIQVYKDGD----YGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 366          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0306630)

HSP 1 Score: 282.337 bits (721), Expect = 5.170e-78
Identity = 170/403 (42.18%), Postives = 250/403 (62.03%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAG-PKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDI 3175
            G +   K K+T +L WK       PQV    +G TIW ++ + + D ++ E LFE++  D    K+ E    K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D       ++L +F  D ++RI+ ++I++RRV+ +Y   L +LG P     E     FC+ LS+FA+EYRTTRE++ Q   KK   ++R +TRG +I D+
Sbjct:  701 GNNTIKKNKKTVKLFWKEVREDMIPQV----VGKTIWDELPDANVDTQKLEHLFESRAKDLMTKKQQELNKSKEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLL-NMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHDCPPPLK-QKLVDFLADCAERIIILQIVHRRVMNRYRKFLLWLGMPQHSVAESRPNEFCRTLSEFALEYRTTRERVQQQLEKKANHRERNKTRGKLIIDM 1097          

HSP 2 Score: 120.168 bits (300), Expect = 5.659e-27
Identity = 80/201 (39.80%), Postives = 127/201 (63.18%), Query Frame = 2
Query:  587 MLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 1189
            MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FY+ +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct:    1 MLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 184          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0306632)

HSP 1 Score: 283.878 bits (725), Expect = 1.016e-77
Identity = 199/543 (36.65%), Postives = 297/543 (54.70%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAG-PKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT---RRLAGTRERKSMRRT-KPNITED 3583
            G +   K K+T +L WK       PQV    +G TIW ++ + + D ++ E LFE++  D    K+ E    K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D       ++L +F  D ++RI+ ++I++RRV+ +Y   L +LG P     E     FC+ LS+FA+EYRTTRE++ Q   KK   ++R +TRG +I D+            E   LL+          S  D                     ++      R   + Q+ +P        +T  + E   D  D++L+ L + AT +   RTT   R+     +RKS+RRT K  +TE+
Sbjct: 1234 GNNTIKKNKKTVKLFWKEVREDMIPQV----VGKTIWDELPDANVDTQKLEHLFESRAKDLMTKKQQELNKSKEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLL-NMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHDCPPPLK-QKLVDFLADCAERIIILQIVHRRVMNRYRKFLLWLGMPQHSVAESRPNEFCRTLSEFALEYRTTRERVQQQLEKKANHRERNKTRGKLIIDMAKFKTKDDVADDELKKLLDT---------SSAD---------------------QADGTLTWRRRRAEQLRSP--------ITRQSEEQFTDGDDEILESLVKTATKAPGTRTTPRERKRTRHADRKSLRRTLKNGLTEE 1732          

HSP 2 Score: 251.136 bits (640), Expect = 2.526e-67
Identity = 143/328 (43.60%), Postives = 223/328 (67.99%), Query Frame = 2
Query:  206 PPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 1189
            PP ++++A +Q+ K  D    YG +LD + ++ EQ E+++G   S    +++RT+L++RV+A+I+K+ +A G +LRRALFSLKQ+FQ+DKDLV  FVA  GL CL ++G+ +DQN+QNYILRALGQ+MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FY+ +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct:  411 PPRRIDDAAIQVYKDGD----YGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 717          
BLAST of Formin-like protein 15 vs. Ensembl Fly
Match: Fhos (gene:FBgn0266084 transcript:FBtr0302086)

HSP 1 Score: 281.952 bits (720), Expect = 1.267e-77
Identity = 167/399 (41.85%), Postives = 248/399 (62.16%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAG-PKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDI 3175
            G +   K K+T +L WK     +    +G TIW ++ + + D ++ E LFE++  D    K+ E    K++ VLD KRSNAINI +  L     +K AIL M ++V+ REG++KLL  MLPT EE   I+ AQ++N +  LG AE++LL L  I+ LE RL++W F+LD +  E++I EPLMDLK GI+ +  + T   +LST+L +G FLN   V  F +EYL KVPEVKDT HKHSLL+H+  +V+     T+DL+SE+  + R  + D+ +LA  L++LE +    W+ LKLI K D       ++L +F  D ++RI+ ++I++RRV+ +Y   L +LG P     E     FC+ LS+FA+EYRTTRE++ Q   KK   ++R +TRG +I D+
Sbjct:  883 GNNTIKKNKKTVKLFWKEVREDMIPQVVGKTIWDELPDANVDTQKLEHLFESRAKDLMTKKQQELNKSKEIIVLDHKRSNAINIAITKLPPPRAIKTAILKMDATVVTREGIDKLL-NMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEKEIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVHKHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKLIAKHDCPPPLK-QKLVDFLADCAERIIILQIVHRRVMNRYRKFLLWLGMPQHSVAESRPNEFCRTLSEFALEYRTTRERVQQQLEKKANHRERNKTRGKLIIDM 1279          

HSP 2 Score: 273.092 bits (697), Expect = 1.083e-74
Identity = 158/382 (41.36%), Postives = 245/382 (64.14%), Query Frame = 2
Query:   44 DDMENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK 1189
            D++  F+ +  Y  D DP S  +  P P   P Y F     + N L  I  +L+ P  +++A +Q+ K  D    YG +LD + ++ EQ E+++G   S    +++RT+L++RV+A+I+K+ +A G +LRRALFSLKQ+FQ+DKDLV  FVA  GL CL ++G+ +DQN+QNYILRALGQ+MLYVDGMNGV++   T++WLYSL+   +R VVK ALKLL+VF+EYA   E +   ++++I+      G  PWS ++++L D +  D+ELV YA + INK L+ + DQD+FY+ +D LE+Q ME++ +  ++K   D+D++ Q ++YE  L+ EDGE      ++G R LP+       +  RK++R R      E  +S++
Sbjct:    8 DELITFRVQ--YLVDSDPLSACTAFPIPVRAPTYAFATTMPLANQLGTILRLLNAPQSIDDAAIQVYKDGD----YGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLLSAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILRALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYA---ESNCYVLVSAIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLEQQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGE------SDGQR-LPQ-------NSMRKTQRYRPGANTTERRKSRR 366          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod3b (formin homology 2 domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-081028-61])

HSP 1 Score: 314.309 bits (804), Expect = 4.310e-97
Identity = 161/330 (48.79%), Postives = 236/330 (71.52%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYE 1027
            M  F C++ + +D DPF++T+  PEPT  P++ F +D  + N +  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+ E G  G    ++LRT+LS+RV A I+K+ N+ G+ELRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNG++  +ET++WLY+L+  KFRLVVK A+KLL+VF+EY    E +A  +I ++N    K G KPWS  ++IL + +  D+EL+ YA+T INK L+ +PDQD+FY+V D LEEQ ME++ +  +++   D+D+++QF IYE
Sbjct:    1 MATFACRVQFLDDTDPFNSTN-FPEPTRPPHFTFREDIPLINQIAGVHRLLKAPHKLDDCALQL-------SHNGSYLDLESTLAEQKDELEGFQEDGGRGKKHSIVLRTQLSVRVHACIEKLYNSTGRELRRALFSLKQIFQDDKDLVHEFVMAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGLIGHNETVQWLYTLVGSKFRLVVKTAMKLLLVFVEYT---ESNAPLLIQAVNSVDTKQGSKPWSNAMEILDEKDGMDTELLVYAMTLINKTLAGLPDQDSFYDVVDSLEEQNMEAVAQRHISRKGTDLDLVEQFNIYE 319          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod3a (formin homology 2 domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-633])

HSP 1 Score: 321.627 bits (823), Expect = 8.299e-91
Identity = 166/336 (49.40%), Postives = 239/336 (71.13%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEK 1057
            M +F C++ + +D DPF++T+  PEPT  P Y F +D  V N +  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+       VILRT+LS+RV A I+K+ N+NG++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +E+I+WLY L+  KFRLVVK +LKLL+VF+EY+   E +A+ +I +I+    K G K WS  ++IL + +  D+EL+ Y +T INK L+ +PDQD+FY++ D LEEQ MES+++  L +   D+D+++Q  IYE  LR EDG++
Sbjct:    1 MSSFVCRVQFLDDTDPFNSTN-FPEPTRPPVYTFREDIPVINQIAGVHRLLKAPHKLDDCALQL-------SHNGVYLDLESTLDEQRDELEGFQRGKKHSVILRTQLSVRVHACIEKLYNSNGRDLRRALFSLKQIFQDDKDLVHEFVMAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVIGHNESIQWLYQLIGSKFRLVVKTSLKLLLVFVEYS---ESNAALLIQAIDTVDNKRGCKSWSNAMEILAEKDGVDTELLVYVMTLINKTLAALPDQDSFYDMVDVLEEQGMESVSQRYLGRKGTDLDLLEQLNIYEATLRHEDGDE 325          

HSP 2 Score: 300.056 bits (767), Expect = 1.515e-83
Identity = 172/402 (42.79%), Postives = 259/402 (64.43%), Query Frame = 2
Query: 2003 FNKQKRTTRLHWKTFGPQ----VSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINS 3181
            F K+K+T RL W    P      ++     ++WS+++ V  D  + E LFE+K  +    KK  A  K+ E  VLD KRSN+INIG+  L     +K AI+N     +N+EG+EK+L TM+PT EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E  E+++ EPL DLK G+ ++  ++TL Y+LST+L +GNFLN +N   F L YL+KVPEVKDT HK SLL+HV S V+     TTDL+SE+ A+ R  +VD+E+L   L  +E+    SW+HLK+I K +       +++ +F  + ++RI+ +KI++RR++ +++  L +LG P    +EI++  F KI+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD+N+
Sbjct:  751 FQKKKKTIRLFWSEVQPADWIYRNHKRSQESLWSRLEPVKIDTAKLEHLFESKSKEMPVAKKAAADGKRPEIIVLDSKRSNSINIGLTVLPPPRTIKTAIVNFDEYALNKEGIEKIL-TMIPTAEETQRIQEAQLANPDVPLGSAEQFLLTLSSISELSARLQLWAFKLDYEATEKEVAEPLQDLKEGMDQLEKNKTLRYILSTLLAIGNFLNGSNAKGFDLNYLEKVPEVKDTVHKQSLLHHVCSAVLENCSDTTDLYSEIGAITRSAKVDFEQLQENLTLMERRCKASWDHLKVIAKHEMKPVLK-QKMSDFLKECAERIIILKIVHRRIMNRFHSFLLFLGQPAYSVREISVTRFSKIISEFALEYRTTRERVLQQKQKRADHRERNKTRGKMITDVNT 1150          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod3a (formin homology 2 domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-633])

HSP 1 Score: 318.931 bits (816), Expect = 6.243e-90
Identity = 167/342 (48.83%), Postives = 241/342 (70.47%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG------VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEK 1057
            M +F C++ + +D DPF++T+  PEPT  P Y F +D  V N +  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G      VILRT+LS+RV A I+K+ N+NG++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +E+I+WLY L+  KFRLVVK +LKLL+VF+EY+   E +A+ +I +I+    K G K WS  ++IL + +  D+EL+ Y +T INK L+ +PDQD+FY++ D LEEQ MES+++  L +   D+D+++Q  IYE  LR EDG++
Sbjct:    1 MSSFVCRVQFLDDTDPFNSTN-FPEPTRPPVYTFREDIPVINQIAGVHRLLKAPHKLDDCALQL-------SHNGVYLDLESTLDEQRDELEGFQQDDCAGRGKKHSVILRTQLSVRVHACIEKLYNSNGRDLRRALFSLKQIFQDDKDLVHEFVMAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVIGHNESIQWLYQLIGSKFRLVVKTSLKLLLVFVEYS---ESNAALLIQAIDTVDNKRGCKSWSNAMEILAEKDGVDTELLVYVMTLINKTLAALPDQDSFYDMVDVLEEQGMESVSQRYLGRKGTDLDLLEQLNIYEATLRHEDGDE 331          

HSP 2 Score: 300.056 bits (767), Expect = 1.552e-83
Identity = 172/402 (42.79%), Postives = 259/402 (64.43%), Query Frame = 2
Query: 2003 FNKQKRTTRLHWKTFGPQ----VSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINS 3181
            F K+K+T RL W    P      ++     ++WS+++ V  D  + E LFE+K  +    KK  A  K+ E  VLD KRSN+INIG+  L     +K AI+N     +N+EG+EK+L TM+PT EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E  E+++ EPL DLK G+ ++  ++TL Y+LST+L +GNFLN +N   F L YL+KVPEVKDT HK SLL+HV S V+     TTDL+SE+ A+ R  +VD+E+L   L  +E+    SW+HLK+I K +       +++ +F  + ++RI+ +KI++RR++ +++  L +LG P    +EI++  F KI+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD+N+
Sbjct:  746 FQKKKKTIRLFWSEVQPADWIYRNHKRSQESLWSRLEPVKIDTAKLEHLFESKSKEMPVAKKAAADGKRPEIIVLDSKRSNSINIGLTVLPPPRTIKTAIVNFDEYALNKEGIEKIL-TMIPTAEETQRIQEAQLANPDVPLGSAEQFLLTLSSISELSARLQLWAFKLDYEATEKEVAEPLQDLKEGMDQLEKNKTLRYILSTLLAIGNFLNGSNAKGFDLNYLEKVPEVKDTVHKQSLLHHVCSAVLENCSDTTDLYSEIGAITRSAKVDFEQLQENLTLMERRCKASWDHLKVIAKHEMKPVLK-QKMSDFLKECAERIIILKIVHRRIMNRFHSFLLFLGQPAYSVREISVTRFSKIISEFALEYRTTRERVLQQKQKRADHRERNKTRGKMITDVNT 1145          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod3b (formin homology 2 domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-081028-61])

HSP 1 Score: 307.76 bits (787), Expect = 1.153e-88
Identity = 175/399 (43.86%), Postives = 263/399 (65.91%), Query Frame = 2
Query: 2003 FNKQKRTTRLHWKTFGP---QVSNGD-IGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLEV--LDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITD 3172
            F K+K+T RL W    P   Q +N      ++WSK+  +  D  + E+LFE K  +    KK  A  K+ E+  LD KRSNAINIG+  L     +K AILN     +++EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F++D + LE+++ EPL DLK G+ ++  ++TL  +LST+L +GNFLN TN   F L YL+KVPEVKDT HK SLL+HV S+VV ++P++TDL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK+I K +       +R+ +F  D + RI+ +KI++RR+I +++  L +LG PP   +E+++  F KILS+FA+EYRTTRE++LQ   K+   ++R +TRG MIT+
Sbjct:  310 FQKKKKTIRLFWNEVRPIDWQYTNHKRCKESLWSKLDPIKLDTAKLENLFETKSKELPVTKKTAADGKRQEIIILDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALSKEGIEKIL-TMIPTEEETQKIQEAQLANPDTPLGSAEQFLLILSSISELSARLQLWAFKMDYDALEKEVAEPLQDLKEGMDQLEKNKTLRSILSTLLAIGNFLNGTNAKGFELSYLEKVPEVKDTVHKQSLLHHVCSIVVEKFPESTDLYSEIGAITRSAKVDFDQLQENLCQMERRCKASWDHLKVISKHEIKPALK-QRMSDFLKDCAGRIIILKIVHRRIINRFHSFLLFLGHPPYAIREVSVHRFSKILSEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITE 706          
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Match: fhod1 (formin homology 2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-110623-4])

HSP 1 Score: 305.449 bits (781), Expect = 1.282e-88
Identity = 171/412 (41.50%), Postives = 262/412 (63.59%), Query Frame = 2
Query: 2000 GFNKQKRTTRLHWKTF----GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF----KKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIK-RLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELS 3208
             F K+++T +L WK       P+      G T+W+ +  VD D  + E LFE+K  D     K  E     + VLD KRSNAINIGM  L +I  +K+AIL      I++EG+EK+L TM PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLK G++++  ++T   +L+T+L +GNFLN +    F L YL+KV EVKDT H+ SLL+H  + VV  YP TTDL+SE+ A+ R  +V++E+L+  L +LE+    SW++LK++ K +  ++ N+K ++ EF  D ++RI+ +K+++RR+I +++  L YLG P    ++  + +FCKI+S+FA+EYRTTRE++L    K+   ++R +TRG +IT+         ELS
Sbjct:  230 AFVKKRKTVKLFWKELKQSDSPRKCKFGRG-TVWASLDKVDVDTAKLEHLFESKGKDLPVAKKGAEVKKAAISVLDPKRSNAINIGMTVLPAIHVIKSAILTFDEFAISKEGIEKIL-TMTPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLTARLQLWAFKLNYETLEKEIAEPLFDLKQGMEQLAKNKTFKRILATLLAIGNFLNSSRAKGFELGYLEKVTEVKDTVHRQSLLHHTCNFVVENYPDTTDLYSEIPAITRSAKVEFEQLSENLIQLERKCKTSWDNLKVVAKHE--TKPNLKNKMTEFLKDCTERIIILKVVHRRIINRFHSFLLYLGHPSYSVRDTKVTHFCKIISEFALEYRTTRERVLTQKRKRAVHRERTKTRGKLITETEKFSGAVTELS 637          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: rexo1 (REX1, RNA exonuclease 1 homolog [Source:Xenbase;Acc:XB-GENE-961786])

HSP 1 Score: 308.916 bits (790), Expect = 1.004e-88
Identity = 201/527 (38.14%), Postives = 311/527 (59.01%), Query Frame = 2
Query: 1997 SGFNKQKRTTRLHWKTFG-PQ-VSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKK--LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIK-RLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSN-RTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMR 3556
            +   K+++T +L W+    P+  S G  G  T+W  +  V  D E+ E LFE+K  +     A  KK  L +LD KRSNAINIG+  L +++ +K AI+N     I +EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E++I EPL DLKLG++++  ++T   +L+++L +GNFLN +N   F L YL+KV EVKDT H+ SLL+H+ +LV+ +YP T+DL+SE++A+ R  +VD++ELA  L +LEK   +SW  LK+I K +  ++  +K ++ EF    +++I+ +KI+YRR++ ++   L YLG+    A++  I  FCK++S+FA+EYRTTRE+ LQ   K+   ++R +TRG MIT+     + S    S  N+L +   SR  L N   +    ++ N        Q  T +S   R++ R           S P IS     T    +D SD+++D L Q  T    +    R+   +ERK  R
Sbjct:  349 TALTKKRKTVKLFWREMKEPENTSRGKFGKGTLWDSLDKVSLDTEKLEHLFESKAKEL----AASKKQYLVLLDPKRSNAINIGLTVLPTVNIIKTAIMNFDEYAITKEGIEKIL-TMVPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLSSRLQLWAFKLDYETMEKEISEPLFDLKLGMEQLSKNKTFKVILASLLAVGNFLNSSNAKGFDLGYLEKVSEVKDTVHRQSLLHHMCNLVIEKYPDTSDLYSEIAAITRSSKVDFDELADTLIQLEKRCRESWESLKVIAKHE--TKPGLKNKMTEFLKSCTEKIVILKIVYRRILNRFRSFLLYLGYTYSSARDTKITRFCKVISEFALEYRTTRERALQQKQKRAAYRERNKTRGRMITETA---KFSSAAGSVENNLTSATSSR--LQNQTSEEGHENMTNLLISAGENQ--TRRSRGVRSLGR----------CSPPEISATKEDTGSSPVDASDEIMDRLVQSVT----QNPNPRVVAPKERKRSR 847          

HSP 2 Score: 133.65 bits (335), Expect = 4.870e-31
Identity = 76/154 (49.35%), Postives = 106/154 (68.83%), Query Frame = 2
Query:  587 MLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIED 1048
            ML+VDGMNGV+  +ETI+WLY+L    +RLVVK ALKLL+VF+EYA   E++A  +I ++N    + G  PWS +I IL +    DSEL+ + +T INK LS +PDQD+FY+VTD LE+Q ME I +  +N    D D+ ++  +YE AL+ ED
Sbjct:    1 MLFVDGMNGVINHNETIQWLYTLCGSPYRLVVKTALKLLIVFVEYA---EVNAPLLIKAVNTVDNRRGKYPWSNLIDILEEKNGADSELLVFTMTLINKTLSALPDQDSFYDVTDCLEQQGMEKIIQRHMNNKATDPDLKRKLVLYESALKQED 151          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: rexo1 (REX1, RNA exonuclease 1 homolog [Source:Xenbase;Acc:XB-GENE-961786])

HSP 1 Score: 309.301 bits (791), Expect = 1.043e-88
Identity = 198/527 (37.57%), Postives = 311/527 (59.01%), Query Frame = 2
Query: 1997 SGFNKQKRTTRLHWKTFG-PQ-VSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKK--LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIK-RLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSR-KNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMR 3556
            +   K+++T +L W+    P+  S G  G  T+W  +  V  D E+ E LFE+K  +     A  KK  L +LD KRSNAINIG+  L +++ +K AI+N     I +EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E++I EPL DLKLG++++  ++T   +L+++L +GNFLN +N   F L YL+KV EVKDT H+ SLL+H+ +LV+ +YP T+DL+SE++A+ R  +VD++ELA  L +LEK   +SW  LK+I K +  ++  +K ++ EF    +++I+ +KI+YRR++ ++   L YLG+    A++  I  FCK++S+FA+EYRTTRE+ LQ   K+   ++R +TRG MIT+     + S    S  N+L +   SR +N  + +   +  +L        + +    +S  R  P P  S    +  SSP             +D SD+++D L Q  T    +    R+   +ERK  R
Sbjct:  361 TALTKKRKTVKLFWREMKEPENTSRGKFGKGTLWDSLDKVSLDTEKLEHLFESKAKEL----AASKKQYLVLLDPKRSNAINIGLTVLPTVNIIKTAIMNFDEYAITKEGIEKIL-TMVPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLSSRLQLWAFKLDYETMEKEISEPLFDLKLGMEQLSKNKTFKVILASLLAVGNFLNSSNAKGFDLGYLEKVSEVKDTVHRQSLLHHMCNLVIEKYPDTSDLYSEIAAITRSSKVDFDELADTLIQLEKRCRESWESLKVIAKHE--TKPGLKNKMTEFLKSCTEKIVILKIVYRRILNRFRSFLLYLGYTYSSARDTKITRFCKVISEFALEYRTTRERALQQKQKRAAYRERNKTRGRMITETA---KFSSAAGSVENNLTSATSSRLQNQTSEEGHENMTNLLISAGENQTRRSRGVRSLGRCSP-PEISATKEDTGSSP-------------VDASDEIMDRLVQSVT----QNPNPRVVAPKERKRSR 859          

HSP 2 Score: 213.772 bits (543), Expect = 1.910e-56
Identity = 117/238 (49.16%), Postives = 163/238 (68.49%), Query Frame = 2
Query:  398 DKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSE 1111
            +K+ N+NG ELRR+LFSLKQ+FQ+DKDLV EFV   GL CL ++G+++DQN+QNYILRAL Q+ML+VDGMNGV+  +ETI+WLY+L    +RLVVK ALKLL+VF+EYA   E++A  +I ++N    + G  PWS +I IL +    DSEL+ + +T INK LS +PDQD+FY+VTD LE+Q ME I +  +N    D D+ ++  ++    R    E       E I +L + + E
Sbjct:   25 EKLYNSNGPELRRSLFSLKQLFQEDKDLVPEFVNSEGLTCLIKVGAEADQNYQNYILRALSQIMLFVDGMNGVINHNETIQWLYTLCGSPYRLVVKTALKLLIVFVEYA---EVNAPLLIKAVNTVDNRRGKYPWSNLIDILEEKNGADSELLVFTMTLINKTLSALPDQDSFYDVTDCLEQQGMEKIIQRHMNNKATDPDLKRKLVLFSFTCRSRFLENLAATELEKISALSKGRQE 259          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: FHOD3 (formin-like 3 [Source:NCBI gene;Acc:100491411])

HSP 1 Score: 301.597 bits (771), Expect = 3.545e-88
Identity = 172/401 (42.89%), Postives = 261/401 (65.09%), Query Frame = 2
Query: 2003 FNKQKRTTRLHWKTFGP----QVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLEV--LDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDIN 3178
            FNK+K+T RL W    P       +      +WSK++ ++ D  + E LFE+K  D    KK     KK EV  LD KRSNAINIG+  L     +K AILN     +N+EG++K+L TM+PT+EE   I+ AQ+ + D  LG AE++LL L  I+ L  RL +W F++D E +E++I EPL DLK G+ ++ +++T  Y+LST+L  GNFLN TN  AF L YLQKVPEVKDT  K  LLYH+ +++V ++P++TDL+SE+ ++ R  +VD+ +L   L  LEK    SW++LK+I K +  S    +++ EF  + ++RI+ +KI++RR+I +++  L ++G PP    E+NI+ FCK +++FA+EYRT+R+++LQ   K    K+R +TRG +ITD++
Sbjct:  206 FNKKKKTIRLFWNEVRPFQLQPFHHSRYRDCMWSKLEPINLDTSKLEYLFESKSKDLPVTKKTAGDGKKQEVIVLDSKRSNAINIGLTVLPPPRTIKMAILNFDEYALNKEGIDKIL-TMIPTEEEKQKIQEAQLASPDIPLGSAEQFLLTLSSISELSARLHLWAFKMDYELMEKEITEPLYDLKEGMNQLENNKTFAYILSTLLATGNFLNGTNAKAFDLSYLQKVPEVKDTVQKQPLLYHMCTIIVEKFPESTDLYSEIGSITRSSKVDFNQLHDNLSNLEKRCKASWDYLKIIAKHEMKSALK-QKMSEFLKECAERIIILKIVHRRIINRFHSFLLFMGQPPHSIHEVNIQKFCKNITEFALEYRTSRDRVLQQKQKWADHKERNKTRGKLITDVS 604          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: rexo1 (REX1, RNA exonuclease 1 homolog [Source:Xenbase;Acc:XB-GENE-961786])

HSP 1 Score: 306.99 bits (785), Expect = 6.659e-87
Identity = 196/530 (36.98%), Postives = 306/530 (57.74%), Query Frame = 2
Query: 2000 GFNKQKRTTRLHWKTFG-PQ-VSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDF-------KKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIK-RLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMR 3556
               K+++T +L W+    P+  S G  G  T+W  +  V  D E+ E LFE+K  +        K  +A  + L +LD KRSNAINIG+  L +++ +K AI+N     I +EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E++I EPL DLKLG++++  ++T   +L+++L +GNFLN +N   F L YL+KV EVKDT H+ SLL+H+ +LV+ +YP T+DL+SE++A+ R  +VD++ELA  L +LEK   +SW  LK+I K +  ++  +K ++ EF    +++I+ +KI+YRR++ ++   L YLG+    A++  I  FCK++S+FA+EYRTTRE+ LQ   K+   ++R +TRG MIT+     + S    S  N+L +   SR  L N   +    ++ N        Q    +        P  S    +  SSP             +D SD+++D L Q  T    +    R+   +ERK  R
Sbjct:  491 SLTKKRKTVKLFWREMKEPENTSRGKFGKGTLWDSLDKVSLDTEKLEHLFESKAKELPFTLCLQKGTDAKKQYLVLLDPKRSNAINIGLTVLPTVNIIKTAIMNFDEYAITKEGIEKIL-TMVPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLSSRLQLWAFKLDYETMEKEISEPLFDLKLGMEQLSKNKTFKVILASLLAVGNFLNSSNAKGFDLGYLEKVSEVKDTVHRQSLLHHMCNLVIEKYPDTSDLYSEIAAITRSSKVDFDELADTLIQLEKRCRESWESLKVIAKHE--TKPGLKNKMTEFLKSCTEKIVILKIVYRRILNRFRSFLLYLGYTYSSARDTKITRFCKVISEFALEYRTTRERALQQKQKRAAYRERNKTRGRMITETA---KFSSAAGSVENNLTSATSSR--LQNQTSEEGHENMTNLLISAGENQTRRSRGVRSRCSPPEISATKEDTGSSP-------------VDASDEIMDRLVQSVT----QNPNPRVVAPKERKRSR 995          

HSP 2 Score: 283.493 bits (724), Expect = 6.978e-79
Identity = 174/419 (41.53%), Postives = 262/419 (62.53%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGP-RKSKRIRV----NETKNESHRSQKLVIEDQ----RKKNDKNFQKIEIIPKKNES 1267
            M   +C++ Y +D+DPF  T+  PEP   P + F ++  + + L  I+++L  P KLE+  LQL       T  G +LD +L++ EQ + L+ + +  + G    +ILRT+LS+RV ++++K+ N+NG ELRR+LFSLKQ+FQ+DKDLV EFV   GL CL ++G+++DQN+QNYILRAL Q+ML+VDGMNGV+  +ETI+WLY+L    +RLVVK ALKLL+VF+EYA   E++A  +I ++N    + G  PWS +I IL +    DSEL+ + +T INK LS +PDQD+FY+VTD LE+Q ME I +  +N    D D+ ++  +YE             V NE ++S PR +      GP  +++ +++    N T   +  S++ V+  Q     + N KN +K  +IP K  S
Sbjct:   16 MATLQCRVQYLDDMDPFICTN-FPEPRRPPVHSFSENTPLLDQLPAIHKLLEAPLKLEDCTLQL-------TTNGNYLDIELSLAEQRDYLEAFYDDISKGRRPTLILRTQLSVRVHSILEKLYNSNGPELRRSLFSLKQLFQEDKDLVPEFVNSEGLTCLIKVGAEADQNYQNYILRALSQIMLFVDGMNGVINHNETIQWLYTLCGSPYRLVVKTALKLLIVFVEYA---EVNAPLLIKAVNTVDNRRGKYPWSNLIDILEEKNGADSELLVFTMTLINKTLSALPDQDSFYDVTDCLEQQGMEKIIQRHMNNKATDPDLKRKLVLYEN-----------IVSNEVLKS-PRERM-----GPIFRTEEVQIENSPNTTIENTAESRRTVMRAQYSIDAETNAKNLEKTLMIPFKKSS 406          
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Match: rexo1 (REX1, RNA exonuclease 1 homolog [Source:Xenbase;Acc:XB-GENE-961786])

HSP 1 Score: 304.679 bits (779), Expect = 2.542e-86
Identity = 197/526 (37.45%), Postives = 305/526 (57.98%), Query Frame = 2
Query: 1997 SGFNKQKRTTRLHWKTFG-PQ-VSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKK--LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIK-RLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMR 3556
            +   K+++T +L W+    P+  S G  G  T+W  +  V  D E+ E LFE+K  +     A  KK  L +LD KRSNAINIG+  L +++ +K AI+N     I +EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E++I EPL DLKLG++++  ++T   +L+++L +GNFLN +N   F L YL+KV EVKDT H+ SLL+H+ +LV+ +YP T+DL+SE++A+ R  +VD++ELA  L +LEK   +SW  LK+I K +  ++  +K ++ EF    +++I+ +KI+YRR++ ++   L YLG+    A++  I  FCK++S+FA+EYRTTRE+ LQ   K+   ++R +TRG MIT+     + S    S  N+L +   SR  L N   +               T        N+T        ++      P IS     T    +D SD+++D L Q  T +       R+   +ERK  R
Sbjct:  465 TALTKKRKTVKLFWREMKEPENTSRGKFGKGTLWDSLDKVSLDTEKLEHLFESKAKEL----AASKKQYLVLLDPKRSNAINIGLTVLPTVNIIKTAIMNFDEYAITKEGIEKIL-TMVPTEEEKQKIQEAQLANPDVPLGTAEQFLLTLSSISGLSSRLQLWAFKLDYETMEKEISEPLFDLKLGMEQLSKNKTFKVILASLLAVGNFLNSSNAKGFDLGYLEKVSEVKDTVHRQSLLHHMCNLVIEKYPDTSDLYSEIAAITRSSKVDFDELADTLIQLEKRCRESWESLKVIAKHE--TKPGLKNKMTEFLKSCTEKIVILKIVYRRILNRFRSFLLYLGYTYSSARDTKITRFCKVISEFALEYRTTRERALQQKQKRAAYRERNKTRGRMITETA---KFSSAAGSVENNLTSATSSR--LQNQTSEEG---------HENMTNLLISAGENQTRRSRGVRSKIFLGLVPPEISATKEDTGSSPVDASDEIMDRLVQSVTQN----PNPRVVAPKERKRSR 965          

HSP 2 Score: 279.256 bits (713), Expect = 1.394e-77
Identity = 158/365 (43.29%), Postives = 235/365 (64.38%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPR 1132
            M   +C++ Y +D+DPF  T+  PEP   P + F ++  + + L  I+++L  P KLE+  LQL       T  G +LD +L++ EQ + L+ + +  + G    +ILRT+LS+RV ++++K+ N+NG ELRR+LFSLKQ+FQ+DKDLV EFV   GL CL ++G+++DQN+QNYILRAL Q+ML+VDGMNGV+  +ETI+WLY+L    +RLVVK ALKLL+VF+EYA   E++A  +I ++N    + G  PWS +I IL +    DSEL+ + +T INK LS +PDQD+FY+VTD LE+Q ME I +  +N    D D+ ++  ++    R    E       E I +L + + E   +  R
Sbjct:   14 MATLQCRVQYLDDMDPFICTN-FPEPRRPPVHSFSENTPLLDQLPAIHKLLEAPLKLEDCTLQL-------TTNGNYLDIELSLAEQRDYLEAFYDDISKGRRPTLILRTQLSVRVHSILEKLYNSNGPELRRSLFSLKQLFQEDKDLVPEFVNSEGLTCLIKVGAEADQNYQNYILRALSQIMLFVDGMNGVINHNETIQWLYTLCGSPYRLVVKTALKLLIVFVEYA---EVNAPLLIKAVNTVDNRRGKYPWSNLIDILEEKNGADSELLVFTMTLINKTLSALPDQDSFYDVTDCLEQQGMEKIIQRHMNNKATDPDLKRKLVLFSFTCRSRFLENLAATELEKISALSKGRQEVLAEAVR 367          
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Match: Fhod3 (formin homology 2 domain containing 3 [Source:MGI Symbol;Acc:MGI:1925847])

HSP 1 Score: 321.242 bits (822), Expect = 6.505e-90
Identity = 170/355 (47.89%), Postives = 246/355 (69.30%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRA 1102
            M    C++ + +D DPF++T+  PEP+  P + F +D  +   L  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  SETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I +++    K G KPWS +++IL + +  D+EL+ YA+T +NK L+ +PDQDTFY+V D LEE  + ++++  LNK   D+D+++QF IYE ALR EDG++       G R   RA
Sbjct:    1 MATLACRVQFLDDTDPFNSTN-FPEPSRPPLFTFREDLALGTQLAGVHRLLRAPHKLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRDRRRA 344          

HSP 2 Score: 320.472 bits (820), Expect = 1.380e-89
Identity = 183/421 (43.47%), Postives = 270/421 (64.13%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHW---KTF-GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDL 3226
            G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L
Sbjct: 1007 GQPAFTKKKKTIRLFWNEVRPFEWPSKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVTKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPEVPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAAPSQPQGL 1425          
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Match: Fhod3 (formin homology 2 domain containing 3 [Source:MGI Symbol;Acc:MGI:1925847])

HSP 1 Score: 320.472 bits (820), Expect = 6.912e-90
Identity = 170/355 (47.89%), Postives = 246/355 (69.30%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRA 1102
            M    C++ + +D DPF++T+  PEP+  P + F +D  +   L  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  SETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I +++    K G KPWS +++IL + +  D+EL+ YA+T +NK L+ +PDQDTFY+V D LEE  + ++++  LNK   D+D+++QF IYE ALR EDG++       G R   RA
Sbjct:    1 MATLACRVQFLDDTDPFNSTN-FPEPSRPPLFTFREDLALGTQLAGVHRLLRAPHKLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRDRRRA 344          

HSP 2 Score: 320.472 bits (820), Expect = 8.321e-90
Identity = 205/535 (38.32%), Postives = 312/535 (58.32%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHW---KTF-GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT--RRLAGTRERKSMRRT 3562
            G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L                 D     N +A   ++ P  E ++     R  S     + +S    +  +P+ ++   D +D+++D + + AT    +R     R      RKS+RRT
Sbjct:  888 GQPAFTKKKKTIRLFWNEVRPFEWPSKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVTKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPEVPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAAPSQPQGLSYA-------------EDAAEHENMKAVLKTSSPALEDATPVLGVRTRSRASRGSTSSWTMGTEESPSVTD---DAADEIMDRIVKSATQVPSQRVVPRERKRSRANRKSLRRT 1404          
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Match: Fhod3 (formin homology 2 domain containing 3 [Source:MGI Symbol;Acc:MGI:1925847])

HSP 1 Score: 321.242 bits (822), Expect = 8.297e-90
Identity = 170/355 (47.89%), Postives = 246/355 (69.30%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRA 1102
            M    C++ + +D DPF++T+  PEP+  P + F +D  +   L  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  SETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I +++    K G KPWS +++IL + +  D+EL+ YA+T +NK L+ +PDQDTFY+V D LEE  + ++++  LNK   D+D+++QF IYE ALR EDG++       G R   RA
Sbjct:    1 MATLACRVQFLDDTDPFNSTN-FPEPSRPPLFTFREDLALGTQLAGVHRLLRAPHKLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRDRRRA 344          

HSP 2 Score: 320.087 bits (819), Expect = 1.924e-89
Identity = 183/421 (43.47%), Postives = 270/421 (64.13%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHW---KTF-GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDL 3226
            G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L
Sbjct: 1039 GQPAFTKKKKTIRLFWNEVRPFEWPSKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVTKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPEVPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAAPSQPQGL 1457          
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Match: Fhod1 (formin homology 2 domain containing 1 [Source:MGI Symbol;Acc:MGI:2679008])

HSP 1 Score: 306.605 bits (784), Expect = 5.641e-86
Identity = 202/553 (36.53%), Postives = 312/553 (56.42%), Query Frame = 2
Query: 2012 QKRTTRLHWK----TFGPQVSNGDIGS--TIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLEV-LDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNP--NSSPGISNMTP---ATSELALDQSDKLLDHLAQQATSSNKR----RTTRRLAGTRERKSMRRT-KPNITEDIIKFLDQQK 3610
            +++T +L W+    T GP  S    G   T+W+ ++ V  D  R E LFE++  D    KK   G + + V LD KRSNAINIG+  L  +  +K A+LN     ++++G+EKLL TM+PT+EE   I+ AQ+ N D  LG AE +L+ L  I  L  RL++W F+LD E +ER+I EPL DLK+G++++  + T   +L+T+L +GNFLN +  S F L YL+KV EVKDT  + SLLYH+ SLV+   P ++DL+SE+ AL RC +VD+E+L   L +LE     + + L+ + K + S      RL  F    ++R+  +++++RRV  +++  L YLG+ P+ A+++ I  FC  L +FA+EYRT RE++LQ   K+   ++R +TRG MIT+    ++ S       N+L   +         D D+          + L T  P + + +R   R     Q  +P  +++ G S  +P   A S L  D SD+++D L Q  T S  R    R  +R  G   RKS+RRT K  + +D+++ L   K
Sbjct:  655 KRKTVKLFWRELKLTGGPGCSRSRFGPCPTLWASLEPVSVDTARLEHLFESRAKDVLPTKKAGEGRRTMTVVLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLL-TMMPTEEERQKIEEAQLANPDVPLGPAENFLMTLASIGGLAARLQLWAFKLDYESMEREIAEPLFDLKVGMEQLVHNATFRCILATLLAVGNFLNGSQSSGFELSYLEKVSEVKDTVRRQSLLYHLCSLVLQTRPDSSDLYSEIPALTRCAKVDFEQLTENLGQLECRSQAAEDSLRSLAKHELSPALR-ARLTHFLAQCTRRVAMLRVVHRRVCNRFHAFLLYLGYTPQAARDVRIMQFCHTLREFALEYRTCRERVLQQQQKRATYRERNKTRGRMITET---EKFSGVAGEAPNNLSVPVAVGSGPGQGDTDNH------ASMKSLLTSRPEDATHSR---RSRGMVQSSSPVSHTAVGPSAASPEETAASGLPTDTSDEIMDLLVQSVTKSGPRALAARERKRSRGN--RKSLRRTLKSGLGDDLVQALGLSK 1191          

HSP 2 Score: 276.174 bits (705), Expect = 7.744e-76
Identity = 151/341 (44.28%), Postives = 220/341 (64.52%), Query Frame = 2
Query:   44 DDMENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 1054
            D +     ++ Y  D DPF+  +  PEP   P         +   +  ++ +L  P KLE+  LQ+       +  G +LD +L+++EQ E L+G+ E  + G    +ILRT+LS+RV A+++K+  ++G ELRR+LFSLKQIFQ+DKDLV EFV   GL CL ++G+ +D N+Q+YILRALGQLML+VDGM GV+  SET++WLY+L     RLVVK ALKLL+VF+EY+   E +A   I ++N      G  PW+ ++ IL +    D+EL+ Y +T INK L+ +PDQD+FY+VTD LE+Q ME++ +  L  +  DVD+  Q  +YE ALR+EDG+
Sbjct:   11 DPVSVVTVRVQYLEDTDPFAC-ANFPEPRRAPTCSLDGALPLSAQIPALHRLLGAPLKLEDCALQV-------SPSGYYLDPELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYGSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSETVQWLYTLCASLSRLVVKTALKLLLVFVEYS---ENNAPLFIQAVNAVASATGTLPWANLVSILEEKNGADAELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRFLGTAGTDVDLRTQLTLYESALRLEDGD 340          
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Match: Fmnl1 (formin-like 1 [Source:MGI Symbol;Acc:MGI:1888994])

HSP 1 Score: 63.1586 bits (152), Expect = 2.616e-9
Identity = 89/381 (23.36%), Postives = 159/381 (41.73%), Query Frame = 2
Query: 2018 RTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHD---------FKKHEAGPKKLEVLDVKRSNAINIGM-KNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQ-LGQAEKYLLDLHEINLLEERLEVWLFQ---LDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSA---FSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQ 3109
            R   L+W    P    G + + +  +    + D   FE  F+ K             K  +  P K  +++  R+  + I + K  +  D +  AI       ++ + +E LL   LPT  E   I   +   +  + L + ++++L    I  L ER+    F     D+ QL    L  ++   + IK    S+ L  +L  +L  GN++N +   A   F L+ L  + E+K T  K +LL+++V ++  +YP+ T  HS+L  L++   V        LD +  D+      L+L  + +   Q++   LKEF    S  + K+    +     Y  V+ Y G  PK     +   F  + S F   Y+   +++ Q
Sbjct:  642 RMPLLNWVALKPSQITGTVFTELNDEKVLQELDMNDFEEHFKTKSQGPCLDISALKGKASQKAPTKTILIEANRAKNLAITLRKGNLGADRICQAIETYDLQTLSLDFLE-LLTRFLPTDYERSLIARFEKEQRPMEELSEEDRFMLRFSRIQRLPERMNTLTFLGNFPDTAQLLMPQLNAIIAASMSIK---SSDKLRQILEIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVS-------LDSVLGDVRSLQRGLELT-QREFVRQDDCLVLKEFLRANSPTMDKLLADSKTAQEAYESVVEYFGENPKTT---SPSMFFSLFSRFTKAYKKAEQEVEQ 1007          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q2V2M9|FHOD3_HUMAN (FH1/FH2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FHOD3 PE=1 SV=2)

HSP 1 Score: 320.472 bits (820), Expect = 4.817e-89
Identity = 169/355 (47.61%), Postives = 244/355 (68.73%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRA 1102
            M    C++ + +D DPF++T+  PEP+  P + F +D  +   L  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  +ETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I ++     K G KPWS +++IL + +  D+EL+ YA+T +NK LS +PDQDTFY+V D LEE  + ++++  LNK   D+D+++Q  IYE ALR EDG++       G R   RA
Sbjct:    1 MATLACRVQFLDDTDPFNSTN-FPEPSRPPLFTFREDLALGTQLAGVHRLLQAPHKLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRA 344          

HSP 2 Score: 318.546 bits (815), Expect = 2.048e-88
Identity = 211/561 (37.61%), Postives = 316/561 (56.33%), Query Frame = 2
Query: 1934 PPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHW---KTFG-PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSN----RT---IPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTT--RRLAGTRERKSMRRT 3562
            PP P   +           G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L                 D     N +A   ++ P  E ++     RT     R S+S      + SP +++          D +D+++D + + AT    +R     R      RKS+RRT
Sbjct:  864 PPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGLSYA-------------EDAAEHENMKAVLKTSSPSVEDATPALGVRTRSRASRGSTSSWTMGTDDSPNVTD----------DAADEIMDRIVKSATQVPSQRVVPRERKRSRANRKSLRRT 1399          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q76LL6|FHOD3_MOUSE (FH1/FH2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fhod3 PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 5.803e-89
Identity = 170/355 (47.89%), Postives = 246/355 (69.30%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRA 1102
            M    C++ + +D DPF++T+  PEP+  P + F +D  +   L  ++ +L  PHKL++  LQL       +  G +LD + T+ EQ ++L+G+ +    G    +ILRT+LS+RV A I+K+ N++G++LRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+QNYILRALGQ+MLYVDGMNGV+  SETI+WLY+L+  KFRLVVK ALKLL+VF+EY+   E +A  +I +++    K G KPWS +++IL + +  D+EL+ YA+T +NK L+ +PDQDTFY+V D LEE  + ++++  LNK   D+D+++QF IYE ALR EDG++       G R   RA
Sbjct:    1 MATLACRVQFLDDTDPFNSTN-FPEPSRPPLFTFREDLALGTQLAGVHRLLRAPHKLDDCTLQL-------SHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYS---ESNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRDRRRA 344          

HSP 2 Score: 320.087 bits (819), Expect = 1.346e-88
Identity = 183/421 (43.47%), Postives = 270/421 (64.13%), Query Frame = 2
Query: 1991 GVSGFNKQKRTTRLHW---KTF-GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDL 3226
            G   F K+K+T RL W   + F  P  +N      +WSK++ +  D  R E LFE+K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N +  LG AE++LL L  I+ L  RL +W F++D E  E+++ EPL+DLK GI ++ +++TL ++LST+L +GNFLN TN  AF L YL+KVPEVKDT HK SLL+HV ++VV  +P ++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK I K +       +R+ EF  D ++RI+ +KI++RR+I +++  L ++G PP   +E+NI  FC+I+S+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S    S+   L
Sbjct: 1039 GQPAFTKKKKTIRLFWNEVRPFEWPSKNNRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVTKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPEVPLGSAEQFLLTLSSISELSARLHLWAFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLK-QRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDSGKFSGSSPAAPSQPQGL 1457          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q6P9Q4|FHOD1_MOUSE (FH1/FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhod1 PE=1 SV=3)

HSP 1 Score: 306.605 bits (784), Expect = 3.946e-85
Identity = 202/553 (36.53%), Postives = 312/553 (56.42%), Query Frame = 2
Query: 2012 QKRTTRLHWK----TFGPQVSNGDIGS--TIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLEV-LDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNP--NSSPGISNMTP---ATSELALDQSDKLLDHLAQQATSSNKR----RTTRRLAGTRERKSMRRT-KPNITEDIIKFLDQQK 3610
            +++T +L W+    T GP  S    G   T+W+ ++ V  D  R E LFE++  D    KK   G + + V LD KRSNAINIG+  L  +  +K A+LN     ++++G+EKLL TM+PT+EE   I+ AQ+ N D  LG AE +L+ L  I  L  RL++W F+LD E +ER+I EPL DLK+G++++  + T   +L+T+L +GNFLN +  S F L YL+KV EVKDT  + SLLYH+ SLV+   P ++DL+SE+ AL RC +VD+E+L   L +LE     + + L+ + K + S      RL  F    ++R+  +++++RRV  +++  L YLG+ P+ A+++ I  FC  L +FA+EYRT RE++LQ   K+   ++R +TRG MIT+    ++ S       N+L   +         D D+          + L T  P + + +R   R     Q  +P  +++ G S  +P   A S L  D SD+++D L Q  T S  R    R  +R  G   RKS+RRT K  + +D+++ L   K
Sbjct:  655 KRKTVKLFWRELKLTGGPGCSRSRFGPCPTLWASLEPVSVDTARLEHLFESRAKDVLPTKKAGEGRRTMTVVLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLL-TMMPTEEERQKIEEAQLANPDVPLGPAENFLMTLASIGGLAARLQLWAFKLDYESMEREIAEPLFDLKVGMEQLVHNATFRCILATLLAVGNFLNGSQSSGFELSYLEKVSEVKDTVRRQSLLYHLCSLVLQTRPDSSDLYSEIPALTRCAKVDFEQLTENLGQLECRSQAAEDSLRSLAKHELSPALR-ARLTHFLAQCTRRVAMLRVVHRRVCNRFHAFLLYLGYTPQAARDVRIMQFCHTLREFALEYRTCRERVLQQQQKRATYRERNKTRGRMITET---EKFSGVAGEAPNNLSVPVAVGSGPGQGDTDNH------ASMKSLLTSRPEDATHSR---RSRGMVQSSSPVSHTAVGPSAASPEETAASGLPTDTSDEIMDLLVQSVTKSGPRALAARERKRSRGN--RKSLRRTLKSGLGDDLVQALGLSK 1191          

HSP 2 Score: 276.174 bits (705), Expect = 5.417e-75
Identity = 151/341 (44.28%), Postives = 220/341 (64.52%), Query Frame = 2
Query:   44 DDMENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 1054
            D +     ++ Y  D DPF+  +  PEP   P         +   +  ++ +L  P KLE+  LQ+       +  G +LD +L+++EQ E L+G+ E  + G    +ILRT+LS+RV A+++K+  ++G ELRR+LFSLKQIFQ+DKDLV EFV   GL CL ++G+ +D N+Q+YILRALGQLML+VDGM GV+  SET++WLY+L     RLVVK ALKLL+VF+EY+   E +A   I ++N      G  PW+ ++ IL +    D+EL+ Y +T INK L+ +PDQD+FY+VTD LE+Q ME++ +  L  +  DVD+  Q  +YE ALR+EDG+
Sbjct:   11 DPVSVVTVRVQYLEDTDPFAC-ANFPEPRRAPTCSLDGALPLSAQIPALHRLLGAPLKLEDCALQV-------SPSGYYLDPELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYGSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSETVQWLYTLCASLSRLVVKTALKLLLVFVEYS---ENNAPLFIQAVNAVASATGTLPWANLVSILEEKNGADAELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRFLGTAGTDVDLRTQLTLYESALRLEDGD 340          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q9Y613|FHOD1_HUMAN (FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3)

HSP 1 Score: 302.368 bits (773), Expect = 6.429e-84
Identity = 204/561 (36.36%), Postives = 314/561 (55.97%), Query Frame = 2
Query: 1997 SGFNKQKRTTRLHWKTF----GPQVSNGDIG--STIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE-VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPAT--------SELALDQSDKLLDHLAQQATSSNKR----RTTRRLAGTRERKSMRRT-KPNITEDIIKFLDQQK 3610
            S    +++T +L W+      G  VS    G  +T+W+ +  V  D  R E LFE++  +    KK   G + +  VLD KRSNAINIG+  L  +  +K A+LN     ++++G+EKLL TM+PT+EE   I+ AQ+ N D  LG AE +L+ L  I  L  RL++W F+LD + +ER+I EPL DLK+G++++  + T   +L+T+L +GNFLN +  S F L YL+KV EVKDT  + SLL+H+ SLV+   P+++DL+SE+ AL RC +VD+E+L   L +LE+    +   L+ + K + +      RL  F    ++R+  ++I++RRV  +++  L YLG+ P+ A+E+ I  FC  L +FA+EYRT RE++LQ   K+   ++R +TRG MIT+       + E  S  N  + V +S       D DS          + L T  P + + NR       S  M   +SSP +  + P+T        S L  D SD+++D L Q  T S+ R    R  +R  G   RKS+RRT K  + +D+++ L   K
Sbjct:  618 SALPTKRKTVKLFWRELKLAGGHGVSASRFGPCATLWASLDPVSVDTARLEHLFESRAKEVLPSKKAGEGRRTMTTVLDPKRSNAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLL-TMMPTEEERQKIEEAQLANPDIPLGPAENFLMTLASIGGLAARLQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVQNATFRCILATLLAVGNFLNGSQSSGFELSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPESSDLYSEIPALTRCAKVDFEQLTENLGQLERRSRAAEESLRSLAKHELAPALR-ARLTHFLDQCARRVAMLRIVHRRVCNRFHAFLLYLGYTPQAAREVRIMQFCHTLREFALEYRTCRERVLQQQQKQATYRERNKTRGRMITETEKFSGVAGEAPS--NPSVPVAVS-SGPGRGDADSH------ASMKSLLTSRPEDTTHNR------RSRGMVQ-SSSPIMPTVGPSTASPEEPPGSSLPSDTSDEIMDLLVQSVTKSSPRALAARERKRSRGN--RKSLRRTLKSGLGDDLVQALGLSK 1158          

HSP 2 Score: 273.092 bits (697), Expect = 4.631e-74
Identity = 159/376 (42.29%), Postives = 231/376 (61.44%), Query Frame = 2
Query:   68 KICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRS 1183
            ++ Y  D DPF+  +  PEP   P         +   +  ++ +L  P KLE+  LQ+       +  G +LD +L+++EQ E L+G+ E  + G    +ILRT+LS+RV A+++K+ +++G ELRR+LFSLKQIFQ+DKDLV EFV   GL CL ++G+ +D N+Q+YILRALGQLML+VDGM GV+  S+TI+WLY+L     RLVVK ALKLL+VF+EY+   E +A   I ++N      G  PW+ ++ IL +    D EL+ Y +T INK L+ +PDQD+FY+VTD LE+Q ME++ +  L  +  DVD+  Q  +YE AL++EDG+         I   P A       G R+ +R   +E    S RS
Sbjct:   19 RVQYLEDTDPFAC-ANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCALQV-------SPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFVEYS---ENNAPLFIRAVNSVASTTGAPPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRHLGTAGTDVDLRTQLVLYENALKLEDGD---------IEEAPGA-------GGRRERRKPSSEEGKRSRRS 367          
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Match: sp|Q1ZXK2|FORG_DICDI (Formin-G OS=Dictyostelium discoideum OX=44689 GN=forG PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.866e-26
Identity = 95/375 (25.33%), Postives = 200/375 (53.33%), Query Frame = 2
Query: 2030 LHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENK-----------PHDFKKHEAGPKKL-EVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLN----ETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASK-RIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKI 3103
            L+WK      SN +   +IW ++    FD + FE+LF  K           P      E    KL  ++D+K+SN+I   +  + + + +K AI  + +S++ +E ++ L+ T +PT+++   IK ++I+  +++L + E+++L+++   +++ERL  WLFQL+ +++  +I++ L  L+  IK+   S++L  +L  +L LGN++N          F+LE L  +   KD ++K SLL +V  + + +YPKT ++  EL +L +  ++   +++  ++ LEK  N S N+ K + +++  S    +     F++ ++  I  +K   + ++  +  ++ + G+P   A   + + F   +  F++ +    +KI
Sbjct:  644 LYWKRIILPPSNRN--ESIWDQVLEPTFDSKDFENLFCAKKKAVDSSLSTNPSSTTGKEGEKVKLVSLVDIKKSNSIAFMLAKIPTAEGLKKAIDTVDNSILGKEIIKTLI-TNVPTEQDYQLIKGSEIH--ESKLDKPERWILEIYGFPMMKERLVAWLFQLEYQEMYNNIIQILEKLQNAIKDTKSSDSLKKILGIVLVLGNYMNGGSGRGQADGFTLEILDSLATSKDVENKTSLLDYVSKISMEKYPKTMNVAQELDSL-KLVQLSISDMSTDINDLEKQFNISKNNCKKVLEANIPSSSKFQSTIGSFLEKTEIDIKNLKENQKNIVDSFIQLVEFFGYPKSYATTASCQQFFNSIYSFSLLFSKQCQKI 1012          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: T1IHU6 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 409/1127 (36.29%), Postives = 636/1127 (56.43%), Query Frame = 2
Query:   56 NFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE--KYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQK---LVIEDQ-----RKKNDKNFQKIEIIPKKN--ESENSDVDEVSKV-----------EKFLETEQNSIKPEIRIHPDSEESSRIVSPVNNLHYQN-------------TPQTSEEDVFIMKDENNKCNIETSKHS------VKAIKNQFSSTIK--QNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDC--TISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNI-----------KENNGSLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWK-TFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF--KKHEAGP----KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMS 3244
            +  C++ Y +D+DPFS ++  PEPT  P + F  +  + N +  ++ +L  PH+L++  LQ+ K   T  E+G +LD + T+ EQ ED +G+ E+    +++RT+LS+RV ++I+K+ N+ GKELRRALFSLKQIFQDDKDLV EFV  NGL  L ++G ++DQN+QNYILRALGQ+MLYVDGMNGV+   ET++W YSL+  K+RLVVK A+KLL+VF+EY    E + + ++ +I  Y    G K WS ++++L + +++D EL+ +A T INK L  IPDQDT+Y++ D LEEQ ME I +  ++K   D+D+++QF IYE  L+ EDGE    L  +   +R +PR++   + +  RKS R     T N  +R+++   L  +D      +++N K + +  I  + N   +++SD++ V+             + F++ ++ +++    +   SE       PV N   +N             TP  + +  +++   + K   E +K        VK    + S  +   Q+ ++    +  S ++SGI+S AK+ L+NQ  +   E             +     + L W+ L    L+  LII + +F+DL   +D +NI            + + S + NG P            PP   +P   P    +P PP    V        N+        K K+T +L WK      V    +  TIW  +KN   D ++ E LFEN+  D   K     P    K++ VL  KRSN INIGM  L     +K AIL M ++++NREG+EK+L  M+P++EE   I  AQ+ N +  LG AE++LL L  I+ L  RL++W F+LD EQ+E D+ EPLMDLK  I ++  ++T  Y+LST+L +GNFLN      F ++YL KVPEVKDT HKHSLL+H+  +V+ +Y  +TDL+SE+ ++ R  +VD++ELA  L+K+E +   SW+ LKLI K D SS   + ++ EF  D ++RI+ + I++RRV+ ++  +L + G P   AKE  +  F +++S+F++EY TTRE+++Q   KK   ++R +TRG MITD+        +   E   LL   MS
Sbjct:    2 SLTCRVQYLSDVDPFSASTNTPEPTRPPYFTFNVNIPLINQIAAVHHLLKAPHRLDDCTLQIYKANGTSGEHGTYLDLESTINEQGEDFEGFNENRKNSILVRTQLSVRVHSIIEKLLNSEGKELRRALFSLKQIFQDDKDLVHEFVQNNGLASLIKVGCEADQNYQNYILRALGQVMLYVDGMNGVINHPETVQWFYSLIATKYRLVVKTAIKLLLVFVEYT---ETNCTLLVKTITNYDINRGVKSWSNIMQLLGEKDSSDMELLVFATTLINKTLYGIPDQDTYYDMVDALEEQGMERIIQKYMSKQGTDLDLLQQFHIYEAVLKHEDGEDDGRLLQMESQVRQIPRSRKSNE-NNRRKSWRHGSVSTGNSPYRNKQTNCLSPDDSSPKHLQRENRKQWLEKPIGAQINGCNTDSSDLNGVTPALRRRRERQDRQQMFIKEQEETVQKRGSLTDTSE-------PVLNSELRNGNCKEPADSSNVSTPAYARQQSWVLSMLHTKSQDEEAKDEKCDNGYVKETPEKTSVPVSSPQHIDMAARINLLSSNLSGIVSKAKEGLINQCSRNDEEKSPTLLSPPALNGVEPKKENDLQWEQL-MSTLDRPLIITDLDFTDLGKEDD-INIFQLSQVNNNFGGKGSPSTMTNGAPH---GIGAPPPPPPGCHAPPPPPLTRGIPPPPALINVPPSGITLTNNNNAAKTIKKNKKTIKLFWKDVHADPVIQAHVKHTIWDDLKNTSVDVQKLEHLFENRVKDVVPKDRNLDPNNKSKEVIVLGSKRSNTINIGMTKLPPPRTIKTAILKMDNTIMNREGIEKILTNMIPSEEEKSRIAEAQVANPEIPLGSAEQFLLTLASISELPARLKLWAFKLDYEQMEVDVAEPLMDLKQCISQLNSNKTFRYILSTLLSIGNFLNGIEAKGFQIDYLAKVPEVKDTVHKHSLLHHLCHMVMEKYSDSTDLYSEIGSVTRASKVDFDELAANLNKMEIECKSSWDRLKLIAKHDGSSSVKVVKMSEFLADCAERIIVLGIVHRRVLNRFYRLLCFFGVPSVVAKETKVNQFLRVISEFSLEYSTTRERVVQQMEKKANHRERNKTRGKMITDMEKFKSKDVQADEELRQLLVTGMS 1112          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: A0A5E4Q7K5 (Uncharacterized protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS6258 PE=4 SV=1)

HSP 1 Score: 541.962 bits (1395), Expect = 4.088e-169
Identity = 372/1069 (34.80%), Postives = 585/1069 (54.72%), Query Frame = 2
Query:   59 FKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNL-LKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPIN---------DYVNIKENNGSLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF--KKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSEN 3217
            F C++ Y +D+DPF+  + V EPT +P Y  +   +  +  +  ++ +L  PH+L++A LQ+  FKD   +YG +LD D T+ EQ E+L+G  ++    ++LRT+LS+RV A+I+++ N+ GK+LRRALF++KQ+ Q DKDLV EFVA NGL CL Q+ +K DQ + +Y+LR +GQ+++YVDGM+GV+     I+WLYS +   FR++VK  LKLL +F+EY     L   + I  +++ H +    PW  V+KIL D +A+D+EL+  A+  IN  L  I D+D +Y+  D L+EQ ++ I +  ++K   D+D+++Q +I++  L  EDG++  T I +                        ++E+  +S R + L I +  ++  K +Q  E   K N+   + + +          +  ++   +  + +       ++ V       TP+  ++ VF++  EN            K I  + +S+   +N V +        ++GI+S AK+ L   + K + +   +E          S + L W+ L + CL  +  + + +FSDL   +         +  N        +L  +  PPPLP                      P PP     ++      + +T  S   K K+T +L W+       P      +G  IW  +  V+ D    E LFE++ +D   K+    PK+  +LD KRSNAINI MK L +   +K AIL M ++VI REG+EKLL TMLPT+EE   I+ AQ  N D  LG AE++LL L  IN L  RL++W+F+LD + LE++I EPLMDLK GI+ + D+ T   +LST+  +G+FLN + V  F LEYL KV EVKDT HKH LLYH+  +++ ++  TTD  SE+  + R  +VD++ L+  L KLE D   SW+HLK + K D  SQ    ++ +F  DA++RI+ + +I +RV+ +YN  L YLG PP D  +     F KI+S+FA+EYRTTRE+++Q   K+   ++R +TRG MI DI      S E + +N
Sbjct:   24 FVCRVQYLDDLDPFNEYN-VREPT-RPLYHTFNVTIPLSYQIAAVHRLLQAPHRLDDATLQV--FKDG--DYGPYLDIDSTLAEQDEELEGLQDNRKNALVLRTQLSVRVHAIIERLINSQGKDLRRALFAVKQMMQSDKDLVHEFVANNGLDCLMQVSAKEDQTYLDYVLRTVGQILIYVDGMHGVMNHKGCIQWLYSRIASNFRMIVKTTLKLLSIFVEYTETNSLLLVDAINFVDKSHNR---PPWYNVMKILQDFDASDTELLICAMNLINLCLINIQDRDVYYDQVDVLQEQGIDDIIQMYMSKQGTDLDLLRQLQIFDAVLLYEDGDESGTAIKQ------------------------LDESIIKSMRRRSLSITNTDRRKSKKYQVKE---KGNQRYTNGLTQ--------RMQNGTLGHSVNTNDN-------LAAVRQKQIDVTPE-KDDRVFLVNRENR----------FKDISQRLTSS---SNHVSE----EKSKLAGIVSKAKEELAKSQSKEIIKSSTIEKSSKLHEIKVSENDLHWEELRKTCLNREFQLCDLDFSDLLQDSDDDVMSSSVNTANGPPPPPPFMLPSVG-PPPLPG------------------YFFPAPPANGSQNQSNLAEASMETDTSTIKKNKKTVKLFWREIQDNPIPPTVRPRVGGFIWDDLPQVNIDSAMLEHLFESRTNDLIIKQKLMEPKRNLILDTKRSNAINIAMKKLPTPQTIKAAILKMDATVIGREGIEKLL-TMLPTEEEKVKIQEAQYANPDLPLGSAEQFLLTLASINELSSRLKLWVFKLDFDNLEKEIAEPLMDLKQGIELLKDNRTFKVILSTLRSVGSFLNGSQVKGFRLEYLSKVMEVKDTVHKHPLLYHICEMIIEKFSDTTDFFSEVGPVIRASKVDFDVLSNNLLKLETDCKASWDHLKKVAKHD-GSQIYKTKINDFITDAAERIILLSVIKKRVMSRYNKFLLYLGVPPADIVKTRPSDFLKIISEFALEYRTTRERVIQQLQKRANHRERNKTRGKMIIDIEKYSTKSGEQTKDN 1002          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: A0A1W4WSX8 (FH1/FH2 domain-containing protein 3 isoform X3 OS=Agrilus planipennis OX=224129 GN=LOC108735605 PE=4 SV=1)

HSP 1 Score: 554.288 bits (1427), Expect = 3.214e-166
Identity = 407/1072 (37.97%), Postives = 599/1072 (55.88%), Query Frame = 2
Query:  215 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEK----YLTVINEGIR-SLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKL----------------------VIEDQRKKNDKNFQK-----------------IEIIPKKNESENSDVDEVSKVEKFLETEQNSI-----KPEI-------RIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSS-TIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNGIPVPP------PLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVS-GFNKQKRTTRLHWKTF--GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF----KKHEAGP-KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSL----DRHSKEL 3205
            KL++  +QL K  D    YG +LD D ++ EQ E+ +G+  +    ++LRT+LS+RV  +I+K+  + G++LRRALFSLKQIFQ+DKDLV EFV  +GL CL ++GS++DQN+QNYILRALGQ+MLYVDGMNGV++ +ET++WLYSL+  KFRLVVK ALKLL+VF+EY    E +   +I ++       G +PWS V+K+L D ++ D+EL+ YA+T INK  + IPDQDT+Y+ TD LEEQ +E+I +  ++K   D+D+++QF+IYE  L+ ED ++     L  ++E  R +L   KS  +    RKS+R         +  SQ L                        ED R     N +K                 +  IP +      D+  ++ V K L+TE+NS+     KP I       +  PD ++S   +  + N++     +   + +  +K EN          +VK +  + SS  I Q+    K+   R GD+SG+IS AK+ L   K   L +    E           ++ L W+ L +  L   L + + +F+DL          ++   +L   +P         PL TN  +   APP P    +      P  P   S  Q  +    T       K K+T +L WK     P  S       IW ++  V  D ++ E LFE++  D     K+ E    K++ VLD KRSNAINIGM  L     +K AIL M ++++NREG+EKLL TMLPT+EE   I+ AQ +N D  LG AE++LL L  I+ L  RL++W F+LD E  ER+I EPLMDLK GI+ +  ++T   +LST+L +G FLN T V  F +EYL KVPEVKDT HKHSLL+H+  +++ ++P+ +DL+SE+ A+ R  ++D++EL   + +LE D   SW+HLKLI K D S+   +K + +F  D ++RI+ + II+RR+I +++  L +LG P     +     FCK +S+FA+EYRTTRE++LQ   KK   ++R +TRG MIT+I       DR   EL
Sbjct:  884 KLDDVAIQLYKDGD----YGAYLDLDASISEQNEEFEGFQSNKKNSLVLRTQLSVRVHTIIEKLLTSEGRDLRRALFSLKQIFQEDKDLVHEFVQNDGLACLIKVGSEADQNYQNYILRALGQVMLYVDGMNGVIQHNETVQWLYSLISSKFRLVVKTALKLLLVFVEYT---ETNCMLLIKAVEIVDCSHGLQPWSNVMKLLKDFDSADTELLIYAMTLINKCFNGIPDQDTYYDQTDSLEEQGIEAIIQRYMSKPGTDLDLLQQFQIYEAVLQYEDDDEDKGIPLRHLDESFRKTLRNRKSVIESSERRKSRRHSTGTAPVHTSLSQTLRNHLETFNLSNNEDDDNDESSAGPEDVRLSGSCNIEKSKGGTYGNGQRLINGNIVNKIPNRK-----DLAYMNSVNK-LDTEENSVGLMNKKPWILSMMYNGKKPPDEQQSYDNIEDIENVN-----ENDRKTILQIKKEN----------TVKDLTQKLSSQNILQSPTEEKVN--RIGDMSGLISKAKEGLAKSKSNALIKSPTSESLPKLETKKTENE-LRWEELAK-SLNRSLNLCDIDFTDLT--------SDDENDILAPALPATGIPPPPPPLITNMGIAIGAPPPPPLNNRISPPTPPNAPIFGSNIQKSSSKLTTESKIPIKKNKKTVKLFWKEVRDDPITSIKLKTGLIWDELTPVTVDTQKLEHLFESRAKDLITKEKQQELNKNKEIIVLDPKRSNAINIGMTKLPPPRSIKTAILKMDATIMNREGIEKLL-TMLPTEEERTKIQEAQASNPDLPLGSAEQFLLTLASISELPARLKLWAFKLDFENTEREIAEPLMDLKQGIEILRMNKTFRGILSTLLSIGIFLNGTEVKGFQIEYLSKVPEVKDTVHKHSLLHHLCHILMEKFPEASDLYSEIGAITRASKIDFDELMLNIQRLEADCKASWDHLKLIAKHDGSTMMKVK-MSDFLTDCAERIIILSIIHRRIINRFHKFLLWLGIPLHQIVDTKPNEFCKTISEFALEYRTTRERVLQQLEKKANHRERNKTRGKMITEIGKFRSKEDRADAEL 1913          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: A0A2A4K3T8 (Uncharacterized protein OS=Heliothis virescens OX=7102 GN=B5V51_2640 PE=4 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 2.076e-160
Identity = 378/1034 (36.56%), Postives = 578/1034 (55.90%), Query Frame = 2
Query:  215 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTV---INEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLN---GIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTF----GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF--KKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSD 3280
            +L++A LQ+  FKD   +YG +LD D T+ EQ E+L+G  +S    ++LRT+LS+RV A+I+++ ++ G+ELRRALF+LKQI Q DKDLV EFVA  GL CL Q+G+ +D N+ +YILRALGQ++LYVDGM+GV+     I+WLY+L+  KFR VVK ALKLL+VF+EY     L   + I S++  +   G +PW  ++KIL D +A+D+EL+ YA T IN+ L+ +PD+DT+Y+  D L++Q ++ I +  ++K   D+D+++Q +I+E  L  EDG++  T    +++ + +  R +S       RKSK+ +  E  N+ + S  L    Q          ++ I    + +     EV     FL   ++SIK         + + R+ SPV       +P T E+ +                                          R  D++GI+S AK+ L   + K + +   +E          S + L W+ L + CL  +  + + +FSDL   +D     +   S  +N   G P PPP       +PP  P  F +    ++P PP P L S+    +D+S        K K+T +L WK       P      +G  IW  + NV  D    E LFE++ +D   K+    PK+  +LD KRSNAINI MK L +   +K AI+ M ++VI REG+EKLL TMLPT+EE   I+ AQ  N D  LG AE++LL L  IN L  RL++W+F+LD + LE++I EPLMDLK GI+ +  + T   +LST+  +GN+LN      F LEYL KV EVKDT HKH LLYH+  +++ ++P ++D  SE+  + R  +VD++ L+  L KLE D   SW+H+K + K D  SQ    ++ EF  DA++RI+ + +I +RV+ ++N  L +LG PP D  +     F K++++F++EYRTTRE++LQ   KK   ++R +TRG MI D+ +    + + +++N        + K L  +D D+D
Sbjct: 1127 QLDDATLQV--FKDG--DYGPYLDLDSTLGEQDEELEGLQDSRKNALVLRTQLSVRVHAIIERLLHSQGRELRRALFTLKQILQSDKDLVHEFVANKGLDCLMQVGNMADHNYLDYILRALGQILLYVDGMHGVMAHKRCIQWLYTLIASKFRHVVKTALKLLLVFVEYTEKNCLLLIDAIISVDNSN---GRQPWYNIMKILQDFDASDTELLIYATTLINRCLNNVPDRDTYYDQVDALQDQGIDDIIQLYMSKQGTDLDLLRQLQIFEAVLLYEDGDETGTALKQLDDSVINSIRRRSINLSTERRKSKKQQCKEKGNQRYTS-GLKQRIQNGTLGHTVNAVDAITVMRQKQTDTTPEVKDDRGFLLNREHSIK---------DLAQRLTSPV-------SPTTEEKPL------------------------------------------RVSDMAGIVSKAKEELAKSQSKEIIKSPTIEKSPKVHEIKVSENDLHWEELRKGCLHREFHLCDLDFSDLREDSD-----DEMSSPAINAASGPPPPPPTMFPPMGIPPPLPGCFPMLSKNNVPTPPKPALSSEMSNDSDSST-----IKKNKKTVKLFWKEIQENPTPVAIRPKVGGFIWDDLPNVTVDTNMLEHLFESRTNDLIIKEKLMEPKRNLILDAKRSNAINIAMKKLPTPQTIKAAIMKMDATVIGREGIEKLL-TMLPTEEEKVKIQEAQYANPDLPLGSAEQFLLTLASINELSSRLKLWVFKLDFDNLEKEIAEPLMDLKQGIELLKVNRTFKVILSTLRTVGNYLNGNYAKGFRLEYLSKVVEVKDTVHKHPLLYHICEMIIEKFPDSSDFFSEVGPVIRASKVDFDVLSANLQKLESDCKASWDHMKRVAKHD-GSQIFKTKINEFLTDAAERIILLSVIKKRVMSRFNKFLLFLGVPPCDMHKTKPAEFLKVIAEFSLEYRTTRERVLQQLEKKANHRERNKTRGKMIIDVGNYSHKNGDHTADN--------ALKELLKTDPDTD 2074          
BLAST of Formin-like protein 15 vs. TrEMBL
Match: A0A0B6ZRD6 (FH2 domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF77387 PE=4 SV=1)

HSP 1 Score: 370.163 bits (949), Expect = 9.145e-111
Identity = 199/421 (47.27%), Postives = 286/421 (67.93%), Query Frame = 2
Query: 1997 SGFNKQKRTTRLHWKTF-GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENK-----PHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIM 3241
            +   K K+T RLHW+   G           IW  +  V  D E+ E LFE K       D K+  +G K++ VLD KRSNAINIG+  L     +K AIL M +S++N+EG+EK+L TM+PT+EE   I  AQ+ N D  LG AE++LL L  +  LE RL++WLF+LD E LE+++ EPLMDLK G+ E+  ++T   +LS IL +GNFLN  +V AFS+E+LQ+VPE+KDT HKHSLL+H+ ++++ Q+P +TDL+SE+  + RC RVDW+ELARKLDK+E D   SW+HL+ I K D SS +   ++  F  DA++RIM + II++RV+ +YN +L YLGFP  DA+++ I +FCK++S+FA+EYRTTR+K++Q+  KK   ++RK+TRG MI D  +     KE++  N++ LN I+
Sbjct:   82 ASLKKNKKTVRLHWRALPGDSQHPTTKDDVIWKLLVPVTIDTEKLEHLFETKTSELKAKDVKQDTSGKKEITVLDPKRSNAINIGLTVLPPPRTIKAAILKMDNSIMNKEGIEKILTTMIPTEEEKGKILEAQMANPDTPLGTAEQFLLTLSSVFELEARLKLWLFKLDYELLEQEVAEPLMDLKKGVIELQKNKTFRCILSGILAIGNFLNGASVRAFSVEFLQRVPEIKDTVHKHSLLHHLCTIIIEQFPDSTDLYSEIGPITRCSRVDWDELARKLDKMEYDCKASWDHLRAIVKHDGSSTDLKGKMSLFLADAAERIMILHIIFKRVLNRYNKMLLYLGFPVPDARDMKINHFCKVVSEFALEYRTTRDKVIQMLQKKANQRERKKTRGKMIVDTENFKGKGKEIA--NDEALNAIL 500          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod3a (formin homology 2 domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-633])

HSP 1 Score: 305.449 bits (781), Expect = 3.429e-90
Identity = 198/535 (37.01%), Postives = 314/535 (58.69%), Query Frame = 2
Query: 2006 NKQKRTTRLHWKTFGP---QVSNGDIGS-TIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKEL-----SSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRT--TRRLAGTRERKSMRRT 3562
            +K+K+T RL W    P   Q      G  ++WSK++ V  D  + E LFE+K  +    KK  +  K+ E  VLD KRSNAINIG+  L     +K+AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E  E+++ EPL DLK G++++  ++TL Y+L+ +L +GNFLN +N   F L YL+KVPEVKDT HK SLL+H  S V+  +P+T+DL+SE+ A+ R  +VD+++L   L  +E+    SW +LKLI K +       +R+ +F  D ++RI+ +KI++RR+I +++  L +LG P    +EI+++ F KILS+FA+EYRTTRE+ILQ   K+   ++R +TRG MI D+ +  R ++ L     ++E+  +  V+  + +L +   ++                 P  ++ +R  P    +        +PG+++          D +D++++ + + AT S + RT    R      RKS+RRT
Sbjct:   91 SKKKKTIRLFWSEVRPAEYQFLGHKRGHMSLWSKLETVKLDTSKLEHLFESKSKEIPVTKKTASDGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKSAILNFDEYALNKEGIEKIL-TMIPTEEEKQRIQEAQLANPDVPLGSAEQFLLTLSSISELSARLQLWAFKLDYEATEKEVAEPLQDLKEGMEQLEKNKTLRYILAALLAIGNFLNGSNAKGFDLNYLEKVPEVKDTVHKQSLLHHACSTVLENFPQTSDLYSEIGAVTRSAKVDFDQLQENLTLMERRCKASWENLKLIAKHEMKPVLK-QRMSDFLKDCAERIIILKIVHRRIINRFHSFLLFLGQPAYGVREISVQRFSKILSEFALEYRTTRERILQQKQKRADHRERNKTRGKMIIDVTA-PRETQGLGHAEDAAEHEHMKAVL--KDSLQSGSTETSVL--------------PGLRTRSRVRPSRGRTAWAAANEDAPGVTD----------DGADEIMERIVRSATQSPRDRTQPRERRRSRANRKSLRRT 596          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod3b (formin homology 2 domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-081028-61])

HSP 1 Score: 295.434 bits (755), Expect = 1.386e-86
Identity = 171/401 (42.64%), Postives = 254/401 (63.34%), Query Frame = 2
Query: 2003 FNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENK-PHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKE 3202
            F K+++T RL W    P         T W    N       + S  + K   D K+ E     + VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I  L  RL++W F++D E LE+++ EPL DLK G+ ++  ++TL ++LST+L +GNFLN +N   F L YL+KVPEVKDT HK SLL+HV S+VV ++P+++DL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK+I K +       +R+ +F  D ++RI+ +KI++RR+I +++  L +LG PP   +E+++  FCKILS+FA+EYRTTRE++LQ   K+   ++R +TRG MITD       S E
Sbjct:   99 FQKKRKTIRLFWNEVRP---------TDWQYHGNKRTLSLSYSSSLQLKTAADGKRQE-----IIVLDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLANPDTPLGSAEQFLLTLSSITELNARLQLWAFKMDYEVLEKEVAEPLQDLKEGMNQLEKNKTLRFILSTLLAIGNFLNGSNAKGFELSYLEKVPEVKDTVHKQSLLHHVCSIVVEKFPESSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKVIAKHEMKPALK-QRMTDFLKDCAERIIILKIVHRRIINRFHAFLLFLGHPPYAVREVSVHRFCKILSEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITDTGKFAGSSVE 483          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod1 (FH1/FH2 domain-containing protein 1-like [Source:NCBI gene;Acc:103022245])

HSP 1 Score: 299.671 bits (766), Expect = 3.116e-83
Identity = 199/555 (35.86%), Postives = 318/555 (57.30%), Query Frame = 2
Query: 2000 GFNKQKRTTRLHWKTF----GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF----KKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQAT-------SSNKRRTTRRLAGTRERKSMRRT-KPNITEDIIKFLDQQKIS 3616
             F K+++T +L WK       P+      G T+W+ +  V  D ++ E LFE+K  D     K  E    ++ VLD KRSNAINIGM  L ++  +K AILN     I++EG+EK+L TM PT+EE   I+ AQ+ + D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLKLG++++  ++T   +L+T+L +GNFLN ++   F L YL+KV EVKDT H+ SLL+H  + VV  YP T+D++SE+SA+ R  +VD+E+L+  L +LE+    SW++LK++ K +   Q    ++ EF  D ++RI+ +K+++RR+I +++  L YLG P    ++  I  FCKI+S+F++EYRTTRE++L    K+   ++R +TRG +IT+          +S ++   ++ + +    A  + ++  N L     R    +    +S  R  P PS   +        G++        L  D +D+++D L +  T       SS K R   RL     RKS+RRT K  ++ D+++ L   K +
Sbjct:  840 AFVKKRKTVKLFWKELKQPDSPRKCKFGRG-TVWASLDKVSVDTDKLEHLFESKAKDLPVAKKGAEVKRAEIHVLDSKRSNAINIGMTVLPAVHIIKTAILNFDEFAISKEGIEKIL-TMTPTEEEKQKIQEAQLASPDVPLGTAEQFLLTLSSISGLTARLQLWAFKLNYESLEKEIAEPLFDLKLGMEQLAKNKTFKRILATLLAIGNFLNSSSAKGFELSYLEKVIEVKDTVHRQSLLHHCCNFVVENYPDTSDVYSEISAITRSAKVDFEQLSDNLVQLERKCKTSWDNLKVMAKHETKLQLK-NKMTEFLKDCTERIIILKVVHRRIINRFHSFLLYLGQPSYSVRDTKITQFCKIISEFSLEYRTTRERVLTQKRKRAAHRERTKTRGKLITETEKFSGAVPSISQDSPSPVS-MTTEAEPAQEEHENMKNLLIANDDRSKLRRSRAVRSMGRVSPSPSMVKE-------DGVN--------LPDDATDEIMDRLVKSVTQNPSERASSPKERKRSRL----NRKSLRRTLKSGLSVDVVQALGLNKAT 1371          

HSP 2 Score: 270.781 bits (691), Expect = 9.522e-74
Identity = 153/340 (45.00%), Postives = 221/340 (65.00%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFN-LLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 1054
            M    C++ Y  D DPF  T+  PEP  +P     K+ L  N  +  ++++L  P KLE   LQ+       +  G +LD D ++ EQ ++L+ + E    G    +ILRT+LS+RV ++++K+ N+ G ELRR+LFSLKQ+FQDDKDLV EFV  +GL C  ++G+++D N+QNYILRAL Q+ML+VDGMNGV+  +ET++WLY+L     RLVVK ALKLL+VF+EY    E +   +I ++N    K G K WS +  +L +   +D+EL+ Y +T INK L+ +PDQD+FY+VTD LE+Q ME I +  ++    D D+ +QF IYE AL+ EDGE
Sbjct:    1 MAVLTCRVQYLEDTDPFVCTN-FPEPR-RPLQYELKENLPLNEQIAGVHKLLQAPLKLEECALQV-------SPNGNYLDLDSSLTEQRDELEQFYEDIAIGKKPILILRTQLSVRVHSILEKLYNSQGPELRRSLFSLKQLFQDDKDLVPEFVNSDGLTCFIKVGAEADHNYQNYILRALSQIMLFVDGMNGVINHNETVQWLYTLTGSMSRLVVKTALKLLIVFVEYT---ESNGPLLIQAVNTVDVKRGVKSWSYLTDMLEEKNGSDTELLVYTMTLINKTLAALPDQDSFYDVTDSLEQQGMERIMQKHMSSRGIDPDLKQQFTIYENALKYEDGE 328          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod1 (FH1/FH2 domain-containing protein 1-like [Source:NCBI gene;Acc:103022245])

HSP 1 Score: 299.671 bits (766), Expect = 3.434e-83
Identity = 200/555 (36.04%), Postives = 318/555 (57.30%), Query Frame = 2
Query: 2000 GFNKQKRTTRLHWKTF----GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF----KKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQAT-------SSNKRRTTRRLAGTRERKSMRRT-KPNITEDIIKFLDQQKIS 3616
             F K+++T +L WK       P+      G T+W+ +  V  D ++ E LFE+K  D     K  E    ++ VLD KRSNAINIGM  L ++  +K AILN     I++EG+EK+L TM PT+EE   I+ AQ+ + D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLKLG++++  ++T   +L+T+L +GNFLN ++   F L YL+KV EVKDT H+ SLL+H  + VV  YP T+D++SE+SA+ R  +VD+E+L+  L +LE+    SW++LK++ K +   Q   K + EF  D ++RI+ +K+++RR+I +++  L YLG P    ++  I  FCKI+S+F++EYRTTRE++L    K+   ++R +TRG +IT+          +S ++   ++ + +    A  + ++  N L     R    +    +S  R  P PS   +        G++        L  D +D+++D L +  T       SS K R   RL     RKS+RRT K  ++ D+++ L   K +
Sbjct:  858 AFVKKRKTVKLFWKELKQPDSPRKCKFGRG-TVWASLDKVSVDTDKLEHLFESKAKDLPVAKKGAEVKRAEIHVLDSKRSNAINIGMTVLPAVHIIKTAILNFDEFAISKEGIEKIL-TMTPTEEEKQKIQEAQLASPDVPLGTAEQFLLTLSSISGLTARLQLWAFKLNYESLEKEIAEPLFDLKLGMEQLAKNKTFKRILATLLAIGNFLNSSSAKGFELSYLEKVIEVKDTVHRQSLLHHCCNFVVENYPDTSDVYSEISAITRSAKVDFEQLSDNLVQLERKCKTSWDNLKVMAKHETKLQLKNK-MTEFLKDCTERIIILKVVHRRIINRFHSFLLYLGQPSYSVRDTKITQFCKIISEFSLEYRTTRERVLTQKRKRAAHRERTKTRGKLITETEKFSGAVPSISQDSPSPVS-MTTEAEPAQEEHENMKNLLIANDDRSKLRRSRAVRSMGRVSPSPSMVKE-------DGVN--------LPDDATDEIMDRLVKSVTQNPSERASSPKERKRSRL----NRKSLRRTLKSGLSVDVVQALGLNKAT 1389          

HSP 2 Score: 270.781 bits (691), Expect = 9.246e-74
Identity = 153/340 (45.00%), Postives = 221/340 (65.00%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFN-LLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 1054
            M    C++ Y  D DPF  T+  PEP  +P     K+ L  N  +  ++++L  P KLE   LQ+       +  G +LD D ++ EQ ++L+ + E    G    +ILRT+LS+RV ++++K+ N+ G ELRR+LFSLKQ+FQDDKDLV EFV  +GL C  ++G+++D N+QNYILRAL Q+ML+VDGMNGV+  +ET++WLY+L     RLVVK ALKLL+VF+EY    E +   +I ++N    K G K WS +  +L +   +D+EL+ Y +T INK L+ +PDQD+FY+VTD LE+Q ME I +  ++    D D+ +QF IYE AL+ EDGE
Sbjct:    1 MAVLTCRVQYLEDTDPFVCTN-FPEPR-RPLQYELKENLPLNEQIAGVHKLLQAPLKLEECALQV-------SPNGNYLDLDSSLTEQRDELEQFYEDIAIGKKPILILRTQLSVRVHSILEKLYNSQGPELRRSLFSLKQLFQDDKDLVPEFVNSDGLTCFIKVGAEADHNYQNYILRALSQIMLFVDGMNGVINHNETVQWLYTLTGSMSRLVVKTALKLLIVFVEYT---ESNGPLLIQAVNTVDVKRGVKSWSYLTDMLEEKNGSDTELLVYTMTLINKTLAALPDQDSFYDVTDSLEQQGMERIMQKHMSSRGIDPDLKQQFTIYENALKYEDGE 328          
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Match: fhod1 (FH1/FH2 domain-containing protein 1-like [Source:NCBI gene;Acc:103022245])

HSP 1 Score: 299.671 bits (766), Expect = 3.811e-83
Identity = 200/555 (36.04%), Postives = 318/555 (57.30%), Query Frame = 2
Query: 2000 GFNKQKRTTRLHWKTF----GPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF----KKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQAT-------SSNKRRTTRRLAGTRERKSMRRT-KPNITEDIIKFLDQQKIS 3616
             F K+++T +L WK       P+      G T+W+ +  V  D ++ E LFE+K  D     K  E    ++ VLD KRSNAINIGM  L ++  +K AILN     I++EG+EK+L TM PT+EE   I+ AQ+ + D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLKLG++++  ++T   +L+T+L +GNFLN ++   F L YL+KV EVKDT H+ SLL+H  + VV  YP T+D++SE+SA+ R  +VD+E+L+  L +LE+    SW++LK++ K +   Q   K + EF  D ++RI+ +K+++RR+I +++  L YLG P    ++  I  FCKI+S+F++EYRTTRE++L    K+   ++R +TRG +IT+          +S ++   ++ + +    A  + ++  N L     R    +    +S  R  P PS   +        G++        L  D +D+++D L +  T       SS K R   RL     RKS+RRT K  ++ D+++ L   K +
Sbjct:  875 AFVKKRKTVKLFWKELKQPDSPRKCKFGRG-TVWASLDKVSVDTDKLEHLFESKAKDLPVAKKGAEVKRAEIHVLDSKRSNAINIGMTVLPAVHIIKTAILNFDEFAISKEGIEKIL-TMTPTEEEKQKIQEAQLASPDVPLGTAEQFLLTLSSISGLTARLQLWAFKLNYESLEKEIAEPLFDLKLGMEQLAKNKTFKRILATLLAIGNFLNSSSAKGFELSYLEKVIEVKDTVHRQSLLHHCCNFVVENYPDTSDVYSEISAITRSAKVDFEQLSDNLVQLERKCKTSWDNLKVMAKHETKLQLKNK-MTEFLKDCTERIIILKVVHRRIINRFHSFLLYLGQPSYSVRDTKITQFCKIISEFSLEYRTTRERVLTQKRKRAAHRERTKTRGKLITETEKFSGAVPSISQDSPSPVS-MTTEAEPAQEEHENMKNLLIANDDRSKLRRSRAVRSMGRVSPSPSMVKE-------DGVN--------LPDDATDEIMDRLVKSVTQNPSERASSPKERKRSRL----NRKSLRRTLKSGLSVDVVQALGLNKAT 1406          

HSP 2 Score: 270.781 bits (691), Expect = 1.019e-73
Identity = 153/340 (45.00%), Postives = 221/340 (65.00%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFN-LLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCG----VILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 1054
            M    C++ Y  D DPF  T+  PEP  +P     K+ L  N  +  ++++L  P KLE   LQ+       +  G +LD D ++ EQ ++L+ + E    G    +ILRT+LS+RV ++++K+ N+ G ELRR+LFSLKQ+FQDDKDLV EFV  +GL C  ++G+++D N+QNYILRAL Q+ML+VDGMNGV+  +ET++WLY+L     RLVVK ALKLL+VF+EY    E +   +I ++N    K G K WS +  +L +   +D+EL+ Y +T INK L+ +PDQD+FY+VTD LE+Q ME I +  ++    D D+ +QF IYE AL+ EDGE
Sbjct:    1 MAVLTCRVQYLEDTDPFVCTN-FPEPR-RPLQYELKENLPLNEQIAGVHKLLQAPLKLEECALQV-------SPNGNYLDLDSSLTEQRDELEQFYEDIAIGKKPILILRTQLSVRVHSILEKLYNSQGPELRRSLFSLKQLFQDDKDLVPEFVNSDGLTCFIKVGAEADHNYQNYILRALSQIMLFVDGMNGVINHNETVQWLYTLTGSMSRLVVKTALKLLIVFVEYT---ESNGPLLIQAVNTVDVKRGVKSWSYLTDMLEEKNGSDTELLVYTMTLINKTLAALPDQDSFYDVTDSLEQQGMERIMQKHMSSRGIDPDLKQQFTIYENALKYEDGE 328          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006679.1 (pep scaffold:Pmarinus_7.0:GL477506:4953:65657:1 gene:ENSPMAG00000006009.1 transcript:ENSPMAT00000006679.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 303.138 bits (775), Expect = 7.485e-85
Identity = 176/436 (40.37%), Postives = 268/436 (61.47%), Query Frame = 2
Query: 1925 LPKPPVPYLVSKFQTKTDNSKTGVSGFN---------KQKRTTRLHWKTFGP---QVSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDIN 3178
            LP PP+      F +    ++ G  G           K+K+T RL W        Q  N   G S++W+ +  V+ D  + E LFE+K  +    K+     K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EKLL TM+PT+EE   I  AQ+ N D  LG AE++LL L  I+ L  RL++W F+LD E +E+++ EPL D+K G+ ++  + TL  +L+T+L +GNFLN TN   F L YL+KVPEVKDT HK SLL+HV ++VV ++P TTDL+SE+ A+ R  +VD++++   L+++E+     W+HLK I K +       K + EF  D ++RI+ +KI++RR++ +++  + Y+G  P   ++++I  FC+I+S+FA+EYRT RE++LQ   K+   ++R +TRG MITD +
Sbjct:  865 LPPPPL------FASPAHQAREGTPGGPGSPALAHSLKKKKTVRLFWSEVRHTEWQHRNHRYGKSSLWASLDPVEVDTNKLEILFESKSKELPVTKRSTTDGKRQELIVLDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALNKEGIEKLL-TMIPTEEEKQKITEAQLVNPDVPLGSAEQFLLTLSSISELSARLQLWAFKLDYETMEKEVAEPLQDIKEGMDQVEKNRTLRCILTTLLAVGNFLNGTNAKGFELHYLEKVPEVKDTVHKQSLLHHVCNMVVEKFPDTTDLYSEIGAITRSAKVDFDQVQENLNQMERRCRACWDHLKAIAKHETKPVLKTK-MSEFLRDCAERIIILKIVHRRIVNRFHAFMLYIGHAPYSIRDVSITRFCRIVSEFALEYRTARERVLQQRLKRATHRERNKTRGKMITDTD 1292          

HSP 2 Score: 113.235 bits (282), Expect = 1.952e-25
Identity = 68/130 (52.31%), Postives = 91/130 (70.00%), Query Frame = 2
Query:  665 KFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGE 1054
            +FRLVVK ALKLLVVF+EY    E +A   I ++N    K G KPWS ++ IL + +  D+EL+ +A+T +NK L+ +PDQDTFY+VTD LEEQ ME+I +  L K   D D+ +QF IYE ALR+EDG+
Sbjct:    1 QFRLVVKTALKLLVVFVEYT---ESNAPLFIKAVNTTDRKSGVKPWSNILAILDEKDGIDTELLVFAMTLLNKTLAVLPDQDTFYDVTDCLEEQGMEAIAQRHLAKRGGDRDLAEQFDIYEVALRLEDGD 127          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001318.1 (pep scaffold:Pmarinus_7.0:GL481857:28229:37996:-1 gene:ENSPMAG00000001186.1 transcript:ENSPMAT00000001318.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 254.218 bits (648), Expect = 1.958e-74
Identity = 139/328 (42.38%), Postives = 211/328 (64.33%), Query Frame = 2
Query: 2201 DVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSL 3184
            D +R     IG+  L +   +KNAI+      +NRE VEKLL TM+PT EE   I  AQ+ N D  LG AE +L  L  I+ L  RL++W F+LD E +E+++ +PLMDLK G++++  + TL  +LST+L +GNFLN ++   F L YLQKVPEVKDT HK SL+YH+ ++VV ++P+ +DL+SE+ A+ R  +VD+ +LA  L +LE+    SW+HLK + K +  +Q    RL +F  D ++R+  +K ++RR+  ++   L YLG+    A+      FC +LS+FA+EYRT RE++L    K+E  ++R +TRG MIT++ + 
Sbjct:    4 DTERGTTFYIGLTTLPAPGVIKNAIITFDEFALNRESVEKLL-TMMPTDEEKRRITEAQMANPDMHLGSAESFLFMLSSISELSARLQLWAFKLDYETMEKEVADPLMDLKDGMEQLRKNYTLKCILSTLLAIGNFLNGSSAKGFELSYLQKVPEVKDTVHKRSLIYHICNVVVEKFPEASDLYSEIGAITRIAKVDFNQLAENLAQLERRCKASWDHLKAVAKHEARAQLKT-RLCDFLCDCAERVAVLKAVHRRLDNRFRAFLLYLGYSAAAARHETATRFCGVLSEFALEYRTVREQVLAQRLKRENVRQRIKTRGKMITEMGTF 329          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000191.1 (pep scaffold:Pmarinus_7.0:GL476590:204154:283609:-1 gene:ENSPMAG00000000170.1 transcript:ENSPMAT00000000191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 2.117e-33
Identity = 63/103 (61.17%), Postives = 79/103 (76.70%), Query Frame = 2
Query:  278 FLDFDLTVQEQIEDLDGYIESGN----CGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRA 574
            +LD + T+ EQIEDLDG+ E         VILRTKLS+RV A I+K+ N +G+ELRRALFSLKQIFQDDKDLV EFV   GL CL ++G+++DQN+Q+YILR 
Sbjct:    2 YLDPECTLAEQIEDLDGFQEQNGKVKKHTVILRTKLSVRVHACIEKLYNCSGRELRRALFSLKQIFQDDKDLVHEFVNAEGLTCLIKVGTEADQNNQSYILRG 104          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000190.1 (pep scaffold:Pmarinus_7.0:GL476590:194598:199001:-1 gene:ENSPMAG00000000169.1 transcript:ENSPMAT00000000190.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 1.337e-26
Identity = 63/150 (42.00%), Postives = 92/150 (61.33%), Query Frame = 2
Query:  587 MLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINR---YHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYE 1027
            ML+VDGMNGV+  + T++WLY L     RLVVK ALKLL+VF+EY           + +++R   +    G KPW  ++ +L + ++ D EL+  A+T INK L  +PDQD+FY++TDWLE Q ME I K  L+   ++ +  +Q   YE
Sbjct:    1 MLFVDGMNGVIAHNLTVQWLYELTASDSRLVVKTALKLLLVFVEYTATNPRLLIQAVGTVDRRRVFSPPPGAKPWCNMMALLSERDSGDPELLVIAMTVINKTLVSLPDQDSFYDMTDWLEAQGMEDIVKNHLSTKTSNPEFAEQLHAYE 150          
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000679.1 (pep scaffold:Pmarinus_7.0:GL483163:2591:34723:1 gene:ENSPMAG00000000612.1 transcript:ENSPMAT00000000679.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 3.572e-9
Identity = 91/384 (23.70%), Postives = 170/384 (44.27%), Query Frame = 2
Query: 2030 LHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHD---------FKKHEAGPKKLEVLDVKRSNAINIGMKNL-VSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDA----QLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETN-----VSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLH------SELSALNRCHRVDWEELARKLDKLEKDIN--KSWN-HLKLIFKSDQSSQ-ENIKRLKEFFMDASK--RIMKMKIIYRRVIGKYNDVLRYLGFPPKDA-KEINIRYFCKILSDFAIEYR 3085
            L+W     +    D   TIW  +     +   FE LF  K            F K     +  ++LD KRS A+ I M ++ + I  +++A+L + SS+++ E ++ L +     +EE+  I     + + A    QL + E++L +L +I    ER+   +FQ    +  + I   L  +    K +  S  +  VLS IL  GN++N  N        F+LE L K+ +VK   ++ SL+ ++V+  +  + +            E   L +  +V +E++ R + +L KD+   K+    +K ++K  +S   E  K   E F   +   R ++ K + +     + D   +  F PK   KE+   +F  +  +F  +++
Sbjct:  250 LYWVRVQLRDRRSDTAKTIWDGLDEAKINPLEFEELFSKKSVKEKKKPLFDVFSKKSKTKQVTKILDGKRSQAVGILMSSIHLEIKDIQHAVLQLDSSLVDLETLQALYENR-GEKEELGKIMQFVTSKQGAEDTRQLDKPEQFLYELSQIPCFFERVFCIVFQSTFTEHIKSIHCRLELVHRNSKLLKTSAGVHKVLSLILTFGNYMNGGNRTRGQADGFALEILPKLRDVKSNDNRISLVNYIVAYYLQNFDEDAGTERSIFPLPEPQELLQAAQVKFEDIQRDMRELRKDLKALKACELEMKKVYKLSKSEHIEPFKSHMEAFTHQANIDREVEEKCL-QETQASFLDTAAFFCFKPKSGEKEVTPSHFFSVWLEFCSDFK 631          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO36709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHT8])

HSP 1 Score: 302.753 bits (774), Expect = 2.240e-84
Identity = 212/549 (38.62%), Postives = 311/549 (56.65%), Query Frame = 2
Query: 1994 VSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKP-----HDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGT--RERKSMRRT-KPNIT-EDIIKFLDQQKI 3613
            +S  NK K+  RL W+          +  TIW  +  VD D ++ E LFENK         ++ +   K++ VLDVKRS  INI +  L  I  +K AI++M S+VI+REGV+KLL+ M P  EE   I+ AQ+ N D  LG AE++LL +  +N L  RL +W F+LD E LE+++ EPLMDLK  ++E+  + T  ++L+T+L +GNFLN   V  F L+YL KVPEVKDT HK SLLYH+  +V+ ++P TTDL+SEL AL+R  RVD+E +A  L  L+++  +SW HL ++ K D + Q   K + E   DA +RI  +K+++RRV+ ++  +L YLG      K+  +  FCKI+S+F++EYRTTRE++ +   K+EK ++R  TRG +IT+  S   H +  S EN   +     +   AN +   DF +               EK  + T+           PN    I +   +T E A D +D+++D L + AT  + R   R+        RKS RRT K  IT ED+ K   Q +I
Sbjct:  987 LSTLNK-KKMVRLFWQEVKNSPLINGVNKTIWGSIDQVDIDTKKLEHLFENKTSTKIKQKLEEEKDKRKEIVVLDVKRSQQINIALTKLPPIRTLKQAIISMDSTVIDREGVDKLLQ-MQPLPEEKMKIQEAQLANPDVPLGTAEQFLLTMASLNELAPRLHLWAFKLDYEMLEKEVAEPLMDLKEALEELNKNNTFKHILATLLAIGNFLNGKKVKGFQLDYLSKVPEVKDTVHKQSLLYHLCCMVMEKFPDTTDLYSELGALHRSSRVDFEVVAENLKNLKENCKRSWEHLSVVAKHDSTKQLKSK-MTELLTDAQERITILKVVHRRVMNRFRKMLLYLGVSASITKKTKVNEFCKIISEFSLEYRTTRERVREQKKKREKLRERNLTRGKLITE--SFGSHGRSPSEEN---VEEEFRKALFANGE---DFENSK-------------EKLKSSTL-----------PNQRNRIRSCRQSTDEFADDNTDEVMDMLVKSATVPDNRTRMRKRTRMPNSNRKSARRTLKEGITPEDLEKLTKQVQI 1500          

HSP 2 Score: 291.582 bits (745), Expect = 9.986e-81
Identity = 161/354 (45.48%), Postives = 231/354 (65.25%), Query Frame = 2
Query:   59 FKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYD-DEANDSELVTYAITFINK---VLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKS 1108
              CK+ Y +D DPF++T+  PEPT  P Y F+ +  +   +  ++ +L  PH +++  LQL       +  G +LD + T++EQ + L+G+++S    +ILRT LS+RV   I K+  A+G+ELRRALFSLKQIFQDDKDLV EFV  +GL  L  +G  +DQN+QNYILRA+GQ+MLYVDGMNGV+  +ETI+WLYSL   KFRLV K ALKLL+VFIEY  D   ++  ++ ++    +  G K WS ++ IL + D   D E++ YA+T +NK   +L   PDQDTFY++TD LEE +ME+  K   ++   ++D+++Q  IYE ALRIEDG++ L          PR ++
Sbjct:   60 LTCKVQYLDDTDPFASTN-FPEPTRPPTYTFHLNIPLCQQVDGLHRLLCAPHAIDDVSLQL-------SHNGCYLDLENTLEEQADLLEGFLDSRKNTIILRTSLSVRVHNCIAKLLAASGRELRRALFSLKQIFQDDKDLVHEFVNSDGLNALITVGQDADQNYQNYILRAIGQIMLYVDGMNGVINHNETIQWLYSLTASKFRLVAKTALKLLLVFIEYTED---NSRLLVEAVQCVDDAQGIKRWSEIVGILSEKDSLGDEEILIYAMTLVNKASDILYATPDQDTFYDITDDLEELDMENTVKMHQDRRGTNIDLLEQLNIYETALRIEDGDEELPAYGSSPSIRPRKRT 402          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO27929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7W7])

HSP 1 Score: 96.6709 bits (239), Expect = 1.150e-23
Identity = 53/107 (49.53%), Postives = 72/107 (67.29%), Query Frame = 2
Query: 2183 KKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLER 2503
            K++ VLDVKRS  INI +  L  I  +K AI++M S+VI+REGV+KLL+ M P  EE   I+ AQ+ N D  LG AE++LL +  +N L  RL +W F+LD E LE+
Sbjct:    3 KEIVVLDVKRSQQINIALTKLPPIRTLKQAIISMDSTVIDREGVDKLLQ-MQPLPEEKMKIQEAQLANPDVPLGTAEQFLLTMASLNELAPRLHLWAFKLDYEMLEK 108          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO32868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU3])

HSP 1 Score: 68.9366 bits (167), Expect = 1.163e-11
Identity = 79/313 (25.24%), Postives = 155/313 (49.52%), Query Frame = 2
Query: 1967 TKTDNSKTGVSGFNKQ--KRTTRLH--WKTFG-PQVSNGDIGSTIWSKMKNV----DFDYERFESLF------ENKP-HDFKKHEAGPKKLEVLDVKRSNAINIGMKNL-VSIDCMKNAILNM-TSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQ-LGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLN---ETNVSAFSLEYLQKVPEVKDTKH-KXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDI 2836
             K D + +   GF KQ  ++T +     K+F   ++ +  I  T+W+ + +     + D E F+ +F      EN+   DF    A PK+L ++D +R+    I +  L +S + +  AIL +     ++++ VE+LLK  +PT  E + +     NNK+     +A+K+L D+  I   E+RL+   F+    +   D+   +  + +  KE+  S+ +  +L  IL  GN++N     N + F L  L ++ + K + + + +LL ++V+++   YP    L  +L+ +    +V+  EL  ++  L K++
Sbjct:  660 VKVDGAPSSFFGFTKQPNRKTPKPSNPLKSFNWSKLPDSKIKGTVWTDIDDTKVYNEMDLEDFDRMFSAYQGKENQGIKDFTDSAAKPKELSLIDSRRAQNCGILLTKLKLSDEEITKAILTIDEEEELSKDMVEQLLK-YVPTAAEKNLLNE---NNKEKDNFARADKFLYDMSRIVHYEQRLKALFFKKKFPERMGDLKPKVQAVIMACKEVTRSKRIRTLLEVILAFGNYMNRGARGNATGFKLASLNRIVDTKSSANSRITLLNYLVTVLEKSYPDVLKLEEDLANVRTAAKVNLAELESEIVALRKEL 968          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO35335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLQ1])

HSP 1 Score: 61.2326 bits (147), Expect = 2.384e-9
Identity = 61/283 (21.55%), Postives = 135/283 (47.70%), Query Frame = 2
Query: 2189 LEVLDVKRSNAINIGMKNL-VSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETN----VSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYP-KTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPK 3019
            L+VLD K +  ++I + +L  S + +K+ IL+     ++   +E LLK  LP+ E+++ +  + + ++ ++L + E++ + + +I  LE+RL   LF+    +   D    +++     +E+  S     +L  IL +GN++N  +       F + YL K+   K    + +LL+ +   V  +Y  +     +EL  +    +V  E L + +  +  ++ K    L+   ++          +KEF+  A  ++  +  +++ ++  + DVL +    PK
Sbjct:  574 LKVLDPKSAQNLSIFLGSLKSSHEEIKSHILHCDQEKLSESAIESLLK-YLPSPEQMEQL--SNMKDQISELSEPEQFAVHISDIKKLEQRLNCLLFRTRFPEEMSDTKPGVVNATAACREVKTSPKFAKLLELILLMGNYMNTGSRNEGTIGFEISYLTKLSSTKSVDGQRNLLHFIADAVENKYSSEIAGFENELGHVEAAGKVSEEILGKSISNMSANLRKIEKELEAKQQNTNPEDRFHDAMKEFYSSAKDQVDVLVEMHKNMVTMFKDVLEFFCMDPK 853          
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Match: EDO45866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ1])

HSP 1 Score: 53.9138 bits (128), Expect = 2.786e-7
Identity = 37/138 (26.81%), Postives = 71/138 (51.45%), Query Frame = 2
Query: 2288 SSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVS-----AFSLEYLQKVPEVKDTKHK 2686
              +++   + KL + +  T+EE+  I+    +N DA L + E++LLD+ +I   EERL   + +        +I + L + +L  +E+   + +  ++  IL  GNF+N  N++      F LE    +P++KD K +
Sbjct:   80 GKLVSSNSMSKLKQKVRGTKEELSTIEQYLEDNPDAILDRPEQFLLDVSKIVCYEERLACLIARTTVRDGLEEIGQMLTNFRLVCEELQKGKNVHNIMGLILAFGNFMNGGNIARGQADGFDLEI---IPKLKDVKSR 214          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: fhod3a (formin homology 2 domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-633])

HSP 1 Score: 320.857 bits (821), Expect = 4.245e-96
Identity = 181/401 (45.14%), Postives = 262/401 (65.34%), Query Frame = 2
Query: 2003 FNKQKRTTRLHWKTFGP------QVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF---KKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITD 3172
            FNK+K+T RL W    P          G  G + WSK+  V  D  + E+LFE K  +    KK  A  K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EKLL TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I+ L  RL +W F++D E  E++++EPL DLK G++++  ++TL Y+LST+L +GNFLN TN   F L YL+KVPEVKDT HK SLL+HV ++VV  +P++TDL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK+I K +   Q   +++ +F  D ++RI+ +K ++RR+I +++  L YLG PP   +EI++  F KILS+FA+EYRTTRE++LQ   K+   ++R +TRG MI D
Sbjct:   36 FNKKKKTIRLFWSEVRPTDCQYRDYKRG--GDSFWSKLDTVKLDTAKLENLFETKSKEISVTKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALNKEGIEKLL-TMIPTEEEKQKIQEAQLANPDVPLGSAEQFLLTLSSISELSARLHLWAFKMDQEATEKEVVEPLQDLKEGMEQLEKNKTLRYILSTLLSIGNFLNGTNAKGFELTYLEKVPEVKDTVHKQSLLHHVCTVVVENFPQSTDLYSEIGAITRSAKVDFDQLQENLCQMERRCKASWDHLKVIAKHEMKPQLK-QKMSDFLKDCAERIIILKTVHRRIINRFHSFLLYLGHPPYSVREISVNRFSKILSEFALEYRTTRERVLQQKQKRADHRERNKTRGKMIMD 432          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: fhod1 (formin homology 2 domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-110623-4])

HSP 1 Score: 307.375 bits (786), Expect = 1.419e-91
Identity = 171/401 (42.64%), Postives = 267/401 (66.58%), Query Frame = 2
Query: 1997 SGFNKQKRTTRLHWKTFG----PQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDF--KKHEAGPKK--LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDI 3175
            S   ++K+T +L W+       PQ  +   G T+W+ +  V+ D  R E LFE+K  +    K   G KK  + VLD KRSNAINIGM  L +I  +K+AIL+     I++EG+EK+L TM+PT+EE   I+ AQ+ + D  LG AE++LL L  I+ L  RL++W F+L+ E LE++I EPL DLKLG++++  + T   +L+T+L +GNFLN T+V  F L YL+KV EVKDT H+ SLLYH   LVV +YP+++D++SE++A++R  +VD+E L+  L +LE+    SW++LK++ K +       K + EF  D ++RI+ +K+++RRVI +++  L +LG P    ++I +  FC+I+S+FA+EYRT+RE++L L  K+   ++R++TRG MIT++
Sbjct:   32 SAPQQKKKTVKLFWRELKQADRPQKCHFGRG-TVWASLDKVEVDTARLEQLFESKAKELCVTKVTMGTKKAVILVLDPKRSNAINIGMTVLPAIHVIKSAILSFDEFAISKEGIEKIL-TMVPTEEEKQKIQEAQLADPDVPLGSAEQFLLSLASISALTARLQLWSFKLNYEALEKEIAEPLFDLKLGMEQLASNRTFRRILATLLAIGNFLNSTSVKGFELSYLEKVAEVKDTVHRQSLLYHTCKLVVDKYPESSDVYSEIAAISRSAKVDFELLSENLVQLERRCKASWDNLKVVAKHETKVALKTK-MTEFLKDCTQRIIILKVVHRRVINRFHSFLLFLGQPSSSVRDIKVTAFCRIISEFALEYRTSRERVLTLKRKRTTVRERRKTRGKMITEV 429          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: fhod3b (formin homology 2 domain containing 3b [Source:ZFIN;Acc:ZDB-GENE-081028-61])

HSP 1 Score: 303.523 bits (776), Expect = 1.585e-89
Identity = 173/399 (43.36%), Postives = 260/399 (65.16%), Query Frame = 2
Query: 2003 FNKQKRTTRLHWKTFGPQ----VSNGDIGSTIWSKMKNVDFDYERFESLFENKP---HDFKKHEAGPKKLE--VLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITD 3172
            F K+K+T RL W    P      S+     ++WSK++ +  D  + E LFE+K    H  KK     K+ E  VLD KRSNAINIG+  L     +K AILN     +N+EG+EK+L TM+PT+EE   I+ AQ+ N D  LG AE++LL L  I  L  RL++W F++D E +E+++ EPL DLK G+ ++  + TL Y+L+T+L +GNFLN +N   F L YL+KVPEVKDT HK SLL+H  S+VV ++P +TDL+SE+ A+ R  +VD+++L   L ++E+    SW+HLK+I K +  +    +++ +F  + ++RI+ +KI++RR+I +++  L +LG P    +E++I  F KILS+FA+EYRTTRE++LQ   K+   ++R +TRG MITD
Sbjct:   78 FQKKKKTIRLFWNEVRPVDWQCKSHKFCKESMWSKLEPIKVDTSKLEQLFESKSKELHVTKKAAVDGKRQEIIVLDSKRSNAINIGLTVLPPPRTIKTAILNFDEYALNKEGIEKIL-TMIPTEEEKQKIQEAQLVNPDIPLGSAEQFLLTLSSITELSARLQLWAFKMDYELMEKEVAEPLQDLKEGMDQLEKNRTLRYLLATLLAIGNFLNGSNAKGFELSYLEKVPEVKDTVHKQSLLHHACSIVVEKFPDSTDLYSEIGAITRLTKVDFDQLQDNLSQMERRCRASWDHLKVISKYEMKAALK-QKMSDFLKECAERIIILKIVHRRIINRFHAFLVFLGHPIYAVREVSIHRFSKILSEFALEYRTTRERVLQQKQKRANHRERNKTRGKMITD 474          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: ENSORLT00000026828.1 (FH1/FH2 domain-containing protein 1 [Source:NCBI gene;Acc:105356456])

HSP 1 Score: 216.853 bits (551), Expect = 9.500e-60
Identity = 131/392 (33.42%), Postives = 217/392 (55.36%), Query Frame = 2
Query: 2000 GFNKQKRTTRLHWK---TFGPQVSNGDIG-STIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKK--LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKS---------DQSSQENIK--------RLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKIL 3106
            G   ++RT +LHWK      P       G  TIW++++ V+ D      LF+ K           ++  + VL +KRSN I I + +L +   +  AI  M SSV++RE V++L + ++PT++E+  IK A+  N  A L QAE  LL L EI  L  RLE+W F LD + LE++I EPL  LKL ++++  S+T  Y+L+T+L +GNFLN      F L YL K+ +V+DT  +  LL+HV  L++   P ++DLHS+++A+ +  + D+ ++     +LE     SW  LK++ K+         D+S   N +        RL +   D  +R+  ++ ++RRVI +++  L +LG+     ++     FC+ +S+F++EYR  R+ I+
Sbjct:   93 GTVTKRRTLKLHWKELPNLAPLPRMTHFGMQTIWAELEPVNLDTSLLGILFKAKTCSTASKVVSGRQPSVSVLGMKRSNIITIALSSLPAPRLLPPAIYAMDSSVLDREDVQRL-RALIPTEDELGLIKEAKAQNPHAPLAQAELCLLTLGEIPHLSTRLELWAFALDYDSLEKEIAEPLFHLKLAMEQLAASQTFRYILATVLTIGNFLNGCKARGFELSYLSKLSQVRDTHTRQPLLHHVCLLLLQLRPDSSDLHSDIAAVTKAAKYDYSQVQSSFTQLETMCKASWEQLKILEKAEDRQNGGKMDRSKGANEEVSENSLRHRLPKILKDCEERLKVLRAVHRRVINRFHSFLLFLGYSHSMVRDTKAEDFCRNISNFSLEYRNARQAII 483          
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Match: ENSORLT00000029213.1 (FH1/FH2 domain-containing protein 1 [Source:NCBI gene;Acc:105356456])

HSP 1 Score: 201.445 bits (511), Expect = 4.195e-55
Identity = 112/323 (34.67%), Postives = 189/323 (58.51%), Query Frame = 2
Query: 2189 LEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSD-----------QSSQENIK------RLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKIL 3106
            + VL +KRSN I I + +L +   +  AI  M SSV++RE V++L + ++PT++E+  IK A+  N  A L QAE  LL L EI  L  RLE+W F LD + LE++I EPL  LKL ++++  S+T  Y+L+T+L +GNFLN      F L YL K+ +V+DT  +  LL+HV  L++   P ++DLHS+++A+ +  + D+ ++     +LE     SW  LK++ K++           + + E +       RL +   D  +R+  ++ ++RRVI +++  L +LG+     ++     FC+ +S+F++EYR  R+ I+
Sbjct:  107 VSVLGMKRSNIITIALSSLPAPRLLPPAIYAMDSSVLDREDVQRL-RALIPTEDELGLIKEAKAQNPHAPLAQAELCLLTLGEIPHLSTRLELWAFALDYDSLEKEIAEPLFHLKLAMEQLAASQTFRYILATVLTIGNFLNGCKARGFELSYLSKLSQVRDTHTRQPLLHHVCLLLLQLRPDSSDLHSDIAAVTKAAKYDYSQVQSSFTQLETMCKASWEQLKILEKAEDRQNGGKMDRSKGANEEVSENSLRHRLPKILKDCEERLKVLRAVHRRVINRFHSFLLFLGYSHSMVRDTKAEDFCRNISNFSLEYRNARQAII 428          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 2231.45 bits (5781), Expect = 0.000e+0
Identity = 1166/1189 (98.07%), Postives = 1167/1189 (98.15%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQKIS 3616
            MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQKIS
Sbjct:    1 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQKIS 1172          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 2184.45 bits (5659), Expect = 0.000e+0
Identity = 1144/1168 (97.95%), Postives = 1146/1168 (98.12%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSM 3553
            MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKS+
Sbjct:    1 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSI 1151          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 1387.09 bits (3589), Expect = 0.000e+0
Identity = 739/763 (96.85%), Postives = 741/763 (97.12%), Query Frame = 2
Query: 1328 SIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQKIS 3616
            +IKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQKIS
Sbjct:  831 AIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQKIS 1576          

HSP 2 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 379/387 (97.93%), Postives = 381/387 (98.45%), Query Frame = 2
Query:  215 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESS 1375
            KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIK     H ++EESS
Sbjct:  367 KLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIK-----HHENEESS 748          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 1341.25 bits (3470), Expect = 0.000e+0
Identity = 717/742 (96.63%), Postives = 720/742 (97.04%), Query Frame = 2
Query: 1328 SIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSM 3553
            +IKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKS+
Sbjct:  524 AIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSI 1248          

HSP 2 Score: 851.662 bits (2199), Expect = 0.000e+0
Identity = 434/446 (97.31%), Postives = 436/446 (97.76%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIES----GNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESS 1375
            MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIES    GNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIK     H ++EESS
Sbjct:    1 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESINIIGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIK-----HHENEESS 441          
BLAST of Formin-like protein 15 vs. Planmine SMEST
Match: SMESG000035694.1 (SMESG000035694.1)

HSP 1 Score: 1341.25 bits (3470), Expect = 0.000e+0
Identity = 717/742 (96.63%), Postives = 720/742 (97.04%), Query Frame = 2
Query: 1328 SIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMXXXXXXXXXXXXXDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNGIPVPPPLPTNXXXXXXXXXXXXXXXXXXXLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKXXXXXXXXXXXXIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAXXXXXXXXXXTRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFXXXXXXXXXXXXTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSM 3553
            +IKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLN  P P  +P                 QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKS+
Sbjct:  520 AIKPEIRIHPDSEESSRIVSPVNNLHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEVGKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSDILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNAPPSPFAVP-----------------QAPSLPKPPVPYLVSKFQTKTDNSKTGVSGFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENKPHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVINREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLLEERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKLGNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDLHSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENIKRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYFCKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSKELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSNRTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSSNKRRTTRRLAGTRERKSI 1244          

HSP 2 Score: 858.21 bits (2216), Expect = 0.000e+0
Identity = 434/442 (98.19%), Postives = 436/442 (98.64%), Query Frame = 2
Query:   50 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRXXXXXXXXXXXXFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESS 1375
            MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIK     H ++EESS
Sbjct:    1 MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEILSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNCGVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVARNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLYSLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKPWSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQEMESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPRAKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEIIPKKNESENSDVDEVSKVEKFLETEQNSIK-----HHENEESS 437          
The following BLAST results are available for this feature:
BLAST of Formin-like protein 15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FHOD33.337e-9438.38formin homology 2 domain containing 3 [Source:HGNC... [more]
FHOD38.004e-9238.30formin homology 2 domain containing 3 [Source:HGNC... [more]
FHOD34.633e-9037.61formin homology 2 domain containing 3 [Source:HGNC... [more]
FHOD31.003e-8947.61formin homology 2 domain containing 3 [Source:HGNC... [more]
FHOD31.431e-8947.61formin homology 2 domain containing 3 [Source:HGNC... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhod-14.691e-7143.36Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
fhod-14.917e-7143.36Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
fhod-11.664e-6741.29Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
fhod-11.748e-6741.29Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
fhod-11.953e-6332.84Formin HOmology Domain [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fhos1.223e-7835.99gene:FBgn0266084 transcript:FBtr0306631[more]
Fhos4.390e-7836.65gene:FBgn0266084 transcript:FBtr0302085[more]
Fhos5.170e-7842.18gene:FBgn0266084 transcript:FBtr0306630[more]
Fhos1.016e-7736.65gene:FBgn0266084 transcript:FBtr0306632[more]
Fhos1.267e-7741.85gene:FBgn0266084 transcript:FBtr0302086[more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhod3b4.310e-9748.79formin homology 2 domain containing 3b [Source:ZFI... [more]
fhod3a8.299e-9149.40formin homology 2 domain containing 3a [Source:ZFI... [more]
fhod3a6.243e-9048.83formin homology 2 domain containing 3a [Source:ZFI... [more]
fhod3b1.153e-8843.86formin homology 2 domain containing 3b [Source:ZFI... [more]
fhod11.282e-8841.50formin homology 2 domain containing 1 [Source:ZFIN... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rexo11.004e-8838.14REX1, RNA exonuclease 1 homolog [Source:Xenbase;Ac... [more]
rexo11.043e-8837.57REX1, RNA exonuclease 1 homolog [Source:Xenbase;Ac... [more]
FHOD33.545e-8842.89formin-like 3 [Source:NCBI gene;Acc:100491411][more]
rexo16.659e-8736.98REX1, RNA exonuclease 1 homolog [Source:Xenbase;Ac... [more]
rexo12.542e-8637.45REX1, RNA exonuclease 1 homolog [Source:Xenbase;Ac... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fhod36.505e-9047.89formin homology 2 domain containing 3 [Source:MGI ... [more]
Fhod36.912e-9047.89formin homology 2 domain containing 3 [Source:MGI ... [more]
Fhod38.297e-9047.89formin homology 2 domain containing 3 [Source:MGI ... [more]
Fhod15.641e-8636.53formin homology 2 domain containing 1 [Source:MGI ... [more]
Fmnl12.616e-923.36formin-like 1 [Source:MGI Symbol;Acc:MGI:1888994][more]
back to top
BLAST of Formin-like protein 15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2V2M9|FHOD3_HUMAN4.817e-8947.61FH1/FH2 domain-containing protein 3 OS=Homo sapien... [more]
sp|Q76LL6|FHOD3_MOUSE5.803e-8947.89FH1/FH2 domain-containing protein 3 OS=Mus musculu... [more]
sp|Q6P9Q4|FHOD1_MOUSE3.946e-8536.53FH1/FH2 domain-containing protein 1 OS=Mus musculu... [more]
sp|Q9Y613|FHOD1_HUMAN6.429e-8436.36FH1/FH2 domain-containing protein 1 OS=Homo sapien... [more]
sp|Q1ZXK2|FORG_DICDI7.866e-2625.33Formin-G OS=Dictyostelium discoideum OX=44689 GN=f... [more]
back to top
BLAST of Formin-like protein 15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1IHU60.000e+036.29Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A5E4Q7K54.088e-16934.80Uncharacterized protein OS=Leptidea sinapis OX=189... [more]
A0A1W4WSX83.214e-16637.97FH1/FH2 domain-containing protein 3 isoform X3 OS=... [more]
A0A2A4K3T82.076e-16036.56Uncharacterized protein OS=Heliothis virescens OX=... [more]
A0A0B6ZRD69.145e-11147.27FH2 domain-containing protein (Fragment) OS=Arion ... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhod3a3.429e-9037.01formin homology 2 domain containing 3a [Source:ZFI... [more]
fhod3b1.386e-8642.64formin homology 2 domain containing 3b [Source:ZFI... [more]
fhod13.116e-8335.86FH1/FH2 domain-containing protein 1-like [Source:N... [more]
fhod13.434e-8336.04FH1/FH2 domain-containing protein 1-like [Source:N... [more]
fhod13.811e-8336.04FH1/FH2 domain-containing protein 1-like [Source:N... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006679.17.485e-8540.37pep scaffold:Pmarinus_7.0:GL477506:4953:65657:1 ge... [more]
ENSPMAT00000001318.11.958e-7442.38pep scaffold:Pmarinus_7.0:GL481857:28229:37996:-1 ... [more]
ENSPMAT00000000191.12.117e-3361.17pep scaffold:Pmarinus_7.0:GL476590:204154:283609:-... [more]
ENSPMAT00000000190.11.337e-2642.00pep scaffold:Pmarinus_7.0:GL476590:194598:199001:-... [more]
ENSPMAT00000000679.13.572e-923.70pep scaffold:Pmarinus_7.0:GL483163:2591:34723:1 ge... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Formin-like protein 15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO367092.240e-8438.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279291.150e-2349.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328681.163e-1125.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353352.384e-921.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458662.786e-726.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Formin-like protein 15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhod3a4.245e-9645.14formin homology 2 domain containing 3a [Source:ZFI... [more]
fhod11.419e-9142.64formin homology 2 domain containing 1 [Source:ZFIN... [more]
fhod3b1.585e-8943.36formin homology 2 domain containing 3b [Source:ZFI... [more]
ENSORLT00000026828.19.500e-6033.42FH1/FH2 domain-containing protein 1 [Source:NCBI g... [more]
ENSORLT00000029213.14.195e-5534.67FH1/FH2 domain-containing protein 1 [Source:NCBI g... [more]
back to top
BLAST of Formin-like protein 15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035694.10.000e+098.07SMESG000035694.1[more]
SMESG000035694.10.000e+097.95SMESG000035694.1[more]
SMESG000035694.10.000e+096.85SMESG000035694.1[more]
SMESG000035694.10.000e+096.63SMESG000035694.1[more]
SMESG000035694.10.000e+096.63SMESG000035694.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000165 ID=SMED30000165|Name=Formin-like protein 15|organism=Schmidtea mediterranea sexual|type=transcript|length=3800bp
TTTAATTTTATGAAATTCATTTCAAGTAGCTTACATTTTAATTGATGATA
TGGAAAATTTCAAGTGTAAAATTTGTTACTACAATGATATTGATCCTTTT
TCAACTACATCTACTGTCCCAGAACCAACAATAAAACCAAATTATTTATT
TTATAAGGATAGATTAGTTTTTAACCTATTAAAAGAAATTTATGAAATAC
TATCACCACCTCATAAATTAGAAAATGCAGTTTTGCAATTATGTAAATTT
AAAGACACCCAAACTGAATACGGGCAATTTCTTGACTTTGATTTAACTGT
ACAAGAACAAATTGAAGATCTTGATGGATATATAGAAAGTGGAAACTGTG
GAGTTATATTGAGGACGAAATTGTCAATTAGAGTTGAAGCTTTAATAGAT
AAAATAAACAATGCTAATGGCAAAGAACTTAGAAGAGCTTTATTTTCATT
AAAGCAAATTTTTCAAGACGATAAAGATTTAGTACAAGAATTTGTTGCTC
GAAATGGATTACAATGTTTAAGGCAGATTGGATCAAAAAGCGATCAAAAT
CATCAAAATTATATTTTGCGAGCATTGGGTCAATTAATGTTGTATGTTGA
TGGAATGAACGGAGTTCTTGAAGACTCAGAAACAATAGAATGGCTCTATA
GCTTATTACAGGGAAAATTTCGATTGGTTGTTAAATTAGCTTTGAAACTT
CTCGTAGTATTCATTGAATATGCTATAGATCAAGAATTACATGCATCAAA
TATTATTGCCTCAATAAATAGATATCATGAAAAATTAGGTGGGAAACCTT
GGAGTCTTGTCATCAAGATTCTATATGACGATGAAGCAAATGACTCTGAA
CTTGTTACTTATGCAATTACATTTATAAATAAAGTTCTAAGTTTTATTCC
TGATCAAGATACATTTTACAATGTTACTGATTGGTTAGAAGAACAAGAAA
TGGAGTCCATTACTAAAGCAATTTTAAATAAATCAAATGCTGATGTTGAT
ATGATAAAACAGTTTAAAATTTATGAAAAAGCTTTGCGTATTGAAGACGG
AGAAAAATATCTTACTGTCATTAATGAGGGTATTAGAAGTTTACCTAGGG
CGAAGTCGGAAACTAAATTAGATGGACCTAGGAAATCAAAAAGAATTCGG
GTAAACGAAACAAAAAATGAATCTCATCGCTCCCAAAAATTAGTTATTGA
AGATCAAAGAAAGAAAAATGATAAAAATTTTCAAAAAATTGAAATAATTC
CTAAAAAAAATGAAAGCGAAAATTCAGATGTTGATGAAGTTAGTAAAGTT
GAAAAATTCTTGGAAACGGAACAAAATTCAATAAAGCCTGAAATAAGAAT
CCATCCTGATTCTGAAGAATCTTCTCGAATAGTGTCTCCAGTAAATAATC
TACATTATCAAAATACACCTCAAACTAGTGAAGAAGATGTTTTTATTATG
AAGGATGAAAACAATAAATGCAATATTGAAACGTCAAAACACAGTGTGAA
AGCAATCAAGAATCAATTTTCATCGACGATTAAACAAAATAACGAAGTTG
GAAAACTGCAACATACTCGTAGTGGAGATGTGTCAGGTATTATTTCAAAT
GCTAAGGATAATCTTATGAATCAGAAAATGAAACTGTTAACAGAACCTAA
GTTACTAGAACCTAAAAAGGATTGCACAATTAGTCATTTTTCTTCCGATA
TTCTTGACTGGGATGCATTAGAAAGAGAATGCCTGGAAGAACAACTTATA
ATCAAAGAATGGAACTTTTCAGATTTAGCACCAATAAATGATTATGTTAA
TATAAAAGAGAATAATGGGTCTTTACTTTTAAATGGTATTCCGGTACCCC
CACCATTACCAACAAATTCTTTTGTTGTTCCCCCAGCTCCTCCATCTCCT
TTTGCAGTTCCTCAAGCTCCATCCTTACCTAAACCTCCCGTACCATATTT
AGTTTCTAAATTTCAAACTAAAACAGACAATTCTAAAACTGGAGTTTCTG
GATTTAATAAGCAAAAGCGCACAACGCGATTGCATTGGAAAACCTTTGGA
CCACAAGTTTCTAATGGAGACATTGGCTCAACAATCTGGTCAAAAATGAA
AAATGTGGATTTCGATTATGAAAGATTTGAATCACTCTTTGAAAATAAAC
CACATGATTTTAAGAAACATGAAGCTGGTCCTAAAAAACTTGAAGTTCTC
GATGTAAAACGGTCAAATGCTATAAATATAGGGATGAAAAATCTAGTATC
GATTGACTGCATGAAAAATGCAATTTTAAATATGACTTCAAGTGTTATTA
ATCGCGAAGGAGTTGAAAAACTTTTGAAAACAATGCTTCCTACTCAAGAA
GAAATCGATAACATCAAAACCGCTCAAATAAATAATAAAGATGCTCAATT
AGGTCAAGCTGAAAAATATTTATTAGATCTTCACGAAATTAATTTATTAG
AAGAACGTTTAGAAGTTTGGCTATTTCAGCTTGATTCCGAACAATTGGAA
AGAGATATTCTTGAGCCCCTAATGGATTTAAAGTTAGGAATCAAAGAAAT
ATATGATAGTGAAACTCTGATTTATGTTCTTTCAACCATATTAAAATTAG
GAAATTTTCTTAATGAAACAAATGTAAGCGCATTTAGCTTAGAATATTTG
CAAAAAGTTCCAGAAGTAAAGGACACTAAACACAAGCACAGTTTGCTTTA
TCACGTTGTTAGCCTGGTTGTTATTCAATATCCAAAAACTACAGATCTCC
ATTCTGAGTTAAGTGCTTTAAATAGATGTCATAGAGTAGATTGGGAAGAA
TTAGCAAGAAAATTGGATAAGCTCGAAAAAGATATCAATAAATCTTGGAA
TCATTTAAAGTTAATTTTTAAATCAGATCAAAGTAGTCAGGAAAATATTA
AAAGACTCAAAGAATTCTTCATGGACGCTTCGAAAAGAATTATGAAAATG
AAAATAATTTATCGAAGAGTAATTGGAAAGTATAATGATGTGCTTCGATA
TTTGGGATTCCCTCCTAAAGATGCCAAAGAAATAAACATTCGTTATTTCT
GTAAAATTCTATCGGATTTTGCCATTGAATATAGAACAACAAGAGAAAAA
ATTTTACAGCTTTCTGCAAAGAAAGAAAAAGATAAAAAAAGAAAGGAAAC
GAGAGGAGCAATGATAACAGATATTAATTCTTTAGACCGGCACTCGAAAG
AATTATCTAGTGAAAATAATGATCTCCTTAATGTCATTATGAGTCGAAAA
AATCTTGCAAATTCAGATTGTGATAGCGACTTTAATTCATTAAACAATAG
AAGAGCACGTCGACTGTCAACCCAGCCACCTACAGAAAAAAGTTCTAATA
GAACTATCCCTAGACCATCATCTTCTCATCAAATGCATAATCCAAATTCT
AGTCCGGGTATTTCAAACATGACTCCAGCTACCTCAGAATTAGCATTAGA
TCAGTCTGACAAATTATTGGACCATCTTGCACAACAAGCCACTTCCTCTA
ATAAACGCAGAACTACTCGTAGATTAGCCGGTACTAGAGAAAGAAAATCT
ATGCGTCGAACCAAACCAAATATAACTGAAGATATTATTAAATTTTTGGA
TCAACAGAAAATATCATGAATAAGTGTCAAAATATGTGATAATGAAAACC
CATATATAAAAATTTAACTGCTTTTTTCAAATATTTTTGTTCGCTTTTAT
ATTTATTTTGTAGTATATAAATAACATTTAATTGTGACTAAACAGATATT
AAGTAATGAGAATTTCTAGTTGTATAAGTTAAACAATTATATTTTTCCAC
back to top

protein sequence of SMED30000165-orf-1

>SMED30000165-orf-1 ID=SMED30000165-orf-1|Name=SMED30000165-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1190bp
MENFKCKICYYNDIDPFSTTSTVPEPTIKPNYLFYKDRLVFNLLKEIYEI
LSPPHKLENAVLQLCKFKDTQTEYGQFLDFDLTVQEQIEDLDGYIESGNC
GVILRTKLSIRVEALIDKINNANGKELRRALFSLKQIFQDDKDLVQEFVA
RNGLQCLRQIGSKSDQNHQNYILRALGQLMLYVDGMNGVLEDSETIEWLY
SLLQGKFRLVVKLALKLLVVFIEYAIDQELHASNIIASINRYHEKLGGKP
WSLVIKILYDDEANDSELVTYAITFINKVLSFIPDQDTFYNVTDWLEEQE
MESITKAILNKSNADVDMIKQFKIYEKALRIEDGEKYLTVINEGIRSLPR
AKSETKLDGPRKSKRIRVNETKNESHRSQKLVIEDQRKKNDKNFQKIEII
PKKNESENSDVDEVSKVEKFLETEQNSIKPEIRIHPDSEESSRIVSPVNN
LHYQNTPQTSEEDVFIMKDENNKCNIETSKHSVKAIKNQFSSTIKQNNEV
GKLQHTRSGDVSGIISNAKDNLMNQKMKLLTEPKLLEPKKDCTISHFSSD
ILDWDALERECLEEQLIIKEWNFSDLAPINDYVNIKENNGSLLLNGIPVP
PPLPTNSFVVPPAPPSPFAVPQAPSLPKPPVPYLVSKFQTKTDNSKTGVS
GFNKQKRTTRLHWKTFGPQVSNGDIGSTIWSKMKNVDFDYERFESLFENK
PHDFKKHEAGPKKLEVLDVKRSNAINIGMKNLVSIDCMKNAILNMTSSVI
NREGVEKLLKTMLPTQEEIDNIKTAQINNKDAQLGQAEKYLLDLHEINLL
EERLEVWLFQLDSEQLERDILEPLMDLKLGIKEIYDSETLIYVLSTILKL
GNFLNETNVSAFSLEYLQKVPEVKDTKHKHSLLYHVVSLVVIQYPKTTDL
HSELSALNRCHRVDWEELARKLDKLEKDINKSWNHLKLIFKSDQSSQENI
KRLKEFFMDASKRIMKMKIIYRRVIGKYNDVLRYLGFPPKDAKEINIRYF
CKILSDFAIEYRTTREKILQLSAKKEKDKKRKETRGAMITDINSLDRHSK
ELSSENNDLLNVIMSRKNLANSDCDSDFNSLNNRRARRLSTQPPTEKSSN
RTIPRPSSSHQMHNPNSSPGISNMTPATSELALDQSDKLLDHLAQQATSS
NKRRTTRRLAGTRERKSMRRTKPNITEDIIKFLDQQKIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005865striated muscle thin filament
GO:0030017sarcomere
GO:0030018Z disc
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042201FH2_Formin_sf
IPR015425FH2_Formin
IPR011989ARM-like
IPR014768GBD/FH3_dom
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0003674molecular_function
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0007015actin filament organization
GO:0030837negative regulation of actin filament polymerization
GO:0045214sarcomere organization
GO:0051639actin filament network formation
GO:0055003cardiac myofibril assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015425Formin, FH2 domainSMARTSM00498it6_sourcecoord: 1..405
e-value: 1.5E-23
score: 94.2
IPR015425Formin, FH2 domainPFAMPF02181FH2coord: 6..329
e-value: 2.4E-67
score: 227.7
IPR015425Formin, FH2 domainPROSITEPS51444FH2coord: 1..355
score: 43.322
IPR042201Formin, FH2 domain superfamilyGENE3DG3DSA:1.20.58.2220coord: 25..356
e-value: 3.8E-75
score: 255.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 463..495
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 394..436
NoneNo IPR availablePANTHERPTHR45920FAMILY NOT NAMEDcoord: 2..490
NoneNo IPR availableSUPERFAMILYSSF101447Formin homology 2 domain (FH2 domain)coord: 29..358