Macrophage mannose receptor 1

Overview
NameMacrophage mannose receptor 1
Smed IDSMED30000163
Length (bp)3544
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Macrophage mannose receptor 1 (SMED30000163) t-SNE clustered cells

Violin plots show distribution of expression levels for Macrophage mannose receptor 1 (SMED30000163) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Macrophage mannose receptor 1 (SMED30000163) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Macrophage mannose receptor 1 (SMED30000163) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000163

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30000163SMESG000044789.1 SMESG000023904.1 SMESG000023903.1 dd_Smed_v4_5207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000163SMESG000044789.1 SMESG000023904.1 SMESG000023903.1 dd_Smed_v4_5207_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000163SMESG000044789.1 SMESG000023904.1 SMESG000023903.1 dd_Smed_v4_5207_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Macrophage mannose receptor 1 vs. Ensembl Human
Match: KLRF1 (killer cell lectin like receptor F1 [Source:HGNC Symbol;Acc:HGNC:13342])

HSP 1 Score: 50.447 bits (119), Expect = 3.122e-6
Identity = 25/78 (32.05%), Postives = 43/78 (55.13%), Query Frame = 2
Query: 2219 CGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWT 2452
            C S +++Y G CY+F+ +   ++++   C E  ++LLI++D  E     AF+ K +  LN +WIGL   S  +   W 
Sbjct:   64 CQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLE----MAFIQKNLRQLNYVWIGLNFTSLKMTWTWV 137          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Human
Match: MRC1 (mannose receptor C-type 1 [Source:HGNC Symbol;Acc:HGNC:7228])

HSP 1 Score: 52.373 bits (124), Expect = 6.009e-6
Identity = 59/259 (22.78%), Postives = 106/259 (40.93%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSA----CGSSFVEYDGNCYFFNK-KPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHW-NTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNC 2698
            +WIGL          WS++  F  L     GS + E   +  +S NP +N +W  L  ++   +IC+          K N    SF+  + S     C S +  Y G+CY  ++ +  +  +A   C++ G +L  ++   E +F+ + L  +    + +WIGL      +   W  ++ + V +T W     S+EN+          + + C V++   G   D G     C   +  +CK    SQ     +  + C
Sbjct:  277 LWIGLNSLSFNSGWQWSDRSPFRYLNW-LPGSPSAEPGKSC-VSLNPGKNAKWENLECVQKLGYICK----------KGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEELDFIISQLGYE--PNDELWIGLNDIKIQMYFEW--SDGTPVTFTKWLRGEPSHENN----------RQEDCVVMKGKDGYWADRG-----CEWPLGYICKMKSRSQGPEIVEVEKGC 504          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Match: mrc1a (mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-GENE-090915-4])

HSP 1 Score: 68.9366 bits (167), Expect = 4.316e-11
Identity = 65/255 (25.49%), Postives = 105/255 (41.18%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILK-SPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNT---FKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKY---KTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQ 2683
            +WIGL          WSN   F  L  +P + S     T A   + N  +  +W  +A  K   +ICR   +   NT    KD PN           C +++V Y GNCY+  +   ++N+A   C   GANL  +++  E +F+        L  + +WIGL    T  L  W  ++ +HV +T W            L  +P +   + + C +++      +D   A   C +    +CKK   S+  G  +
Sbjct:  278 LWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSLEPGLTCA---ALNAGKASKWESMACNKKLGYICRKG-NSTDNTPPPGKDQPN----------FCPAAWVPYAGNCYYLQRTKKMWNDALAACHREGANLASIHNIEEHSFI--ISQSGYLPTDELWIGLNDQKTQNLFEW--SDRTHVTFTTW------------LVGEPSHFINRLEDCVLIK-----GKDGKWADHACEMERGYICKKKSSSKPEGAPE 497          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 61.6178 bits (148), Expect = 7.053e-9
Identity = 58/250 (23.20%), Postives = 104/250 (41.60%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLIS-----QNHG 2674
            +W+GL +        W++    + L       S +E      IST+    GRW         P+IC+  P+  L+ F     T+S+    +  C   +  +   CY+ N   + + +A+  C++M ANL+ ++   E  ++   + K I     +WIGL    T +  N+  T+ + V +T+W+      N++  + +D       C  +    G   D     S C   + S+CKK         Q+HG
Sbjct:  301 LWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENCGVISTDA--QGRWHNRDCSVALPYICKKRPNATLDPF----TTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKHMKKDI---EELWIGLH--DTAMQMNFEWTDRTPVIFTYWHPF--EPNNFREVNED-------CVTIWGPEGRWND-----SPCNYSLPSICKKPAQKADDRIQDHG 525          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 61.6178 bits (148), Expect = 7.356e-9
Identity = 58/250 (23.20%), Postives = 104/250 (41.60%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLIS-----QNHG 2674
            +W+GL +        W++    + L       S +E      IST+    GRW         P+IC+  P+  L+ F     T+S+    +  C   +  +   CY+ N   + + +A+  C++M ANL+ ++   E  ++   + K I     +WIGL    T +  N+  T+ + V +T+W+      N++  + +D       C  +    G   D     S C   + S+CKK         Q+HG
Sbjct:  299 LWMGLNDLDLNGGWQWADSAPLKYLNWEAEMPSYDEEENCGVISTDA--QGRWHNRDCSVALPYICKKRPNATLDPF----TTDSWADDGHYQCDVGWQNFQTGCYWLNSDKLDWRSADRTCQKMEANLVSIHTLPELEYITKHMKKDI---EELWIGLH--DTAMQMNFEWTDRTPVIFTYWHPF--EPNNFREVNED-------CVTIWGPEGRWND-----SPCNYSLPSICKKPAQKADDRIQDHG 523          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Mouse
Match: Cd209c (CD209c antigen [Source:MGI Symbol;Acc:MGI:2157945])

HSP 1 Score: 49.6766 bits (117), Expect = 3.846e-6
Identity = 43/189 (22.75%), Postives = 85/189 (44.97%), Query Frame = 2
Query: 2105 LARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYT---HWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLIS 2662
            L R+ N  +    +  K    +K+    +S I +    C   +  + GNCYFF+K    +N++ N C+++ A L+++    E++F++    ++  +    W+GL  D  +  R W   + SH+ ++   +WN  G   N +           + C   R        +G   + CT++   +CKK+ +S
Sbjct:   10 LKRVSNVAYSHGQEQAKKEKVYKEMTQLKSQINRLCRPCPWDWTVFQGNCYFFSKFQQNWNDSVNACRKLDAQLVVIKSDDEQSFLQQTSKEKGYA----WMGLS-DLKHEGR-WHWVDGSHLLFSFMKYWNK-GEPNNEW----------EEDCAEFR-------GDGWNDAPCTIKKYWICKKSAMS 174          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: A0A3Q1HG54 (Mannose receptor, C type 1a OS=Anabas testudineus OX=64144 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.213e-10
Identity = 71/265 (26.79%), Postives = 109/265 (41.13%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILK-SPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNT--FKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRY 2725
            +WIGL          WSN   F  L  +P + SS   YT A   + N  +  +W      K   +ICR     +L T   KD P          S C   +V Y GNCY+ ++   ++ +A   C + G +L  + +  E++F+        LS + +WIGL      +L  W  ++ SHV +THW T    E S+T  + +       C ++R      +D   A   C      +CKKT   +    +Q   N G      R+
Sbjct:  263 LWIGLNSLDFDSGWQWSNGNPFRYLNWAPGHPSSEPGYTCA---TLNAAKASKWESSQCTKKLGYICRKGNSTSLPTPLSKDQP----------SFCPKHWVPYGGNCYYLDRTKRMWRDALAACHKEGGDLASIQNIEEQSFI--ISQSGYLSTDVLWIGLNDQRNQMLFEW--SDHSHVTFTHWQT---GEPSHTTSFQED------CVLIR-----GKDGRWADHMCEKMYGYICKKTASIKQAEGTQEEANPGCKHGSIRF 496          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: A0A484C6Y4 (Uncharacterized protein (Fragment) OS=Perca flavescens OX=8167 GN=EPR50_G00225550 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 3.891e-10
Identity = 70/265 (26.42%), Postives = 108/265 (40.75%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILK-SPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNT--FKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRY 2725
            +WIGL          WSN   F  L  +P + SS    T A   + N  +  +W   A  K   +ICR     +L     KD P          S C S +V Y GNCY+  +   ++ +A   C + GA+L  ++   E++F+        LS + +WIGL      +L  W  ++ SHV +T W T     +  T L +D       C ++R      +D   A   C      +CKK   ++    +Q   N G  +   R+
Sbjct:  352 LWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSSEPGLTCA---TLNAAKASKWESNACTKKLGYICRKGNSTSLPPPPIKDQP----------SFCPSHWVPYAGNCYYLQRSKKMWKDALAACHKEGADLASVSSIEEQSFI--ISQSGYLSTDVLWIGLNDQRNQMLFEW--SDHSHVTFTQWQT--GEPSHATNLQED-------CVLIR-----GKDGRWADQMCEKTYGYICKKKASTKPAEGAQEEANPGCKLGSIRF 585          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: A0A5J5CFJ7 (Uncharacterized protein OS=Etheostoma spectabile OX=54343 GN=FQN60_013612 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 6.407e-10
Identity = 71/265 (26.79%), Postives = 110/265 (41.51%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILK-SPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNT--ESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRY 2725
            +WIGL          WSN   F  L  +P + SS    T A   + N  +  +W   A  K   +ICR          K NP +          S C S +V Y GNCY+  +   ++ +A   C++ GA+L  +N+  E+ FV        LS + +WIGL      +L  W  ++ SHV +T W  +G   ++ T L +D       C ++R      +D   A   C      +CKK   ++    +Q   N G  +   R+
Sbjct:  272 LWIGLNSLDFESGWQWSNGNPFRYLNWAPGHPSSEPGLTCA---TLNAAKASKWESSACTKKLGYICR----------KGNPISLPPPLNQDQPSFCPSHWVPYAGNCYYLQRSKKMWKDALAACRKEGADLASINNIEEQGFV--ISQSGYLSTDVLWIGLNDQRNQMLFEW--SDHSHVTFTQWQ-IGEPSHA-TNLQED-------CVLIR-----GKDGRWADHMCEKTYGYICKKKASTKPAEGAQEEANPGCKLGSIRF 505          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: W4Y9R3 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.118e-9
Identity = 70/256 (27.34%), Postives = 108/256 (42.19%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQK----SFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDN-PNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARS-HCTVRIQSVCKKTLISQNHGFSQNP 2689
            +W+G+ + R      WS+      +F     P N   N E  + M      F NG W  +A     P IC++         K+N P T+  I  T S C    V Y G+CY     PM F +A N C   GANL+ + D FE++ + + L  Q  +L   WIGL    T     +  ++ + + +THW+ +G  ++S             G Y +    G +   G+ R+  C    + VC+K       GF+  P
Sbjct: 1165 VWLGINDLRVQMLFEWSDGTPVDYTFWNTGEPNNYQGNNEDCVEM------FNNGAWNDIACASTIPSICKLK--------KENLPPTDQPI--TPSGCNLGEVAYGGSCYMAVTTPMSFADAQNDCSTKGANLVSIADRFEQSVISSLLGLQDGTL--FWIGLS--DTQNYGEYAWSDMTAITFTHWD-VGQPDDS-------------GGYCVASTSGSTA--GLWRNIQCDTEAKYVCEKV----RAGFTPRP 1380          
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Match: A0A3Q2PE57 (Mannose receptor, C type 1a OS=Fundulus heteroclitus OX=8078 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.714e-9
Identity = 72/264 (27.27%), Postives = 112/264 (42.42%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILK-SPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSY-TYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRY 2725
            +WIGL          WSN   F  L  +P + SS    T A   + N  +  +W   A  K   +ICR     +L      P   S   K  S C S +V Y G CY+  +   ++  A   C++ GA+L  +++  E++F+ +      L  + +WIGL      +L  W  ++ SHV +T+W    S E S+ T L +D       C ++R      +D   A   C      +CKKT  +     +Q   N G  +  TR+
Sbjct:  261 LWIGLNSMDIESGWQWSNGNPFRYLNWAPGHPSSTPGLTCA---ALNAGKASKWESSACNKKLGYICRKGNSTSL------PPPPS---KGPSFCPSHWVPYGGKCYYLERSKKMWMEALAACRKEGADLASIHNIEEQSFIMS--QSGYLPTDVLWIGLNDQRNQLLFEW--SDHSHVTFTNWQ---SGEPSHATNLQED-------CVLIR-----GKDGKWADHMCEKTYGYICKKTASTTPAAGTQEEVNPGCKLGSTRF 493          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 63.929 bits (154), Expect = 1.229e-9
Identity = 58/250 (23.20%), Postives = 102/250 (40.80%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLIS-----QNHG 2674
            +W+GL +        W++    + L    +  ++EE      I T    +GRW         P+IC+  P+  L+ F     TES+       C   +  +   CY  N   + +N+A   C++M A+L+ ++   E  F+   + K +   + +WIGL    T +  N+  T+ + V +T W+      N++    +D       C  +    G   D     S C   + S+CKK         Q+HG
Sbjct:  298 LWMGLNDLDLNGGWQWADSAPLKYLNWEADQPNHEEDQNCAVIRTE--SSGRWQNRDCSVALPYICKKRPNATLDPF----TTESWADDGQYQCDLGWQNFQAGCYRLNSDKLDWNSAQKTCQKMDAHLVSIHTLPELEFITVHMKKDV---DELWIGLH--DTAMQMNFEWTDRTPVIFTFWHPF--EPNNFHNTQED-------CVTMWGPEGRWND-----SPCNFSLPSICKKAAQKIDGRIQDHG 522          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: mrc2 (mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GENE-090915-5])

HSP 1 Score: 63.929 bits (154), Expect = 1.230e-9
Identity = 58/250 (23.20%), Postives = 102/250 (40.80%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLIS-----QNHG 2674
            +W+GL +        W++    + L    +  ++EE      I T    +GRW         P+IC+  P+  L+ F     TES+       C   +  +   CY  N   + +N+A   C++M A+L+ ++   E  F+   + K +   + +WIGL    T +  N+  T+ + V +T W+      N++    +D       C  +    G   D     S C   + S+CKK         Q+HG
Sbjct:  301 LWMGLNDLDLNGGWQWADSAPLKYLNWEADQPNHEEDQNCAVIRTE--SSGRWQNRDCSVALPYICKKRPNATLDPF----TTESWADDGQYQCDLGWQNFQAGCYRLNSDKLDWNSAQKTCQKMDAHLVSIHTLPELEFITVHMKKDV---DELWIGLH--DTAMQMNFEWTDRTPVIFTFWHPF--EPNNFHNTQED-------CVTMWGPEGRWND-----SPCNFSLPSICKKAAQKIDGRIQDHG 525          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: pla2r1 (phospholipase A2 receptor 1 [Source:ZFIN;Acc:ZDB-GENE-120323-1])

HSP 1 Score: 63.5438 bits (153), Expect = 1.451e-9
Identity = 45/185 (24.32%), Postives = 92/185 (49.73%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAM-EISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWN 2491
            +W GL    +T    WS+     +L+   + SS+      +  +  +   NG W  L+     P+IC+  P+   N+ +  P  E++ YK  + C   + +++G CY F ++   ++N+++ C+++GA L  ++   E   + A +A    S  ++WIGL +++      W  +++S V +T W+
Sbjct:  277 VWTGLNHLADTGGWQWSDGSPLALLQYMSDMSSSAVLQGQLCGVFNSAVENGPWQSLSCDSALPYICKKTPN---NSRRVEP-LETWQYK-ETTCPDGWFDHNGFCYRFVEERSSWDNSSSTCRDLGAQLTSIHSLSELEMLLALIAN--ASDPKVWIGLSIEADFHTVKW--SDNSTVTFTSWH 452          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 60.8474 bits (146), Expect = 9.529e-9
Identity = 60/241 (24.90%), Postives = 100/241 (41.49%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILK-SPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKT---DGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKK 2650
            +WIGL          WSN   F  L  +P  G  + E  L   ++ N  +  +W  +A  K   +ICR    K  +T    P   S +    S C +++V Y G+CY   +  M++ +A + C + GA L  +++  E +F+           + IWIGL    T  L  W  ++ +HV +  W            L  +P + T   + C +++   G   D+   + H       +CKK
Sbjct:  278 LWIGLNSLDFESGWQWSNGNPFRYLNWAP--GHPSLEPGLNC-VALNAGKASKWESMACNKKLGYICR----KGNSTSTITP---SGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFI--ISQSGYTPTDEIWIGLNDQKTQNLFEW--SDRTHVTFAKW------------LVGEPSHATNLREDCVLMKGKDGKWADHMCEKEH-----DFICKK 487          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:103028880])

HSP 1 Score: 60.4622 bits (145), Expect = 1.116e-8
Identity = 60/241 (24.90%), Postives = 100/241 (41.49%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILK-SPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKT---DGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKK 2650
            +WIGL          WSN   F  L  +P  G  + E  L   ++ N  +  +W  +A  K   +ICR    K  +T    P   S +    S C +++V Y G+CY   +  M++ +A + C + GA L  +++  E +F+           + IWIGL    T  L  W  ++ +HV +  W            L  +P + T   + C +++   G   D+   + H       +CKK
Sbjct:  278 LWIGLNSLDFESGWQWSNGNPFRYLNWAP--GHPSLEPGLNC-VALNAGKASKWESMACNKKLGYICR----KGNSTSTITP---SGVKDQPSFCPTTWVPYSGHCYSIRRNKMMWRDALSACHKDGAELASIHNIEEHSFI--ISQSGYTPTDEIWIGLNDQKTQNLFEW--SDRTHVTFAKW------------LVGEPSHATNLREDCVLMKGKDGKWADHMCEKEH-----DFICKK 487          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Nematostella
Match: EDO46964 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP4])

HSP 1 Score: 55.0694 bits (131), Expect = 6.765e-9
Identity = 37/119 (31.09%), Postives = 58/119 (48.74%), Query Frame = 2
Query: 2219 CGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILR-NWTTTNSSHVYYTHW-----NTLGSYENS---YTYLYDDPKYK 2548
            C + +V  + +CY  ++  M + +A   C ++G +L+ +    E  FV     KQ  S NR+WIGLK + T   +  W   +SS   YT W     N  G+ E+    YT+   DP+ K
Sbjct:    1 CPAGWVRLNRSCYKADQTIMNWADARTACGKLGGDLVKITSEQENTFVYELSRKQAPSRNRMWIGLKRNPTTPTKFEW--FDSSRPLYTKWWTGEPNNHGASEDCGEIYTFPLPDPRAK 117          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: mrc2 (mannose receptor C type 2 [Source:NCBI gene;Acc:101168215])

HSP 1 Score: 61.2326 bits (147), Expect = 7.034e-9
Identity = 53/239 (22.18%), Postives = 104/239 (43.51%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEIL--KSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKK 2650
            +WIGL +   +    WS+    + L  +      ++EE  + +   ++    GRW       + P++C+  P+  ++ F     T+S+       C   +  +   CY  N +   +N A   C+++ ANL  ++   E  F+   L K I   +++WIGL    T++  ++  T+ + V +T+W+      N++    +D       C  +    G  +D     S C + + S+CKK
Sbjct:  299 LWIGLNDLDISGGWQWSDSSPLKYLNWEKEQPNHADEENCVVIRTESS----GRWQNRDCSVDLPYVCKKRPNATMDPF----TTDSWTDDEKYECDVGWQAFQAGCYKLNSEKTDWNAAQKNCQKVEANLASIHTLPELEFITRSLRKDI---DQLWIGLH--DTDMQMDFQWTDHTPVIFTYWHPF--EPNNFRNTPED-------CVSIWGAEGRWDD-----SPCNLTLPSICKK 510          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: mrc1a (mannose receptor C-type 1 [Source:NCBI gene;Acc:101161518])

HSP 1 Score: 60.4622 bits (145), Expect = 1.222e-8
Identity = 63/263 (23.95%), Postives = 102/263 (38.78%), Query Frame = 2
Query: 1940 IWIGLYEHRETKQLLWSNQKSFEILK-SPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRY 2725
            +WIGL          WSN   F  L   P + SS      A   + N  +  +W   A  K   +ICR           ++ N      K  S C S +V Y GNCYF  +   ++ +A   C++ G +L  ++   E++FV +        +  +WIG       +L  W  ++ S V +T W+T G   +   +  D        C ++R   G   D+   + H       +CKK   +     +Q   N G  +   R+
Sbjct:  277 LWIGLNSLDFESGWQWSNGNPFRYLNWGPGHPSSEPGLNCA---TINAGKASKWESNACTKKLGYICRKG---------NSTNLPPPPIKGPSFCPSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDM--LWIGFNDQRNQLLFEW--SDHSQVTFTQWDT-GEPSHIINHQED--------CVLIRGKDGKWADHTCEKMH-----GYICKKKASTTMSEGNQEEVNPGCKLGSFRF 509          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: ly75 (lymphocyte antigen 75 [Source:NCBI gene;Acc:101158591])

HSP 1 Score: 53.9138 bits (128), Expect = 1.335e-6
Identity = 29/109 (26.61%), Postives = 55/109 (50.46%), Query Frame = 2
Query: 2105 LARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKP---MLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKV 2422
            L+ ++ FPF+C       + + + NP          ++C ++ + +   CY    KP     F  AN+ C+ +G  L+ + D  E++F+   L K + ++ +IWIGLK+
Sbjct:  795 LSCLQQFPFVCE---RHNITSVERNPLIPQ---PGGTSCKANALPFRNKCYTLMVKPDEPKPFKAANDDCQSVGGTLVTIADQVEQDFISTLLPK-MKNMGKIWIGLKI 896          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: ENSORLT00000027287.1 (pep primary_assembly:ASM223467v1:21:5848170:5863319:1 gene:ENSORLG00000024106.1 transcript:ENSORLT00000027287.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 6.364e-6
Identity = 36/135 (26.67%), Postives = 62/135 (45.93%), Query Frame = 2
Query: 2099 LMLARMKNFPFICRVDPHKALNTFKDN---PNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNT 2494
            L+LA +     +C +   K+++  K N    N     +KT   C   ++ +  +CYFF+ +   ++ A   C+  GA+L+++N   E  FV A L KQ      +WIGL    T +   W   + S +    W +
Sbjct:   10 LLLAGLVILGLLCEL--QKSIDKEKQNLLVSNNVLIFWKT--GCPEKWIRFGSSCYFFSGESKTWDEAREFCRARGADLVVINTEGENLFVSA-LKKQ-----DVWIGLT--DTVLEGTWKWVDGSPLTLQFWGS 132          
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Match: mrc1b (macrophage mannose receptor 1 [Source:NCBI gene;Acc:101163523])

HSP 1 Score: 51.2174 bits (121), Expect = 9.243e-6
Identity = 44/145 (30.34%), Postives = 65/145 (44.83%), Query Frame = 2
Query: 2228 SFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQI-LSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYK--TDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKT 2653
             ++E+ GN YF N+K +    A   CK+   +L  +N ++ EN   AFL K+I  S    WIGL VD     R W   + S V Y  W+               P YK   + C ++R   GV  D      +C    +S+CK++
Sbjct:  764 GWLEWKGNQYFINQKSLSMEEARQFCKQFHGDLATIN-SYNEN---AFLWKRISRSHGNYWIGLNVDFDGT-RVW--MDHSEVIYQQWDE------------GQPDYKHYDEQCVIMRVEDGVWHD-----YNCGFEHKSICKRS 884          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000023904.1 (SMESG000023904.1)

HSP 1 Score: 887.871 bits (2293), Expect = 0.000e+0
Identity = 437/438 (99.77%), Postives = 437/438 (99.77%), Query Frame = 2
Query: 1937 WIWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRYNLNVRQTVNNELCVRWDLVMLKNPYVYHLNTQLISSMPFNKDGYISYSLDRCSEFRYGSKIYGYSCYIFKDKQYILKDCLFQHCLXXXXXXXXXXXGHPFMIVMSLILIISAFCFIIYVYRKNLLSLYRVRVFMASILGRYQPDWLRESHSRSQVGTPGGTGFVNPIYTPLESRY 3250
            WIWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRYNLNVRQTVNNELCVRWDLVMLKNPYVYHLNTQLISSMPFNKDGYISYSLDRCSEFRYGSKIYGYSCYIFKDKQYILKDCLFQHCLS DKSSTKTSSGHPFMIVMSLILIISAFCFIIYVYRKNLLSLYRVRVFMASILGRYQPDWLRESHSRSQVGTPGGTGFVNPIYTPLESRY
Sbjct:  108 WIWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRYNLNVRQTVNNELCVRWDLVMLKNPYVYHLNTQLISSMPFNKDGYISYSLDRCSEFRYGSKIYGYSCYIFKDKQYILKDCLFQHCLSNDKSSTKTSSGHPFMIVMSLILIISAFCFIIYVYRKNLLSLYRVRVFMASILGRYQPDWLRESHSRSQVGTPGGTGFVNPIYTPLESRY 545          

HSP 2 Score: 82.0333 bits (201), Expect = 1.132e-15
Identity = 38/42 (90.48%), Postives = 39/42 (92.86%), Query Frame = 1
Query:  913 KLFEQTLTWPEAIRKCKSLFSPPLPVANLASFDNLQQYGKLI 1038
            KLFEQTLTWPEAIRKCKSLF PPLPVANLASFDNLQQY  L+
Sbjct:   57 KLFEQTLTWPEAIRKCKSLFRPPLPVANLASFDNLQQYDSLL 98          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000044789.1 (SMESG000044789.1)

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 436/438 (99.54%), Postives = 437/438 (99.77%), Query Frame = 2
Query: 1937 WIWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRYNLNVRQTVNNELCVRWDLVMLKNPYVYHLNTQLISSMPFNKDGYISYSLDRCSEFRYGSKIYGYSCYIFKDKQYILKDCLFQHCLXXXXXXXXXXXGHPFMIVMSLILIISAFCFIIYVYRKNLLSLYRVRVFMASILGRYQPDWLRESHSRSQVGTPGGTGFVNPIYTPLESRY 3250
            WIWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRYNLNVRQTVNNELCVRWDLVMLKNPYVYHLNTQLISSMPFNKDGYISYSLDRCSEFRYGSKIYGYSCYIFKDKQYILKDCLFQHCLS DKSSTKTSSGHPFMIV+SLILIISAFCFIIYVYRKNLLSLYRVRVFMASILGRYQPDWLRESHSRSQVGTPGGTGFVNPIYTPLESRY
Sbjct:  108 WIWIGLYEHRETKQLLWSNQKSFEILKSPFNGSSNEEYTLAMEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKTNSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENFVRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYENSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLISQNHGFSQNPQNCGTSINGTRYNLNVRQTVNNELCVRWDLVMLKNPYVYHLNTQLISSMPFNKDGYISYSLDRCSEFRYGSKIYGYSCYIFKDKQYILKDCLFQHCLSNDKSSTKTSSGHPFMIVISLILIISAFCFIIYVYRKNLLSLYRVRVFMASILGRYQPDWLRESHSRSQVGTPGGTGFVNPIYTPLESRY 545          

HSP 2 Score: 83.9593 bits (206), Expect = 3.150e-16
Identity = 39/42 (92.86%), Postives = 40/42 (95.24%), Query Frame = 1
Query:  913 KLFEQTLTWPEAIRKCKSLFSPPLPVANLASFDNLQQYGKLI 1038
            KLFEQTLTWPEAIRKCKSLFSPPLPVANLASFDNLQQY  L+
Sbjct:   57 KLFEQTLTWPEAIRKCKSLFSPPLPVANLASFDNLQQYDSLL 98          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000063572.1 (SMESG000063572.1)

HSP 1 Score: 166.777 bits (421), Expect = 8.998e-42
Identity = 92/149 (61.74%), Postives = 109/149 (73.15%), Query Frame = 1
Query:  295 LVSTYLCQLETKHSHFKIDTVRTDSDYKLLCSPINLENGRNTIDI*FVRYNVINHKPRELYLKNVQLKDVGKYVCRSREKVSSRFI-DRKISITN*D*IIAKP*NILHIVISQLDSTHNTIRLEERQNLDIEYSFTHWSRNKCNVQLIK 738
            LVS Y CQ ETK +  KI+TVR  SD KL+CS +N+EN +N IDI +   NVI  K RELYLKNVQLKDVGKYVCRS EK+ S  +   K +IT  D ++ +  NI +IVISQLD+ HNTIRLEE QNLDIE S T+WSRN+ NVQ IK
Sbjct:    2 LVSIYSCQPETKPTPLKIETVRIGSDIKLVCSAVNVENEKNIIDIHWEHNNVIIGKGRELYLKNVQLKDVGKYVCRSSEKIESGLVAGEKSTITEQDQVVVEQENIPNIVISQLDAAHNTIRLEETQNLDIECSVTNWSRNEYNVQWIK 150          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000026481.1 (SMESG000026481.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.664e-38
Identity = 89/141 (63.12%), Postives = 102/141 (72.34%), Query Frame = 1
Query:  319 LETKHSHFKIDTVRTDSDYKLLCSPINLENGRNTIDI*FVRYNVINHKPRELYLKNVQLKDVGKYVCRSREKVSSRFI-DRKISITN*D*IIAKP*NILHIVISQLDSTHNTIRLEERQNLDIEYSFTHWSRNKCNVQLIK 738
            LETK +  KI+TVR  SD KLLCS  N+ N RN IDI + R NVI  K RELYLKNVQLKDVGKYVCRS EKV S FI   K +IT  D ++ +  NI HIVISQL  +HNTIRLEE +NLDIE S T+WSRN+ + Q IK
Sbjct:  218 LETKPTPLKIETVRIGSDIKLLCSAENMGNQRNIIDIHWERNNVIIGKGRELYLKNVQLKDVGKYVCRSSEKVESGFIAGEKSTITEQDQVLVEQENIPHIVISQLGESHNTIRLEETENLDIECSVTNWSRNEYDAQWIK 358          
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Match: SMESG000026481.1 (SMESG000026481.1)

HSP 1 Score: 157.147 bits (396), Expect = 2.290e-38
Identity = 89/141 (63.12%), Postives = 102/141 (72.34%), Query Frame = 1
Query:  319 LETKHSHFKIDTVRTDSDYKLLCSPINLENGRNTIDI*FVRYNVINHKPRELYLKNVQLKDVGKYVCRSREKVSSRFI-DRKISITN*D*IIAKP*NILHIVISQLDSTHNTIRLEERQNLDIEYSFTHWSRNKCNVQLIK 738
            LETK +  KI+TVR  SD KLLCS  N+ N RN IDI + R NVI  K RELYLKNVQLKDVGKYVCRS EKV S FI   K +IT  D ++ +  NI HIVISQL  +HNTIRLEE +NLDIE S T+WSRN+ + Q IK
Sbjct:  736 LETKPTPLKIETVRIGSDIKLLCSAENMGNQRNIIDIHWERNNVIIGKGRELYLKNVQLKDVGKYVCRSSEKVESGFIAGEKSTITEQDQVLVEQENIPHIVISQLGESHNTIRLEETENLDIECSVTNWSRNEYDAQWIK 876          
The following BLAST results are available for this feature:
BLAST of Macrophage mannose receptor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
KLRF13.122e-632.05killer cell lectin like receptor F1 [Source:HGNC S... [more]
MRC16.009e-622.78mannose receptor C-type 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mrc1a4.316e-1125.49mannose receptor, C type 1a [Source:ZFIN;Acc:ZDB-G... [more]
mrc27.053e-923.20mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
mrc27.356e-923.20mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cd209c3.846e-622.75CD209c antigen [Source:MGI Symbol;Acc:MGI:2157945][more]
back to top
BLAST of Macrophage mannose receptor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage mannose receptor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q1HG541.213e-1026.79Mannose receptor, C type 1a OS=Anabas testudineus ... [more]
A0A484C6Y43.891e-1026.42Uncharacterized protein (Fragment) OS=Perca flaves... [more]
A0A5J5CFJ76.407e-1026.79Uncharacterized protein OS=Etheostoma spectabile O... [more]
W4Y9R31.118e-927.34Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A3Q2PE571.714e-927.27Mannose receptor, C type 1a OS=Fundulus heteroclit... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc21.229e-923.20mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
mrc21.230e-923.20mannose receptor, C type 2 [Source:ZFIN;Acc:ZDB-GE... [more]
pla2r11.451e-924.32phospholipase A2 receptor 1 [Source:ZFIN;Acc:ZDB-G... [more]
mrc1a9.529e-924.90mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
mrc1a1.116e-824.90mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO469646.765e-931.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrc27.034e-922.18mannose receptor C type 2 [Source:NCBI gene;Acc:10... [more]
mrc1a1.222e-823.95mannose receptor C-type 1 [Source:NCBI gene;Acc:10... [more]
ly751.335e-626.61lymphocyte antigen 75 [Source:NCBI gene;Acc:101158... [more]
ENSORLT00000027287.16.364e-626.67pep primary_assembly:ASM223467v1:21:5848170:586331... [more]
mrc1b9.243e-630.34macrophage mannose receptor 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Macrophage mannose receptor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023904.11.132e-1599.77SMESG000023904.1[more]
SMESG000044789.13.150e-1699.54SMESG000044789.1[more]
SMESG000063572.18.998e-4261.74SMESG000063572.1[more]
SMESG000026481.11.664e-3863.12SMESG000026481.1[more]
SMESG000026481.12.290e-3863.12SMESG000026481.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000163 ID=SMED30000163|Name=Macrophage mannose receptor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3544bp
TTTTATTGGCGTTATCGTTTAATTTTCGACAAAAATTGTTAAAGTGACAT
TTTTAAAGAAATTTGGATATGGACAGTAATTAATCAGTGTAGTGCAACAT
TTAATTTTTAATTTATTTTACTAAATTTAAATTAAATTACAAATGTGTTA
TTAAAAATAACAAATATTTAATTTTGTTTAAATATTTTTGATATTTTAAC
ATTATCGTACCGACAACTCTTCAATATCATCAACCATTCATCGATAATTT
TTCACATCAAAACTCAATTGTGGAAATGATTGTTTTGTTTAAGGCTCGTT
TCCACATATTTATGCCAGCTTGAAACAAAACACAGTCATTTCAAAATTGA
TACTGTTCGAACTGATTCAGATTACAAATTACTGTGTTCTCCTATTAACC
TCGAAAATGGCAGAAATACCATTGATATATGATTTGTACGCTACAATGTC
ATCAACCACAAACCTAGAGAATTATACTTGAAGAATGTCCAATTAAAAGA
TGTTGGAAAGTATGTTTGCAGATCAAGAGAAAAAGTATCATCACGATTTA
TTGATAGAAAAATATCCATAACTAATTAAGATTGAATAATAGCAAAACCA
TAAAACATTCTTCATATTGTCATTTCTCAACTCGATTCTACTCACAATAC
TATCAGACTTGAAGAAAGGCAAAATCTTGATATCGAATACTCCTTCACCC
ACTGGTCAAGAAACAAATGCAATGTTCAATTAATCAAATTCAACGTATTG
GATTTATTACAAATATATTTTATTATAAATATTATTGTGTTTCTACAATC
AGTTATATATTAAGTAGCATTTTTCAAGTATTATTATATTTTTTACTGAA
TTATTTAATGAAACAATTGTTCTTTATTATTGTAAAACCATAAATTTATA
TTATATTTCATCAAGTTATTTGAACAAACTTTAACATGGCCCGAAGCTAT
CCGTAAATGTAAGTCCTTGTTTAGTCCTCCTCTGCCTGTAGCTAATTTGG
CAAGTTTTGATAATTTACAACAATATGGTAAGTTAATTCTTTTTAAAAAT
TTCTAATTTTCCATTTATTAACTATTTTTATTTTATTTTAATTTTCAGCT
AGAAAATGATAATTGTAGAAATTTATAATTATTATACATTATTATTACGA
CTCAGTTTTTTTTTGAATTTAATATTTAAGGATAATTTTATGCCCTGACT
TTCAATTATTGTTTGAAATTTCATACTAGGAGAAAGTTTTACTTAGGTCA
CTAAATCATCCCATTTTCTATAATGATTGAAGGTACAGGCCATACTTATA
AATAAATTTAAAACACATCTTGCAATTGTATTTTTCTCACCATACCTATT
TGCATTTTATCAGTGTTAATAAATATTACATAGTCACTCGAAATACATAA
AATAACGTGAAATGGTAATAATTTAAATTAATATTATAAAATAGAACCAA
TTCAATTATATTAATATTGAGCGTTACGATTTTGAATGATAATTTTTTAT
TTACAAAACTTTAATTGTTGGCATCAACAATTCACAACCCGAACATCGTT
TATAATGATTTGCGACCAATATTTTCACAGTTAATTCATTTTCATTTATC
TTTATTTCTATTCCAACCATTGGCCCCGTCAAGATTTGGTGTAAGATGTA
AAAACAATTATTGATTTTACCAAATGTCAGGCTTACAAATTGCTTCAAAA
ATAGAAAACGTCTATGGAAAATCTAGCACATTGAAAAGAGTTAAAACTTG
GACAAGATTCACTATGTACGATGAGTGTACATAAAAAATAAATGCCAATA
TTCACGATTTTTTAAACGAAATCACATAGAATACAATTATAATTTGATAA
AAATGAATAACAATAAAGATATTTTAATTTGATAGAATTTATCTTTAGAT
TCACTATTGAGTTCTTTAAGAAATTTTAATAACAGTTGGATATGGATAGG
TTTATATGAACATAGAGAAACTAAACAACTTTTATGGTCAAATCAAAAAT
CTTTCGAAATATTGAAATCACCTTTTAATGGATCCAGCAACGAGGAGTAT
ACATTGGCAATGGAAATATCAACAAATCCGTTTCGCAATGGTCGTTGGTT
AATGTTAGCTCGCATGAAAAATTTTCCATTTATTTGCCGCGTTGATCCTC
ATAAAGCATTGAATACTTTCAAAGATAATCCCAATACTGAATCGTTCATT
TATAAAACAAATAGCGCTTGTGGATCATCATTTGTAGAATATGATGGAAA
TTGCTATTTTTTTAATAAGAAACCAATGCTTTTTAATAATGCAAACAATA
GATGTAAAGAGATGGGTGCAAATCTACTTATTCTTAATGATACATTTGAA
GAAAATTTTGTTAGAGCGTTTCTTGCTAAGCAAATTTTATCTTTGAATCG
GATATGGATAGGTCTAAAAGTAGATTCTACCAACATATTGCGGAATTGGA
CCACAACTAATTCTTCACATGTGTATTATACTCACTGGAATACACTTGGA
TCGTATGAAAATTCTTATACTTACTTATACGATGATCCAAAATACAAAAC
AGACGGATGTTATGTTTTAAGATTCAATCGTGGCGTCTCGGAAGATAATG
GAATGGCTAGATCACATTGTACCGTACGAATTCAATCGGTTTGCAAAAAA
ACCTTAATTTCTCAAAATCATGGATTTTCCCAAAATCCTCAAAATTGCGG
AACTTCAATAAATGGTACTCGATATAATCTTAATGTTAGACAAACTGTTA
ATAATGAACTATGTGTAAGGTGGGATTTAGTAATGTTAAAGAATCCTTAT
GTTTATCATTTAAACACACAACTAATTTCATCAATGCCTTTTAATAAAGA
CGGATATATTTCTTATTCGCTGGATAGATGTTCAGAATTCAGATATGGAA
GTAAAATCTACGGCTATAGCTGTTATATTTTTAAAGATAAACAATATATT
TTGAAAGATTGCTTATTCCAACATTGTCTATCAAAGGATAAATCAAGTAC
AAAAACTTCCTCTGGCCATCCTTTTATGATTGTGATGTCATTGATCTTAA
TCATTTCGGCATTTTGTTTCATAATTTATGTTTACAGAAAGAATCTATTA
TCTTTATATAGAGTTCGAGTATTTATGGCAAGTATTTTGGGTCGCTACCA
ACCTGATTGGTTGAGGGAGTCTCATAGTCGATCACAGGTTGGAACACCCG
GTGGAACGGGATTTGTCAATCCAATCTATACACCACTTGAATCTCGCTAC
TAAATTTTCATCAAGTGTTAATTTATAATTTTTTATGTTTTTACATAAAT
TGTTTACTACAATTTTATCACTATACGTTACAATCTTATTTTCTATCAAT
ACTTTCTCACTTCTTTCTTGGACTTATGCGTTTTAGTCCGTTGCGTTATC
ATTATTTTTGAATGTCATATTGGTTTGTATCTATATAATTGCATTTGCAT
AAATATTCTTGTAACGTTCCGAAAATTTTGTGATTTGGAATTCTGGTAAA
TAAATATGTTTTTATGGATTCTTAGTATCTTTATGTATTTGTCC
back to top

protein sequence of SMED30000163-orf-1

>SMED30000163-orf-1 ID=SMED30000163-orf-1|Name=SMED30000163-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=398bp
MEISTNPFRNGRWLMLARMKNFPFICRVDPHKALNTFKDNPNTESFIYKT
NSACGSSFVEYDGNCYFFNKKPMLFNNANNRCKEMGANLLILNDTFEENF
VRAFLAKQILSLNRIWIGLKVDSTNILRNWTTTNSSHVYYTHWNTLGSYE
NSYTYLYDDPKYKTDGCYVLRFNRGVSEDNGMARSHCTVRIQSVCKKTLI
SQNHGFSQNPQNCGTSINGTRYNLNVRQTVNNELCVRWDLVMLKNPYVYH
LNTQLISSMPFNKDGYISYSLDRCSEFRYGSKIYGYSCYIFKDKQYILKD
CLFQHCLSKDKSSTKTSSGHPFMIVMSLILIISAFCFIIYVYRKNLLSLY
RVRVFMASILGRYQPDWLRESHSRSQVGTPGGTGFVNPIYTPLESRY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR001304C-type_lectin-like
IPR016186C-type_lectin-like/link_sf
IPR016187CTDL_fold
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0030246carbohydrate binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001304C-type lectin-likeSMARTSM00034CLECT_2coord: 54..196
e-value: 2.1E-13
score: 60.5
IPR001304C-type lectin-likePFAMPF00059Lectin_Ccoord: 72..197
e-value: 1.4E-9
score: 38.7
IPR001304C-type lectin-likePROSITEPS50041C_TYPE_LECTIN_2coord: 61..196
score: 14.605
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 44..209
e-value: 4.4E-20
score: 74.0
NoneNo IPR availableCDDcd00037CLECTcoord: 64..197
e-value: 2.70598E-13
score: 63.7929
NoneNo IPR availableTMHMMTMhelixcoord: 320..342
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 54..197