Dipeptidyl peptidase 3

Overview
NameDipeptidyl peptidase 3
Smed IDSMED30000158
Length (bp)2383
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dipeptidyl peptidase 3 (SMED30000158) t-SNE clustered cells

Violin plots show distribution of expression levels for Dipeptidyl peptidase 3 (SMED30000158) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dipeptidyl peptidase 3 (SMED30000158) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dipeptidyl peptidase 3 (SMED30000158) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000158

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000158SMESG000079740.1 Contig3021GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30000158SMESG000079740.1 dd_Smed_v4_1031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000158SMESG000079740.1 dd_Smed_v4_1031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000158SMESG000079740.1 dd_Smed_v4_1031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000158SMESG000079740.1 dd_Smed_v4_1031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000158SMESG000079740.1 dd_Smed_v4_1031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30000158SMESG000079740.1 dd_Smed_v6_1031_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000158SMESG000079740.1 dd_Smed_v4_1031_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Human
Match: DPP3 (dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGNC:3008])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 346/722 (47.92%), Postives = 471/722 (65.24%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIEN-GITKYEVRQASSLKNVNRRLEISNPSHNIEV--------------KLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRF--KDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQCVVCEDIEKSP-KLIEYPTTSEGMIQSFVDRFSGKSGDLADI 2202
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + +E  +R+I  S+A +   E+ R ++     L+FSL  R + +GLG+EGI+TY+S NCTM+DAK  Q ++D  N+SAYNTR+FK+++  G   YEVR AS L         S PS + EV              ++  GDY  +++ +V +L+KAK  A N ++  M+  YIESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK MS KFE LV  A  +LKELPWP  +EKDKFL PDFTSLD++ F  SG+P GINIPNYDD+RQ  GFKNVSLGNVL   +  +  K  F+  + K+++I     +F+VQVGLHEL+GHGSGKLF   + G +NFD     +  T   I SWY+  ETWDS F+TIAS +EECRAE VGLYLC   ++ +IFGF G  +  D+I+VNWL+M+++ L+++EFYTPE   WRQAH QARFVIL+VLLEAG+ L+ I   T  DGRPD  + L+RSKI +VG+P + +FL  LQ  KST +V  G   +  Y+ +     E FL LR+ VL RK  R + +Q      +E S  +L+EY  ++ G+I+SF +RF     +L +I
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEVRGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLG--------SEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQYIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASAEQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQREKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGA-DAEDVIYVNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNT--RLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEI 714          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Human
Match: DPP3 (dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGNC:3008])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 346/722 (47.92%), Postives = 471/722 (65.24%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIEN-GITKYEVRQASSLKNVNRRLEISNPSHNIEV--------------KLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRF--KDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQCVVCEDIEKSP-KLIEYPTTSEGMIQSFVDRFSGKSGDLADI 2202
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + +E  +R+I  S+A +   E+ R ++     L+FSL  R + +GLG+EGI+TY+S NCTM+DAK  Q ++D  N+SAYNTR+FK+++  G   YEVR AS L         S PS + EV              ++  GDY  +++ +V +L+KAK  A N ++  M+  YIESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK MS KFE LV  A  +LKELPWP  +EKDKFL PDFTSLD++ F  SG+P GINIPNYDD+RQ  GFKNVSLGNVL   +  +  K  F+  + K+++I     +F+VQVGLHEL+GHGSGKLF   + G +NFD     +  T   I SWY+  ETWDS F+TIAS +EECRAE VGLYLC   ++ +IFGF G  +  D+I+VNWL+M+++ L+++EFYTPE   WRQAH QARFVIL+VLLEAG+ L+ I   T  DGRPD  + L+RSKI +VG+P + +FL  LQ  KST +V  G   +  Y+ +     E FL LR+ VL RK  R + +Q      +E S  +L+EY  ++ G+I+SF +RF     +L +I
Sbjct:   23 TQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEVRGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLG--------SEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQYIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASAEQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQREKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGA-DAEDVIYVNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNT--RLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEI 733          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Human
Match: DPP3 (dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGNC:3008])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 346/722 (47.92%), Postives = 471/722 (65.24%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIEN-GITKYEVRQASSLKNVNRRLEISNPSHNIEV--------------KLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRF--KDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQCVVCEDIEKSP-KLIEYPTTSEGMIQSFVDRFSGKSGDLADI 2202
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + +E  +R+I  S+A +   E+ R ++     L+FSL  R + +GLG+EGI+TY+S NCTM+DAK  Q ++D  N+SAYNTR+FK+++  G   YEVR AS L         S PS + EV              ++  GDY  +++ +V +L+KAK  A N ++  M+  YIESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK MS KFE LV  A  +LKELPWP  +EKDKFL PDFTSLD++ F  SG+P GINIPNYDD+RQ  GFKNVSLGNVL   +  +  K  F+  + K+++I     +F+VQVGLHEL+GHGSGKLF   + G +NFD     +  T   I SWY+  ETWDS F+TIAS +EECRAE VGLYLC   ++ +IFGF G  +  D+I+VNWL+M+++ L+++EFYTPE   WRQAH QARFVIL+VLLEAG+ L+ I   T  DGRPD  + L+RSKI +VG+P + +FL  LQ  KST +V  G   +  Y+ +     E FL LR+ VL RK  R + +Q      +E S  +L+EY  ++ G+I+SF +RF     +L +I
Sbjct:   24 TQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEVRGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLG--------SEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQYIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASAEQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQREKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGA-DAEDVIYVNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNT--RLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEI 734          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Human
Match: DPP3 (dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGNC:3008])

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 330/722 (45.71%), Postives = 449/722 (62.19%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIEN-GITKYEVRQASSLKNVNRRLEISNPSHNIEV--------------KLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRF--KDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQCVVCEDIEKSP-KLIEYPTTSEGMIQSFVDRFSGKSGDLADI 2202
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E +                               +E  +R+I  S+A +   E+ R ++     L+FSL  R + +GLG+EGI+TY+S NCTM+DAK  Q ++D  N+SAYNTR+FK+++  G   YEVR AS L         S PS + EV              ++  GDY  +++ +V +L+KAK  A N ++  M+  YIESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK MS KFE LV  A  +LKELPWP  +EKDKFL PDFTSLD++ F  SG+P GINIPNYDD+RQ  GFKNVSLGNVL   +  +  K  F+  + K+++I     +F+VQVGLHEL+GHGSGKLF   + G +NFD     +  T   I SWY+  ETWDS F+TIAS +EECRAE VGLYLC   ++ +IFGF G  +  D+I+VNWL+M+++ L+++EFYTPE   WRQAH QARFVIL+VLLEAG+ L+ I   T  DGRPD  + L+RSKI +VG+P + +FL  LQ  KST +V  G   +  Y+ +     E FL LR+ VL RK  R + +Q      +E S  +L+EY  ++ G+I+SF +RF     +L +I
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEY------------------------------QEKLERVILGSEAAQQHPEEVRGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLG--------SEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQYIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASAEQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQREKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGA-DAEDVIYVNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNT--RLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEI 684          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Human
Match: DPP3 (dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGNC:3008])

HSP 1 Score: 172.555 bits (436), Expect = 9.490e-49
Identity = 82/198 (41.41%), Postives = 126/198 (63.64%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVF 699
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + +E  +R+I  S+A +   E+ R ++     L+FSL  R + +GLG+EGI+TY+S NCTM+DAK  Q ++D  N+SAYNTR+F
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEVRGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLF 201          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Celegans
Match: dpt-1 (Dipeptidyl peptidase 3 [Source:UniProtKB/TrEMBL;Acc:Q9U3K7])

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 320/714 (44.82%), Postives = 459/714 (64.29%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKN-VNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFK-DGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRDSSIF 2241
            S YI+  E PV  LD  ++F+ L+E EKKYS  + KA + GAL  ++Q SPES  +F +   LFK ++ E        +   + + + F  Y A  Y N GNY+ FGD+K +P +++     +++ S A  TDEK  + ++ ++ +I SL S   Q+G G++G++ Y+S N T  DA++I  +  + N+ ++N+R+FK++  +G T Y ++ ASS +  V+  +E         V++V GDY  +M+     L KA   A N+N++ M++ Y+E F+ G I  HK+GS+YWI D GP VE+YIGFIE+YRDP G R EFE F+A VNKE S+KF++LV  A +ILK LPW  +YEKD FL+PDFT+LD+I F  SG+P GINIPNYDDIRQN GFKNVSLGNV+ ++ K  K NF+    +E+  K  + +FEVQVGLHEL+GHGSGKLF    DG +NFD+N  KD+IT  PI +WY+  ETW S F  +AS +EECRAE VG  LC   +I +IFG++G +   ++ +VNWLS I++ L+++EFY  EQKKW QAHC AR+V+ +V+LEAGQ  +KIE    EDG+PDL   L+R+ I++VGRP +  FL+ LQ YKST + + G + F  Y ++ +  LH R+I + R+ PR + +Q    E       L+ Y +   G+IQSFV+R+   + +     LY  WK D   F
Sbjct:    6 SLYIIPNETPVCQLDAADAFKTLSEKEKKYSHYVAKASFDGALAVFLQVSPESAPIFYVLYRLFKSESVEQLKEKALSVGFTDAEWQAFLVYAAAFYSNSGNYKGFGDTKIVPGVEQTKIRALLEKS-AVGTDEKVMKTWESVEKVIGSLESNELQLGFGDKGVTCYHSSNVTKADAEKIDRFFKQRNVESWNSRLFKEVGSDGKTTYTIKLASSEEGIVSEAVEFEGDV----VQIVRGDYALIMKRTHEWLDKAIPTAANKNQEEMLRKYVEHFKKGDIALHKDGSRYWIKDVGPAVESYIGFIENYRDPAGTRSEFEGFVAAVNKETSKKFQTLVANAENILKRLPWGTDYEKDTFLKPDFTALDVIAFGSSGIPAGINIPNYDDIRQNEGFKNVSLGNVISAQPKQ-KMNFLDEHDEELMFKYHKDSFEVQVGLHELLGHGSGKLFQKNLDGTFNFDTNKVKDIITGAPIATWYEPGETWSSKFGPLASAYEECRAEAVGYVLCCDADILEIFGYTG-DLAQEVKYVNWLSEIRAGLLALEFYQAEQKKWGQAHCYARYVLTKVVLEAGQGFVKIEETKGEDGKPDLHFKLDRNLIDSVGRPAVNTFLAKLQAYKSTGDFEGGKRLFESYGVVGDTELHWRDICIARRKPRRLFVQPNTVEK-NGEISLVTYSSDVSGVIQSFVERYEKSAVE----DLYACWKDDQKWF 707          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Celegans
Match: dpt-1 (Dipeptidyl peptidase 3 [Source:UniProtKB/TrEMBL;Acc:Q9U3K7])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 320/714 (44.82%), Postives = 459/714 (64.29%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKN-VNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFK-DGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRDSSIF 2241
            S YI+  E PV  LD  ++F+ L+E EKKYS  + KA + GAL  ++Q SPES  +F +   LFK ++ E        +   + + + F  Y A  Y N GNY+ FGD+K +P +++     +++ S A  TDEK  + ++ ++ +I SL S   Q+G G++G++ Y+S N T  DA++I  +  + N+ ++N+R+FK++  +G T Y ++ ASS +  V+  +E         V++V GDY  +M+     L KA   A N+N++ M++ Y+E F+ G I  HK+GS+YWI D GP VE+YIGFIE+YRDP G R EFE F+A VNKE S+KF++LV  A +ILK LPW  +YEKD FL+PDFT+LD+I F  SG+P GINIPNYDDIRQN GFKNVSLGNV+ ++ K  K NF+    +E+  K  + +FEVQVGLHEL+GHGSGKLF    DG +NFD+N  KD+IT  PI +WY+  ETW S F  +AS +EECRAE VG  LC   +I +IFG++G +   ++ +VNWLS I++ L+++EFY  EQKKW QAHC AR+V+ +V+LEAGQ  +KIE    EDG+PDL   L+R+ I++VGRP +  FL+ LQ YKST + + G + F  Y ++ +  LH R+I + R+ PR + +Q    E       L+ Y +   G+IQSFV+R+   + +     LY  WK D   F
Sbjct:   44 SLYIIPNETPVCQLDAADAFKTLSEKEKKYSHYVAKASFDGALAVFLQVSPESAPIFYVLYRLFKSESVEQLKEKALSVGFTDAEWQAFLVYAAAFYSNSGNYKGFGDTKIVPGVEQTKIRALLEKS-AVGTDEKVMKTWESVEKVIGSLESNELQLGFGDKGVTCYHSSNVTKADAEKIDRFFKQRNVESWNSRLFKEVGSDGKTTYTIKLASSEEGIVSEAVEFEGDV----VQIVRGDYALIMKRTHEWLDKAIPTAANKNQEEMLRKYVEHFKKGDIALHKDGSRYWIKDVGPAVESYIGFIENYRDPAGTRSEFEGFVAAVNKETSKKFQTLVANAENILKRLPWGTDYEKDTFLKPDFTALDVIAFGSSGIPAGINIPNYDDIRQNEGFKNVSLGNVISAQPKQ-KMNFLDEHDEELMFKYHKDSFEVQVGLHELLGHGSGKLFQKNLDGTFNFDTNKVKDIITGAPIATWYEPGETWSSKFGPLASAYEECRAEAVGYVLCCDADILEIFGYTG-DLAQEVKYVNWLSEIRAGLLALEFYQAEQKKWGQAHCYARYVLTKVVLEAGQGFVKIEETKGEDGKPDLHFKLDRNLIDSVGRPAVNTFLAKLQAYKSTGDFEGGKRLFESYGVVGDTELHWRDICIARRKPRRLFVQPNTVEK-NGEISLVTYSSDVSGVIQSFVERYEKSAVE----DLYACWKDDQKWF 745          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Fly
Match: DppIII (gene:FBgn0037580 transcript:FBtr0081840)

HSP 1 Score: 614.764 bits (1584), Expect = 0.000e+0
Identity = 316/697 (45.34%), Postives = 454/697 (65.14%), Query Frame = 1
Query:  106 SSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALF-LLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNVNRRLEISNPSHNI-EVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHF-KDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSL-VSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLH----LREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRF 2172
            ++H+++    P+  LDCK++F+NLTE EK Y+    +A W G LI  +Q SPE+P +F LL +I    + P   A  L E  V+  D   F  Y   V+ N GNY+  GDSK +P + E+ F+ I+K S AY  + +  +I++K+K LI++L SRN+ +G   +GI+TY+S NCT +D++ +  ++    I  Y  R FK +ENG T Y+V+  S  ++    + +    +N  + ++  GDYQ++++ +   L +A+  A NENE  MI+ Y+ SFE GS+D HK GS++WI DKGP++E YIGFIE+YRDP G R EFE F+A+VNKE S KF  LV  A  +++ LPW + YEKD +L+PDFTSLD++ F  SG+P GINIPNYD+IRQ+ GFKNVSLGNVL +  +     F+  E + +  +    AFEVQVGLHEL+GHGSGKLF   ++G YNFD  NTK+L+T  PI  WY   ET+D+ F  I S +EECRAE VGLYL   ++I +IFGF  +   ++II+VNWLS+I + + V++E + P+ K W QAH +ARFVI++VLLEAG+ L+K+E    E G+ +LL+ ++RSKI+TVGR  +G FL+ LQ YKSTA+++   K +  YS ++E   H     R+I L  K PR I +Q       ++  +L  Y  T EG IQS+V+R+
Sbjct:    5 TAHFVLPNTQPIADLDCKSAFENLTEKEKLYAHHFSQASWDGGLIALIQSSPEAPLIFSLLHRIFLAEKIPVLRAKAL-EAGVSADDFTAFLVYACGVFANAGNYKGMGDSKIVPNLSEKQFETIVKASAAYSDEPRVGKIFEKVKNLIYALESRNEILGFAPDGITTYWSDNCTKEDSEIVNAWLTSKRIEPYMCRTFKIVENGQTVYDVKLGSVAESTQDGITLPLEEYNGNKFRVTRGDYQKLLQRVNQHLLQAQKYAANENESKMIEHYVRSFEQGSLDEHKNGSRWWIKDKGPVIETYIGFIETYRDPAGGRAEFEGFVAMVNKESSAKFSELVNRAEKLIEYLPWTEPYEKDSYLKPDFTSLDVLTFAGSGVPAGINIPNYDEIRQDEGFKNVSLGNVLANINRKDPIPFLTEEDQTLMKEYKVKAFEVQVGLHELLGHGSGKLFRIDENGVYNFDKENTKNLVTGEPITKWYLPGETYDTKFGAIGSSYEECRAEAVGLYLSLQRDILEIFGFKDKAEQDNIIYVNWLSLIWNGMGVALEMFNPKSKLWLQAHSRARFVIMKVLLEAGEGLVKVE--ETEKGK-NLLLTVDRSKIDTVGRKALGDFLTKLQVYKSTADIEAASKMYEHYSKVDESGSHPWAKWRDICLAHKKPRMILVQANTAIGQDQKVQLKTYEPTHEGYIQSWVERY 697          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Fly
Match: DppIII (gene:FBgn0037580 transcript:FBtr0081841)

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 316/697 (45.34%), Postives = 454/697 (65.14%), Query Frame = 1
Query:  106 SSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALF-LLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNVNRRLEISNPSHNI-EVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHF-KDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSL-VSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLH----LREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRF 2172
            ++H+++    P+  LDCK++F+NLTE EK Y+    +A W G LI  +Q SPE+P +F LL +I    + P   A  L E  V+  D   F  Y   V+ N GNY+  GDSK +P + E+ F+ I+K S AY  + +  +I++K+K LI++L SRN+ +G   +GI+TY+S NCT +D++ +  ++    I  Y  R FK +ENG T Y+V+  S  ++    + +    +N  + ++  GDYQ++++ +   L +A+  A NENE  MI+ Y+ SFE GS+D HK GS++WI DKGP++E YIGFIE+YRDP G R EFE F+A+VNKE S KF  LV  A  +++ LPW + YEKD +L+PDFTSLD++ F  SG+P GINIPNYD+IRQ+ GFKNVSLGNVL +  +     F+  E + +  +    AFEVQVGLHEL+GHGSGKLF   ++G YNFD  NTK+L+T  PI  WY   ET+D+ F  I S +EECRAE VGLYL   ++I +IFGF  +   ++II+VNWLS+I + + V++E + P+ K W QAH +ARFVI++VLLEAG+ L+K+E    E G+ +LL+ ++RSKI+TVGR  +G FL+ LQ YKSTA+++   K +  YS ++E   H     R+I L  K PR I +Q       ++  +L  Y  T EG IQS+V+R+
Sbjct:   68 TAHFVLPNTQPIADLDCKSAFENLTEKEKLYAHHFSQASWDGGLIALIQSSPEAPLIFSLLHRIFLAEKIPVLRAKAL-EAGVSADDFTAFLVYACGVFANAGNYKGMGDSKIVPNLSEKQFETIVKASAAYSDEPRVGKIFEKVKNLIYALESRNEILGFAPDGITTYWSDNCTKEDSEIVNAWLTSKRIEPYMCRTFKIVENGQTVYDVKLGSVAESTQDGITLPLEEYNGNKFRVTRGDYQKLLQRVNQHLLQAQKYAANENESKMIEHYVRSFEQGSLDEHKNGSRWWIKDKGPVIETYIGFIETYRDPAGGRAEFEGFVAMVNKESSAKFSELVNRAEKLIEYLPWTEPYEKDSYLKPDFTSLDVLTFAGSGVPAGINIPNYDEIRQDEGFKNVSLGNVLANINRKDPIPFLTEEDQTLMKEYKVKAFEVQVGLHELLGHGSGKLFRIDENGVYNFDKENTKNLVTGEPITKWYLPGETYDTKFGAIGSSYEECRAEAVGLYLSLQRDILEIFGFKDKAEQDNIIYVNWLSLIWNGMGVALEMFNPKSKLWLQAHSRARFVIMKVLLEAGEGLVKVE--ETEKGK-NLLLTVDRSKIDTVGRKALGDFLTKLQVYKSTADIEAASKMYEHYSKVDESGSHPWAKWRDICLAHKKPRMILVQANTAIGQDQKVQLKTYEPTHEGYIQSWVERY 760          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Zebrafish
Match: dpp3 (dipeptidyl-peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-1247])

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 349/731 (47.74%), Postives = 482/731 (65.94%), Query Frame = 1
Query:  103 MSSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREI-YDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSL-----------KNVNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKS--NFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFKD-GQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQC--VVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRDS 2232
            + S Y +  +  +  LDC+ +F+ L+  EK Y+  L +A WYG L+  +Q SPES  +++L Q +F+ Q P           ++  + + F  Y A ++ N+GNY+SFGD+KFIP + +E F  ++  S A+K D    E+ ++     ++SL  + KQ+GLGE+GI+ Y+S NC ++DA+  Q ++D  N+SAYNTR+FK   +G   YEVR AS+            K    R E  +    ++     GDY  +ME +   L+KAK  A +EN++ M++ YI SF  GS++AHKEGS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK MS +F  LV  A  +L ELPWP  +EKD+FL+PDFTSLD++ F  SG+P GINIPNYDDIRQ  GFKNVSLGNVL   +   K    F+  + K+++IK    +FEVQVGLHEL+GHGSGKLF   D G++NFD    ++  T   I+SWYKG+ETWDS F+TIAS +EECRAECVGLYLC  K++  IFG  G E+  ++++VNWL+M+++ L+ +EFYTPE K WRQAH QARFVIL+VLLEAG+ L+ ++  T  DGRPD +I L+RSKI TVG+  I +FL  LQ YKSTA+V+ G   +  YS +       FL LRE VL RK  R + +Q    + +D   + +LIEY  ++EG+IQSF++RF   S ++ D  L E+ ++DS
Sbjct:    2 VDSQYYLPNDIGISALDCREAFKLLSPKEKLYAHYLSRAAWYGGLVVLIQTSPESAKIYVLLQKMFRAQTPLQMQETATAAGLSAEEYQAFLVYAAGLFANMGNYKSFGDTKFIPNLPKEKFKALVWESLAFKEDPSGTEVLWNSCCEPLYSLEEKQKQLGLGEKGITAYFSGNCCLEDAEFAQKFLDSKNLSAYNTRLFKTEVDGKRCYEVRLASAKTEDCCAEEGEGKTCCGRFEFEDAVFCVK----RGDYSFLMEKVCQNLEKAKVNAADENQRRMLEEYIRSFTYGSVEAHKEGSRFWIKDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSARFAQLVSSAEVLLPELPWPPAFEKDRFLKPDFTSLDVLTFAGSGIPAGINIPNYDDIRQTEGFKNVSLGNVLAVAYATQKDKLTFLEEKDKDLYIKWKGPSFEVQVGLHELLGHGSGKLFVQDDKGKFNFDQTAVRNPETGELISSWYKGSETWDSKFSTIASSYEECRAECVGLYLCLSKQVLSIFGHEG-EDAEEVLYVNWLNMVRAGLLGLEFYTPESKSWRQAHMQARFVILRVLLEAGEGLVCVKECTGTDGRPDAVITLDRSKINTVGKSAIQRFLCKLQVYKSTADVEGGRALYEGYSAVTSDGAHDFLRLRETVLLRKEARKMFVQANTFIKDD---AVELIEYEGSAEGLIQSFIERFPDDSEEV-DAQLLEMTRKDS 723          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Zebrafish
Match: dpp3 (dipeptidyl-peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-1247])

HSP 1 Score: 89.7373 bits (221), Expect = 6.435e-21
Identity = 41/115 (35.65%), Postives = 67/115 (58.26%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRI 453
            S Y +  +  +  LDC+ +F+ L+  EK Y+  L +A WYG L+  +Q SPES  +++L Q +F+ Q P           ++  + + F  Y A ++ N+GNY+SFGD+KFIP +
Sbjct:    4 SQYYLPNDIGISALDCREAFKLLSPKEKLYAHYLSRAAWYGGLVVLIQTSPESAKIYVLLQKMFRAQTPLQMQETATAAGLSAEEYQAFLVYAAGLFANMGNYKSFGDTKFIPNL 118          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Xenopus
Match: DPP3 (dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:101732710])

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 328/677 (48.45%), Postives = 444/677 (65.58%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKNVNRRLEISNPSHNIEV-----------KLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLK--SRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNE----QFLHLREIVLDRKLPRGITIQ 2079
            S Y++    PV  LDC  +F  L+  EK Y+  L +A +YG LI   Q SPESPA+++L   LF+ Q+P           VNE + +    Y A  + N+GNY+SFGD+KF+P I  E  +++I+ S+A+  D E    ++  +   ++SL    +Q+GLG+ GI+TY+S NCT++DA+  Q ++D  ++SAYNTR+FK + E+G + YEVR AS    VN+    S PS   E+           ++  GDY  ++  +   L+ AK  A N+N++ M+  Y+ SF+ GSI AHKEGSKYW+ DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK +S KF  LV  A  ++  LPWP  YEKD FL+PDFTSLD++ F  SG+P GINIPNYDDIRQ VGFKNVSLGNVL   S  +  K  F+  E K++F+K    +FEVQVGLHEL+GHGSGKLF   + G  NFD     +  T   +  WYK  ETWDS F+TIAS +EECRAECVGLYLC  +E+ +IFG   QE   D+I+VNWL+M+++ L+ +E++TPE  +WRQAH QARFVIL+VLLEAG++ + I      DGRPD+ + L+R KI +VG P I +FL  LQ YKSTA+V+   + ++ YS + +    QFL LR+I++ RK  R   +Q
Sbjct:    5 SQYVLPNNLPVALLDCNEAFLLLSAEEKLYTHYLSRASFYGGLIVLFQTSPESPAIYILLNRLFRSQDPGELRGVALSHDVNEEEYQALLVYAAGFFANMGNYKSFGDTKFVPNIPREKLEKVIRASNAFAKDPEGMESLWKMVADHMYSLEPSERQLGLGDHGITTYFSGNCTLEDAELAQRFLDSKSLSAYNTRLFKTLDESGKSLYEVRLAS----VNKEESASPPSDLSEILGSVEFEGHQFRVTRGDYSPLLRRVRENLENAKAYAANDNQRQMLDEYVRSFQEGSIKAHKEGSKYWVQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKSVSAKFAQLVSVAEQLVSSLPWPASYEKDAFLRPDFTSLDVVTFSGSGIPAGINIPNYDDIRQTVGFKNVSLGNVLSVGSATEREKLTFLREEDKDLFLKFRGPSFEVQVGLHELLGHGSGKLFVQDEKGALNFDKETVINPETGELVKGWYKTGETWDSKFSTIASTYEECRAECVGLYLCINEEVLRIFGHEAQE-AQDVIYVNWLNMVRAGLMGLEYFTPETGRWRQAHMQARFVILRVLLEAGENFVTITQKVGADGRPDVQVTLDREKILSVGHPAIQRFLLRLQVYKSTADVERAREMYDGYSTVTDADPYQFLTLRDIIISRKEERKSFVQ 676          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Xenopus
Match: DPP3 (dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:101732710])

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 328/677 (48.45%), Postives = 444/677 (65.58%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKNVNRRLEISNPSHNIEV-----------KLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLK--SRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNE----QFLHLREIVLDRKLPRGITIQ 2079
            S Y++    PV  LDC  +F  L+  EK Y+  L +A +YG LI   Q SPESPA+++L   LF+ Q+P           VNE + +    Y A  + N+GNY+SFGD+KF+P I  E  +++I+ S+A+  D E    ++  +   ++SL    +Q+GLG+ GI+TY+S NCT++DA+  Q ++D  ++SAYNTR+FK + E+G + YEVR AS    VN+    S PS   E+           ++  GDY  ++  +   L+ AK  A N+N++ M+  Y+ SF+ GSI AHKEGSKYW+ DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK +S KF  LV  A  ++  LPWP  YEKD FL+PDFTSLD++ F  SG+P GINIPNYDDIRQ VGFKNVSLGNVL   S  +  K  F+  E K++F+K    +FEVQVGLHEL+GHGSGKLF   + G  NFD     +  T   +  WYK  ETWDS F+TIAS +EECRAECVGLYLC  +E+ +IFG   QE   D+I+VNWL+M+++ L+ +E++TPE  +WRQAH QARFVIL+VLLEAG++ + I      DGRPD+ + L+R KI +VG P I +FL  LQ YKSTA+V+   + ++ YS + +    QFL LR+I++ RK  R   +Q
Sbjct:    5 SQYVLPNNLPVALLDCNEAFLLLSAEEKLYTHYLSRASFYGGLIVLFQTSPESPAIYILLNRLFRSQDPGELRGVALSHDVNEEEYQALLVYAAGFFANMGNYKSFGDTKFVPNIPREKLEKVIRASNAFAKDPEGMESLWKMVADHMYSLEPSERQLGLGDHGITTYFSGNCTLEDAELAQRFLDSKSLSAYNTRLFKTLDESGKSLYEVRLAS----VNKEESASPPSDLSEILGSVEFEGHQFRVTRGDYSPLLRRVRENLENAKAYAANDNQRQMLDEYVRSFQEGSIKAHKEGSKYWVQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKSVSAKFAQLVSVAEQLVSSLPWPASYEKDAFLRPDFTSLDVVTFSGSGIPAGINIPNYDDIRQTVGFKNVSLGNVLSVGSATEREKLTFLREEDKDLFLKFRGPSFEVQVGLHELLGHGSGKLFVQDEKGALNFDKETVINPETGELVKGWYKTGETWDSKFSTIASTYEECRAECVGLYLCINEEVLRIFGHEAQE-AQDVIYVNWLNMVRAGLMGLEYFTPETGRWRQAHMQARFVILRVLLEAGENFVTITQKVGADGRPDVQVTLDREKILSVGHPAIQRFLLRLQVYKSTADVERAREMYDGYSTVTDADPYQFLTLRDIIISRKEERKSFVQ 676          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Xenopus
Match: DPP3 (dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:101732710])

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 332/693 (47.91%), Postives = 448/693 (64.65%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKNVNRRLEISNPSHNIEV-----------KLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLK--SRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNE----QFLHLREIVLDRKLPR-----------GITIQCVVCE 2094
            S Y++    PV  LDC  +F  L+  EK Y+  L +A +YG LI   Q SPESPA+++L   LF+ Q+P           VNE + +    Y A  + N+GNY+SFGD+KF+P I  E  +++I+ S+A+  D E    ++  +   ++SL    +Q+GLG+ GI+TY+S NCT++DA+  Q ++D  ++SAYNTR+FK + E+G + YEVR AS    VN+    S PS   E+           ++  GDY  ++  +   L+ AK  A N+N++ M+  Y+ SF+ GSI AHKEGSKYW+ DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK +S KF  LV  A  ++  LPWP  YEKD FL+PDFTSLD++ F  SG+P GINIPNYDDIRQ VGFKNVSLGNVL   S  +  K  F+  E K++F+K    +FEVQVGLHEL+GHGSGKLF   + G  NFD     +  T   +  WYK  ETWDS F+TIAS +EECRAECVGLYLC  +E+ +IFG   QE   D+I+VNWL+M+++ L+ +E++TPE  +WRQAH QARFVIL+VLLEAG++ + I      DGRPD+ + L+R KI +VG P I +FL  LQ YKSTA+V+   + ++ YS + +    QFL LR+I++ RK  R           GI+  C V E
Sbjct:    5 SQYVLPNNLPVALLDCNEAFLLLSAEEKLYTHYLSRASFYGGLIVLFQTSPESPAIYILLNRLFRSQDPGELRGVALSHDVNEEEYQALLVYAAGFFANMGNYKSFGDTKFVPNIPREKLEKVIRASNAFAKDPEGMESLWKMVADHMYSLEPSERQLGLGDHGITTYFSGNCTLEDAELAQRFLDSKSLSAYNTRLFKTLDESGKSLYEVRLAS----VNKEESASPPSDLSEILGSVEFEGHQFRVTRGDYSPLLRRVRENLENAKAYAANDNQRQMLDEYVRSFQEGSIKAHKEGSKYWVQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKSVSAKFAQLVSVAEQLVSSLPWPASYEKDAFLRPDFTSLDVVTFSGSGIPAGINIPNYDDIRQTVGFKNVSLGNVLSVGSATEREKLTFLREEDKDLFLKFRGPSFEVQVGLHELLGHGSGKLFVQDEKGALNFDKETVINPETGELVKGWYKTGETWDSKFSTIASTYEECRAECVGLYLCINEEVLRIFGHEAQE-AQDVIYVNWLNMVRAGLMGLEYFTPETGRWRQAHMQARFVILRVLLEAGENFVTITQKVGADGRPDVQVTLDREKILSVGHPAIQRFLLRLQVYKSTADVERAREMYDGYSTVTDADPYQFLTLRDIIISRKEERKSFVQINTRITGISPHCSVSE 692          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Xenopus
Match: DPP3 (dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:101732710])

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 326/674 (48.37%), Postives = 443/674 (65.73%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKNVNRRLEISNPS--------HNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLK--SRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNE----QFLHLREIVLDRKLPRGITIQ 2079
            S Y++    PV  LDC  +F  L+  EK Y+  L +A +YG LI   Q SPESPA+++L   LF+ Q+P           VNE + +    Y A  + N+GNY+SFGD+KF+P I  E  +++I+ S+A+  D E    ++  +   ++SL    +Q+GLG+ GI+TY+S NCT++DA+  Q ++D  ++SAYNTR+FK + E+G + YEVR AS    VN+    S P+           + ++  GDY  ++  +   L+ AK  A N+N++ M+  Y+ SF+ GSI AHKEGSKYW+ DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK +S KF  LV  A  ++  LPWP  YEKD FL+PDFTSLD++ F  SG+P GINIPNYDDIRQ VGFKNVSLGNVL   S  +  K  F+  E K++F+K    +FEVQVGLHEL+GHGSGKLF   + G  NFD     +  T   +  WYK  ETWDS F+TIAS +EECRAECVGLYLC  +E+ +IFG   QE   D+I+VNWL+M+++ L+ +E++TPE  +WRQAH QARFVIL+VLLEAG++ + I      DGRPD+ + L+R KI +VG P I +FL  LQ YKSTA+V+   + ++ YS + +    QFL LR+I++ RK  R   +Q
Sbjct:    5 SQYVLPNNLPVALLDCNEAFLLLSAEEKLYTHYLSRASFYGGLIVLFQTSPESPAIYILLNRLFRSQDPGELRGVALSHDVNEEEYQALLVYAAGFFANMGNYKSFGDTKFVPNIPREKLEKVIRASNAFAKDPEGMESLWKMVADHMYSLEPSERQLGLGDHGITTYFSGNCTLEDAELAQRFLDSKSLSAYNTRLFKTLDESGKSLYEVRLAS----VNKEEPNSPPTIILGSVEFEGHQFRVTRGDYSPLLRRVRENLENAKAYAANDNQRQMLDEYVRSFQEGSIKAHKEGSKYWVQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKSVSAKFAQLVSVAEQLVSSLPWPASYEKDAFLRPDFTSLDVVTFSGSGIPAGINIPNYDDIRQTVGFKNVSLGNVLSVGSATEREKLTFLREEDKDLFLKFRGPSFEVQVGLHELLGHGSGKLFVQDEKGALNFDKETVINPETGELVKGWYKTGETWDSKFSTIASTYEECRAECVGLYLCINEEVLRIFGHEAQE-AQDVIYVNWLNMVRAGLMGLEYFTPETGRWRQAHMQARFVILRVLLEAGENFVTITQKVGADGRPDVQVTLDREKILSVGHPAIQRFLLRLQVYKSTADVERAREMYDGYSTVTDADPYQFLTLRDIIISRKEERKSFVQ 673          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Xenopus
Match: DPP3 (dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:101732710])

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 324/666 (48.65%), Postives = 440/666 (66.07%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKNVNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLK--SRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNE----QFLHLREIVLDRKLPRGITIQ 2079
            S Y++    PV  LDC  +F  L+  EK Y+  L +A +YG LI   Q SPESPA+++L   LF+ Q+P           VNE + +    Y A  + N+GNY+SFGD+KF+P I  E  +++I+ S+A+  D E    ++  +   ++SL    +Q+GLG+ GI+TY+S NCT++DA+  Q ++D  ++SAYNTR+FK + E+G + YEVR AS       R+  S      + ++  GDY  ++  +   L+ AK  A N+N++ M+  Y+ SF+ GSI AHKEGSKYW+ DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK +S KF  LV  A  ++  LPWP  YEKD FL+PDFTSLD++ F  SG+P GINIPNYDDIRQ VGFKNVSLGNVL   S  +  K  F+  E K++F+K    +FEVQVGLHEL+GHGSGKLF   + G  NFD     +  T   +  WYK  ETWDS F+TIAS +EECRAECVGLYLC  +E+ +IFG   QE   D+I+VNWL+M+++ L+ +E++TPE  +WRQAH QARFVIL+VLLEAG++ + I      DGRPD+ + L+R KI +VG P I +FL  LQ YKSTA+V+   + ++ YS + +    QFL LR+I++ RK  R   +Q
Sbjct:    5 SQYVLPNNLPVALLDCNEAFLLLSAEEKLYTHYLSRASFYGGLIVLFQTSPESPAIYILLNRLFRSQDPGELRGVALSHDVNEEEYQALLVYAAGFFANMGNYKSFGDTKFVPNIPREKLEKVIRASNAFAKDPEGMESLWKMVADHMYSLEPSERQLGLGDHGITTYFSGNCTLEDAELAQRFLDSKSLSAYNTRLFKTLDESGKSLYEVRLASEPHLRFERILGSVEFEGHQFRVTRGDYSPLLRRVRENLENAKAYAANDNQRQMLDEYVRSFQEGSIKAHKEGSKYWVQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKSVSAKFAQLVSVAEQLVSSLPWPASYEKDAFLRPDFTSLDVVTFSGSGIPAGINIPNYDDIRQTVGFKNVSLGNVLSVGSATEREKLTFLREEDKDLFLKFRGPSFEVQVGLHELLGHGSGKLFVQDEKGALNFDKETVINPETGELVKGWYKTGETWDSKFSTIASTYEECRAECVGLYLCINEEVLRIFGHEAQEA-QDVIYVNWLNMVRAGLMGLEYFTPETGRWRQAHMQARFVILRVLLEAGENFVTITQKVGADGRPDVQVTLDREKILSVGHPAIQRFLLRLQVYKSTADVERAREMYDGYSTVTDADPYQFLTLRDIIISRKEERKSFVQ 669          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Mouse
Match: Dpp3 (dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1922471])

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 341/715 (47.69%), Postives = 473/715 (66.15%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKT-DEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKNVNRRL--EISNPSHNIEVK-----LVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRF--KDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQCVVCEDIEKSP-KLIEYPTTSEGMIQSFVDRFSGKSGDLADI 2202
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + ++   R+I  S A +   E+ R+++     L+FSL  R + +GLG+EG++TY+S +CTM+DAK  Q ++D  N+SAYNTR+FK + + G + YEVR AS L N +  L  E+++     E +     +  GDY  +++ +V  L+KAK  A N +++ M+  Y+ESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+A+VNK MS KFE LV  A  +LKELPWP  +EKDKFL PDFTSLD++ F  SG+P GINIPNYDD+RQ  GFKNVSLGNVL   +  K  K  F+  E K+++I+    +F+VQVGLHEL+GHGSGKLF   + G +NFD     +  T   I SWY+  ETWDS F+TIAS +EECRAE VGLYLC   ++ +IFGF G  +  D+I+VNWL+M+++ L+++EFYTPE   WRQAH QARFVIL+VLLEAG+ L+ +   T  DGRPD  + L+RSKI +VGRP + +FL  LQ  KST +V  G   +  Y+ +     E FL LR+ VL RK  R + +Q      +E S  +L+EY  ++ G+I+SF +RF     +L ++
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKDKLGRVILGSKAAQQRPEEVRDLWQTCGDLMFSLEPRLRHLGLGKEGVTTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFKVVGQEGKSHYEVRLASVL-NTDPALDSELTSKLKRYEFQGNHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQYVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMSAKFERLVASAEQLLKELPWPLAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYAAKREKLTFLEEEDKDLYIRWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDKETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLNPQVLEIFGFEGA-DAEDVIYVNWLNMVRAGLLALEFYTPEAANWRQAHMQARFVILRVLLEAGEGLVTVTPTTGSDGRPDARVRLDRSKIRSVGRPALERFLRRLQVLKSTGDVVAGRALYEGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNT--RLEGSEVQLVEYEASAAGLIRSFCERFPEDGPELEEV 714          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Mouse
Match: Dpp3 (dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1922471])

HSP 1 Score: 417.157 bits (1071), Expect = 4.001e-138
Identity = 211/445 (47.42%), Postives = 296/445 (66.52%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKT-DEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKNVNRRL--EISNPSHNIEVK-----LVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRF--KDPKSNFIPNEHKEIFIKNAESAFEVQV 1410
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + ++   R+I  S A +   E+ R+++     L+FSL  R + +GLG+EG++TY+S +CTM+DAK  Q ++D  N+SAYNTR+FK + + G + YEVR AS L N +  L  E+++     E +     +  GDY  +++ +V  L+KAK  A N +++ M+  Y+ESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+A+VNK MS KFE LV  A  +LKELPWP  +EKDKFL PDFTSLD++ F  SG+P GINIPNYDD+RQ  GFKNVSLGNVL   +  K  K  F+  E K+++I+    +F+VQV
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKDKLGRVILGSKAAQQRPEEVRDLWQTCGDLMFSLEPRLRHLGLGKEGVTTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFKVVGQEGKSHYEVRLASVL-NTDPALDSELTSKLKRYEFQGNHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQYVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMSAKFERLVASAEQLLKELPWPLAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYAAKREKLTFLEEEDKDLYIRWKGPSFDVQV 447          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Mouse
Match: Dpp3 (dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1922471])

HSP 1 Score: 149.828 bits (377), Expect = 5.698e-41
Identity = 71/188 (37.77%), Postives = 115/188 (61.17%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKT-DEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDEN 669
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + ++   R+I  S A +   E+ R+++     L+FSL  R + +GLG+EG++TY+S +CTM+DAK  Q ++D  
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKDKLGRVILGSKAAQQRPEEVRDLWQTCGDLMFSLEPRLRHLGLGKEGVTTYFSGDCTMEDAKLAQDFLDSQ 191          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Mouse
Match: Dpp3 (dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1922471])

HSP 1 Score: 137.887 bits (346), Expect = 7.244e-37
Identity = 72/144 (50.00%), Postives = 99/144 (68.75%), Query Frame = 1
Query:  655 YMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKNVNRRL--EISNPSHNIEVK-----LVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFE 1062
            ++D  N+SAYNTR+FK + + G + YEVR AS L N +  L  E+++     E +     +  GDY  +++ +V  L+KAK  A N +++ M+  Y+ESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE
Sbjct:   43 FLDSQNLSAYNTRLFKVVGQEGKSHYEVRLASVL-NTDPALDSELTSKLKRYEFQGNHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQYVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFE 185          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Mouse
Match: Dpp3 (dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1922471])

HSP 1 Score: 108.997 bits (271), Expect = 3.536e-27
Identity = 53/150 (35.33%), Postives = 87/150 (58.00%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKT-DEKFREIYDKIKPLIFS 555
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + ++   R+I  S A +   E+ R+++     L+FS
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKDKLGRVILGSKAAQQRPEEVRDLWQTCGDLMFS 153          
BLAST of Dipeptidyl peptidase 3 vs. UniProt/SwissProt
Match: sp|A7RZW4|DPP3_NEMVE (Dipeptidyl peptidase 3 OS=Nematostella vectensis OX=45351 GN=dpp3 PE=3 SV=1)

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 348/725 (48.00%), Postives = 470/725 (64.83%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVN----EVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEK-FREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSL----------KNVNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFK-DGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQC-VVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRD 2229
            + YI+  E  +  L+C+ +F  LTE EK Y+  L KA W GALI  +Q SPE+P +FLL Q LF  ++    +L  K LK +    E +   F  Y A  YGN+GNY+SFGD+KFIP + +E F  I+  S AY T+ K    ++      ++SL  + +Q+G GE+GISTYYS NC   DA+ IQ ++ E NI  +NTR+FK+I + G   Y +R AS+           K+    L  S       VK+  GDY  +++ +V+ L  AK  A NENE +M+  Y+ SF TGS++AHK+GS++WI DKGP+VE YIGFIESYRDPFGVR E+E F+++VNK MS KF  LV  A ++L +LPWP  YEKD FL+PDFTSLD++ F  SG+P GINIPNYD+IRQ+ GFKNVSLGNVL +   D K  F+  E  E++ K    +FEVQVGLHEL+GHGSGKLF  K DG YNFD  +  +  T   I SWY   ETW + F  ++S +EECRAECVG+YLC  K++ +IFG  G    +DI++VNWL+M+++ L+ +EFYTPE  KWRQAH QAR+VIL+VLLEAG+ L+++  I   DG+PD+L+ L+R+KI  VG+P IG FL  LQ +KSTA+   G   ++KYS ++  FL +R IVL RK PR + +Q     +D   S K  E+  ++ GMI SF+ RF G      D  L ++W+ D
Sbjct:    9 TQYIIPNEANINFLECRTAFGGLTEKEKCYAHYLYKASWEGALICLLQTSPEAPGIFLLFQKLFSSES--VGSLKEKALKSSVAPTEEEFTSFLTYVAAFYGNIGNYKSFGDTKFIPNLPKEKFQTIVFSSQAYATNAKSVVTLWSDCCEAMYSLKPKLRQLGFGEQGISTYYSSNCNKSDAEFIQGFLKEKNIEGWNTRLFKEINDKGHVTYNLRLASTALSAEDCSAEKKDDVASLVKSYEYQGTTVKITRGDYAGLLKKVVDNLIMAKGFASNENEVAMLDHYVHSFTTGSVEAHKDGSRHWIRDKGPVVETYIGFIESYRDPFGVRAEYEGFVSIVNKSMSAKFADLVSSAETLLPQLPWPSSYEKDTFLRPDFTSLDVLGFGSSGIPAGINIPNYDEIRQDEGFKNVSLGNVLSAHSADQKITFLTEEDAELYSKLKAPSFEVQVGLHELLGHGSGKLFIKKPDGSYNFDHKSVVNTETGEKIQSWYTEGETWSTKFAELSSSYEECRAECVGIYLCLNKDVLRIFGHEGAAG-DDIVYVNWLNMVRAGLLGLEFYTPENNKWRQAHMQARYVILRVLLEAGEQLVQLTRIAGSDGKPDILVTLDRNKISCVGQPAIGAFLRKLQVFKSTADYASGKDLYDKYSAVDAHFLEMRNIVLARKTPRRMFVQSHTTIQDGVVSLK--EFEASASGMIASFIARFPGD-----DPVLEKLWRDD 723          
BLAST of Dipeptidyl peptidase 3 vs. UniProt/SwissProt
Match: sp|O55096|DPP3_RAT (Dipeptidyl peptidase 3 OS=Rattus norvegicus OX=10116 GN=Dpp3 PE=1 SV=2)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 339/714 (47.48%), Postives = 471/714 (65.97%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKN---VNRRLEISNPSHNIE---VKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRF--KDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQCVVCEDIEKSP-KLIEYPTTSEGMIQSFVDRFSGKSGDLADI 2202
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + +E  +R+I  S A +   E+ R ++     L+FSL  R + +GLG+EG++TY+S +C M+DAK  Q ++D  N+SAYNTR+FK + + G   YEVR AS L     ++  L     S+  +    ++  GDY  +++ +V  L+KAK  A N +++ M+  Y+ESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+A+VNK+MS KFE LV  A  +LKELPWP  +EKDKFL PDFTSLD++ F  SG+P GINIPNYDD+RQ  GFKNVSLGNVL   +  K  K  F+  E K+++I+    +F+VQVGLHEL+GHGSGKLF   + G +NFD     +  T   I SWY+  ETWDS F+TIAS +EECRAE VGLYLC   ++ +IFGF G  +  D+I+VNWL+M+++ L+++EFYTPE   WRQAH QARFVIL+VLLEAG+ L+ +   T  DGRPD  +HL+RSKI +VG+P + +FL  LQ  KST +V  G   +  Y+ +     E FL LR+ VL RK  R + +Q      +E S  +L+EY  ++ G+I+SF +RF     +L ++
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSKAAQQHPEEVRSLWQTCGELMFSLEPRLRHLGLGKEGVTTYFSGDCAMEDAKLAQDFLDSQNLSAYNTRLFKVVGQEGKYHYEVRLASVLNTEPALDSELTSKLKSYEFQGNHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQYVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKDMSAKFERLVASAEQLLKELPWPPAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATKREKLTFMEEEDKDLYIRWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLNPQVLQIFGFEGT-DAEDVIYVNWLNMVRAGLLALEFYTPETANWRQAHMQARFVILRVLLEAGEGLVTVTPTTGSDGRPDARVHLDRSKIRSVGKPALERFLRRLQVLKSTGDVVAGRALYEGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNT--RLEGSEVQLVEYEASAAGLIRSFCERFPEDGPELEEV 714          
BLAST of Dipeptidyl peptidase 3 vs. UniProt/SwissProt
Match: sp|Q9NY33|DPP3_HUMAN (Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=DPP3 PE=1 SV=2)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 346/722 (47.92%), Postives = 471/722 (65.24%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTD-EKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIEN-GITKYEVRQASSLKNVNRRLEISNPSHNIEV--------------KLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRF--KDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQCVVCEDIEKSP-KLIEYPTTSEGMIQSFVDRFSGKSGDLADI 2202
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + +E  +R+I  S+A +   E+ R ++     L+FSL  R + +GLG+EGI+TY+S NCTM+DAK  Q ++D  N+SAYNTR+FK+++  G   YEVR AS L         S PS + EV              ++  GDY  +++ +V +L+KAK  A N ++  M+  YIESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK MS KFE LV  A  +LKELPWP  +EKDKFL PDFTSLD++ F  SG+P GINIPNYDD+RQ  GFKNVSLGNVL   +  +  K  F+  + K+++I     +F+VQVGLHEL+GHGSGKLF   + G +NFD     +  T   I SWY+  ETWDS F+TIAS +EECRAE VGLYLC   ++ +IFGF G  +  D+I+VNWL+M+++ L+++EFYTPE   WRQAH QARFVIL+VLLEAG+ L+ I   T  DGRPD  + L+RSKI +VG+P + +FL  LQ  KST +V  G   +  Y+ +     E FL LR+ VL RK  R + +Q      +E S  +L+EY  ++ G+I+SF +RF     +L +I
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEVRGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLAQDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLG--------SEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQYIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSAKFERLVASAEQLLKELPWPPTFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQREKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGA-DAEDVIYVNWLNMVRAGLLALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNT--RLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEI 714          
BLAST of Dipeptidyl peptidase 3 vs. UniProt/SwissProt
Match: sp|Q99KK7|DPP3_MOUSE (Dipeptidyl peptidase 3 OS=Mus musculus OX=10090 GN=Dpp3 PE=1 SV=2)

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 341/715 (47.69%), Postives = 473/715 (66.15%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKT-DEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSLKNVNRRL--EISNPSHNIEVK-----LVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRF--KDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQCVVCEDIEKSP-KLIEYPTTSEGMIQSFVDRFSGKSGDLADI 2202
            + YI+  +  V  LDC+ +F+ L+  E+ Y+  L +A WYG L   +Q SPE+P ++ L   LF+ Q+P+    H     + E + + F  Y A VY N+GNY+SFGD+KF+P + ++   R+I  S A +   E+ R+++     L+FSL  R + +GLG+EG++TY+S +CTM+DAK  Q ++D  N+SAYNTR+FK + + G + YEVR AS L N +  L  E+++     E +     +  GDY  +++ +V  L+KAK  A N +++ M+  Y+ESF  GSI+AHK GS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+A+VNK MS KFE LV  A  +LKELPWP  +EKDKFL PDFTSLD++ F  SG+P GINIPNYDD+RQ  GFKNVSLGNVL   +  K  K  F+  E K+++I+    +F+VQVGLHEL+GHGSGKLF   + G +NFD     +  T   I SWY+  ETWDS F+TIAS +EECRAE VGLYLC   ++ +IFGF G  +  D+I+VNWL+M+++ L+++EFYTPE   WRQAH QARFVIL+VLLEAG+ L+ +   T  DGRPD  + L+RSKI +VGRP + +FL  LQ  KST +V  G   +  Y+ +     E FL LR+ VL RK  R + +Q      +E S  +L+EY  ++ G+I+SF +RF     +L ++
Sbjct:    4 TQYILPNDIGVSSLDCREAFRLLSPTERLYAHHLSRAAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKDKLGRVILGSKAAQQRPEEVRDLWQTCGDLMFSLEPRLRHLGLGKEGVTTYFSGDCTMEDAKLAQDFLDSQNLSAYNTRLFKVVGQEGKSHYEVRLASVL-NTDPALDSELTSKLKRYEFQGNHFQVTRGDYAPILQKVVEHLEKAKAYAANSHQEQMLAQYVESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKAMSAKFERLVASAEQLLKELPWPLAFEKDKFLTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYAAKREKLTFLEEEDKDLYIRWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDKETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLNPQVLEIFGFEGA-DAEDVIYVNWLNMVRAGLLALEFYTPEAANWRQAHMQARFVILRVLLEAGEGLVTVTPTTGSDGRPDARVRLDRSKIRSVGRPALERFLRRLQVLKSTGDVVAGRALYEGYAAVTDAPPECFLTLRDTVLLRKESRKLIVQPNT--RLEGSEVQLVEYEASAAGLIRSFCERFPEDGPELEEV 714          
BLAST of Dipeptidyl peptidase 3 vs. UniProt/SwissProt
Match: sp|Q9VHR8|DPP3_DROME (Dipeptidyl peptidase 3 OS=Drosophila melanogaster OX=7227 GN=DppIII PE=2 SV=2)

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 316/697 (45.34%), Postives = 454/697 (65.14%), Query Frame = 1
Query:  106 SSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALF-LLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNVNRRLEISNPSHNI-EVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHF-KDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSL-VSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLH----LREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRF 2172
            ++H+++    P+  LDCK++F+NLTE EK Y+    +A W G LI  +Q SPE+P +F LL +I    + P   A  L E  V+  D   F  Y   V+ N GNY+  GDSK +P + E+ F+ I+K S AY  + +  +I++K+K LI++L SRN+ +G   +GI+TY+S NCT +D++ +  ++    I  Y  R FK +ENG T Y+V+  S  ++    + +    +N  + ++  GDYQ++++ +   L +A+  A NENE  MI+ Y+ SFE GS+D HK GS++WI DKGP++E YIGFIE+YRDP G R EFE F+A+VNKE S KF  LV  A  +++ LPW + YEKD +L+PDFTSLD++ F  SG+P GINIPNYD+IRQ+ GFKNVSLGNVL +  +     F+  E + +  +    AFEVQVGLHEL+GHGSGKLF   ++G YNFD  NTK+L+T  PI  WY   ET+D+ F  I S +EECRAE VGLYL   ++I +IFGF  +   ++II+VNWLS+I + + V++E + P+ K W QAH +ARFVI++VLLEAG+ L+K+E    E G+ +LL+ ++RSKI+TVGR  +G FL+ LQ YKSTA+++   K +  YS ++E   H     R+I L  K PR I +Q       ++  +L  Y  T EG IQS+V+R+
Sbjct:   68 TAHFVLPNTQPIADLDCKSAFENLTEKEKLYAHHFSQASWDGGLIALIQSSPEAPLIFSLLHRIFLAEKIPVLRAKAL-EAGVSADDFTAFLVYACGVFANAGNYKGMGDSKIVPNLSEKQFETIVKASAAYSDEPRVGKIFEKVKNLIYALESRNEILGFAPDGITTYWSDNCTKEDSEIVNAWLTSKRIEPYMCRTFKIVENGQTVYDVKLGSVAESTQDGITLPLEEYNGNKFRVTRGDYQKLLQRVNQHLLQAQKYAANENESKMIEHYVRSFEQGSLDEHKNGSRWWIKDKGPVIETYIGFIETYRDPAGGRAEFEGFVAMVNKESSAKFSELVNRAEKLIEYLPWTEPYEKDSYLKPDFTSLDVLTFAGSGVPAGINIPNYDEIRQDEGFKNVSLGNVLANINRKDPIPFLTEEDQTLMKEYKVKAFEVQVGLHELLGHGSGKLFRIDENGVYNFDKENTKNLVTGEPITKWYLPGETYDTKFGAIGSSYEECRAEAVGLYLSLQRDILEIFGFKDKAEQDNIIYVNWLSLIWNGMGVALEMFNPKSKLWLQAHSRARFVIMKVLLEAGEGLVKVE--ETEKGK-NLLLTVDRSKIDTVGRKALGDFLTKLQVYKSTADIEAASKMYEHYSKVDESGSHPWAKWRDICLAHKKPRMILVQANTAIGQDQKVQLKTYEPTHEGYIQSWVERY 760          
BLAST of Dipeptidyl peptidase 3 vs. TrEMBL
Match: A0A0R3UB74 (Dipeptidyl peptidase 3 OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS4173 PE=3 SV=1)

HSP 1 Score: 723.391 bits (1866), Expect = 0.000e+0
Identity = 369/727 (50.76%), Postives = 488/727 (67.13%), Query Frame = 1
Query:  103 MSSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIE---NGITKYEVRQASSLKNVNRRLEISNPS--HNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFK-DGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTP-----EQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKS-PKLIEYPTTSEGMIQSFVDRFSGKS--GDLADIALYEVWKRDSSIF 2241
            M S Y V     +  LDCK SF  L++ EK+Y   L +  W G LID +Q SPE+  +FLL Q +F++Q     +   +   +N+ DI  F +YFA++YGNLGNY SFGD+KFIP + E+ F  I+ +SDAY    + + ++ ++   I+SL     ++    EG++TYYS NC  +DA+ +Q Y++   I  YNTRV K  E   +G  +Y++  ASS    +R+  I++P        KL  GD+QE+M L+V  ++K K+ ALN  +KSM + Y  SF TGSI+AHKEGSK W+ DK P VE+YIGFIESYRDP+GVRGEFETF+AVV+K MS KF++LV  A   L  LPWP  YEKDKFL+PDFTSLDII+F VSG+PVGINIPNYDDIRQ  GFKNVSLGNVLK+RF+DP + FI +E +E++  N   +FE+QVGLHEL+GHGSGKLF    DG +NF S + +DLIT   I  WY+  ETWDS F+ IAS FEECRAECVG+YLC + E+  IF   G+ N  D++++NWLSM++S L+ +EF+TP     +   WRQAHCQARF IL+VLLE    +LKIE++  +DG+PDL IHL+RS++ +VG+P IG FL  LQ YKST N +EG  FF  +S    + L  R+ V+DR+ PR I +Q V  E+ E     L  YP T EG+IQSF+DR+S +   G  A  AL  VW+RD   F
Sbjct:    1 MGSEY-VHVPCDILPLDCK-SFDLLSDVEKRYLCLLDEIAWIGGLIDLIQLSPEAAGIFLLGQSIFEKQTVSELSDAARSAGINDADISAFVSYFASIYGNLGNYLSFGDTKFIPGLSEKAFTAIVAVSDAYNLSPELKNVFGQVIAAIYSLHPHRLRLAFAPEGLTTYYSGNCVREDAEIVQKYLNAKKIEGYNTRVLKSQERNCDGKFEYQITFASS---ESRKEIITDPCLPSTAVFKLRYGDFQELMALLVEAIEKVKEAALNTTQKSMWEEYQVSFRTGSIEAHKEGSKLWVSDKQPAVESYIGFIESYRDPYGVRGEFETFVAVVDKAMSAKFQNLVSGASKFLTLLPWPTAYEKDKFLEPDFTSLDIISFGVSGLPVGINIPNYDDIRQTFGFKNVSLGNVLKARFQDPTATFICDEDRELYATNVGQSFEIQVGLHELLGHGSGKLFRRNDDGTFNFPS-SVRDLITGGDITHWYEPGETWDSKFSNIASAFEECRAECVGVYLCDVAEVLSIFDAEGKYNPGDVMYINWLSMVRSGLMGLEFFTPPTNEGDGGAWRQAHCQARFAILKVLLECTPSVLKIESVKGQDGKPDLRIHLDRSRLHSVGKPAIGDFLQKLQYYKSTGNSEEGCVFFTNHSTPTTEHLKWRQTVIDRRKPRPIYVQPVTFENPESGLVTLKNYPGTDEGIIQSFIDRYSNRRHFGPRALAALKAVWERDQQYF 721          
BLAST of Dipeptidyl peptidase 3 vs. TrEMBL
Match: A0A2B4R4C2 (Dipeptidyl peptidase 3 OS=Stylophora pistillata OX=50429 GN=dpp3 PE=3 SV=1)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 358/722 (49.58%), Postives = 486/722 (67.31%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHL--KELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAY-KTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNVNRRLEISNPSHNIEV-----------KLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFK-DGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRD 2229
            S Y +  E  V  LDC+ +F  LTE EK Y+  L +A W GALI  +Q SPESP +FLL Q LF+ ++ E     +   E   ++ +++ F  Y A  YGN+GNY+SFGD+KF+P + +E  + ++  S AY K  ++  +++     +++SLTS+++Q+GLGE+G+STYYS NCT DDA+  Q +M E +I  YNTR+FK+ ++G   Y +R AS         E       + V           ++  GDY  +++ +V  L+KAK+   NENE SMIK YI SF TGSI AHK+GS+YWI DKGPIVE YIGFIE+YRDP GVR E+E F++VVNKEMS KF SLV  A  +L ELPWP  YEKDKFL+PDFTSLD++ F  SG+P GINIPNYDDIRQ  GFKNVSLGNVL ++  D K  F+ +E +E+F K   ++FEVQVGLHEL+GHGSGKLF  K DG YNFD  +     T   I+SWY   ETW + F  ++S +EECRAECVG+YLC+ KE+ +IFG  G  + ++I+++NWL+M+++ L+ +EFYTPE  KWRQAH QAR+VILQVLLEAG+ L+++ +I   DG+PD+L+ L+R+KIE+VGRP IG FL  LQ YKSTA+   G   +++YS +NE+FL LR+ VL RK PR + +QC      +   +L E+  +  GMI+SF  RF G+     D  L E+W+ +
Sbjct:   20 SQYTISREVDVNLLDCRTAFSGLTEKEKHYAHFLCRASWEGALICLLQTSPESPGIFLLLQELFQEESVEELKERVLKSENGPSKEELESFLIYAAAFYGNVGNYKSFGDTKFVPDLPKEKLESVVFSSKAYEKNAKRVEQLWSDCGDMMYSLTSKSRQLGLGEQGLSTYYSSNCTKDDAELAQEFMKEKDIETYNTRLFKEKKDGQVTYILRIASVATTAEPCPEADGEDKVVTVLGSHEFKGCTFRVERGDYSGLLKRVVENLEKAKEFTANENELSMIKNYIYSFNTGSIQAHKDGSRYWIRDKGPIVETYIGFIETYRDPSGVRAEYEGFVSVVNKEMSAKFASLVSSAEQLLPELPWPPAYEKDKFLRPDFTSLDVLGFGSSGIPAGINIPNYDDIRQEEGFKNVSLGNVLAAQSVDKKVTFLSDEDQELFTKLKAASFEVQVGLHELLGHGSGKLFVKKNDGTYNFDIESVMHTETGEKISSWYTDGETWYTRFADLSSSYEECRAECVGIYLCTSKEVLRIFGHEGT-DADNIVYINWLNMVRAGLLGLEFYTPENNKWRQAHMQARYVILQVLLEAGEKLVQVTSIAGSDGKPDVLVTLDRTKIESVGRPAIGNFLRKLQVYKSTADYNAGRALYDRYSAVNEEFLALRKTVLARKTPRRMFVQCHTSITGDNDVRLTEFEASPAGMIKSFTTRFPGE-----DSVLEELWRAE 735          
BLAST of Dipeptidyl peptidase 3 vs. TrEMBL
Match: A0A267FVS4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006755g2 PE=4 SV=1)

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 359/714 (50.28%), Postives = 473/714 (66.25%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNV-----NRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQ-KKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRD 2229
            S Y V  + PV  L C  +F+ L++AEK Y+  L +A W G LI   Q S ESP LFL+ Q +F+RQ PE      K   V++ D   F  Y   V GNLGNY+SFGD+K +P + EE  D+II  S+A+ + E+ R  + +++    SLT RN+Q+GLG  GI++Y+S NC   DAK  Q ++D   ISAYNTR+FK  E G   Y + QAS+  +V     +   E S  S    V+   GDY+E+M L +  L+ A+  ALN N+  M++ Y  SF  GSID HK GS+ WI DKGP VE Y+GFIESYRDPFGVRGEFE+F+AVVNKE S KF +LV  A   L  LPWP  YEKDKFLQPDFT+L+I+ F  SG+P+GINIPNYDDIRQ+ GFKNVSLGNVL S F DPK+ F+  E K+I+I+    +FEVQVGLHEL+GHGSGKLF    DG++NFD ++  DL+T  P+ SWYK  ETWD  F+ +AS FEECRAECVG+YLC + E+  +FG   +   +++I+VNWL M ++ + S+E Y+PE    WRQAH +ARF IL+ LLEAGQ L+ I+ IT EDG+PDL + L+RSKI +V +P IG+FL  LQ +KST +V+ G  FF  YS ++  F  LR+IV+ R+ PR + IQ  +  D   S  ++EY      MI+SF DRFS +     + AL++ W+RD
Sbjct:   52 SLYTVPTDAPVTFLACGPAFEKLSQAEKAYAYHLYRASWIGGLICLHQTSAESPGLFLVLQSVFRRQTPEQLRASCKA-GVSDADWDAFLMYATQVLGNLGNYKSFGDTKILPDLSEEALDKIITASEAHASSERVRVAWQRVRAAASSLTERNRQLGLGTAGITSYFSDNCDESDAKLAQAFLDSRQISAYNTRLFKSAEGG--SYRIVQASAESSVVAEPTDFTDEASGRSGKFSVE--RGDYRELMSLALPHLRNAEAAALNANQAEMLRRYAASFAGGSIDEHKAGSRAWIRDKGPAVETYMGFIESYRDPFGVRGEFESFVAVVNKEQSAKFNALVSNAEKFLPLLPWPAAYEKDKFLQPDFTALEIVTFANSGVPLGINIPNYDDIRQSEGFKNVSLGNVLSSSFSDPKTTFLVAEDKDIWIRRIAQSFEVQVGLHELLGHGSGKLFKQDSDGKFNFDPSSVVDLVTGKPVASWYKVGETWDGKFSNLASAFEECRAECVGVYLCDVPEVLAVFGHPDKAEADEVIYVNWLCMARAGVASLEMYSPENGGTWRQAHSRARFAILRALLEAGQGLVTIDEITGEDGKPDLTVRLDRSKISSVAKPAIGEFLKRLQSFKSTCSVEAGRAFFESYSTVDAYFQRLRDIVIARRKPRRVFIQANLSMDSSGSVSIVEYSDGPAEMIRSFRDRFSDEDWGRIEEALWQQWERD 760          
BLAST of Dipeptidyl peptidase 3 vs. TrEMBL
Match: A0A0B6YUJ3 (Dipeptidyl peptidase 3 OS=Arion vulgaris OX=1028688 GN=ORF35366 PE=3 SV=1)

HSP 1 Score: 713.761 bits (1841), Expect = 0.000e+0
Identity = 364/729 (49.93%), Postives = 497/729 (68.18%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFK-QIENGITKYEVRQASSLKNVNRRLEI------------SNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQ----FLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRDSSIF 2241
            S Y+++    V  LDC+ +F+ L+  E+ Y+  L +A + G LI   Q SPESP LF+L Q LF+ Q+P+      + L  +  + + FF Y A  Y N+GNY+SFGD+KFIP +D+   + +IK S AY+ D+  ++++D++K  +FSL SR+ ++G  ++G +TYYS NC   DAK  Q ++D + IS YNTR+FK Q E+G   YEVR AS   +V+                 S    + + ++  GDY  +M L+V EL+KA+  A N+NE++M++ Y  SF TGS+ AHK+GS YWI ++GPIVE YIGFIESYRDP+GVRGEFE F+AVVNK MS KF  LV  A  +L  LPWP EYEKD FL+PDFTSLD++ F  SG+P GINIPNYDDIRQN GFKNVSLGNVL S ++D K  F+ +E KE++ K    +FEVQVGLHEL+GHGSGKLF   + G++NFD  +     TN  I SWY+  ETWDS F+TIAS +EECRAECVG+YLC L ++ KIFG  G ++ +DII++NWL+M+K+ L+++EFY+P+   WRQAH  ARFVIL+V+LEAGQDL+K+E IT +DGRPDL + L+R+KI  VG+P IG FL  LQ YKST +V+   K ++ YS +N+Q    FL LR IVLDRK PR + +Q     + E + KL  Y +T+  +IQSF DRFS  S D+ D  + ++W+++   +
Sbjct:    8 SQYVIQNSTDVVLLDCETAFKGLSATERLYAHHLAQASFKGGLIVLFQTSPESPGLFVLLQKLFRAQSPKEILDLAQTLGFSAEEQEAFFIYAAAFYNNMGNYKSFGDTKFIPGVDKSKVEALIKASSAYQKDDGVQKLWDEVKDRMFSLDSRHTELGFRDKGTTTYYSGNCDQSDAKLAQEFLDSHKISPYNTRLFKTQDESGQVVYEVRLASCATDVSEVQGYPSGKVLGDYNFNSKDGKHAKFRVTRGDYSTLMALVVEELQKAQKYASNDNERNMLQEYSNSFSTGSLPAHKDGSLYWIRNRGPIVETYIGFIESYRDPYGVRGEFEGFVAVVNKAMSAKFTELVNSAEHLLAHLPWPSEYEKDTFLRPDFTSLDVLAFGGSGIPAGINIPNYDDIRQNEGFKNVSLGNVLTSGYRDTKITFLRDEDKELYSKYKILSFEVQVGLHELLGHGSGKLFIEEEPGKFNFDKESVTHTETNEKITSWYQHGETWDSKFSTIASTYEECRAECVGIYLCLLSDVLKIFGHVG-DDADDIIYINWLNMVKAGLMALEFYSPDTGSWRQAHMNARFVILRVMLEAGQDLVKVEKITGDDGRPDLRVVLDRAKIIPVGKPAIGAFLRKLQVYKSTCDVESATKMYSYYSDVNDQDSPKFLSLRCIVLDRKQPRKLFVQHHTYVENE-AVKLKNYNSTASDLIQSFKDRFS--SNDI-DSVILDLWEKEKPFY 731          
BLAST of Dipeptidyl peptidase 3 vs. TrEMBL
Match: A0A267FUB8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003174g5 PE=4 SV=1)

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 354/714 (49.58%), Postives = 472/714 (66.11%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNV-----NRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQ-KKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRD 2229
            S Y V  + PV  L C  +F+ L++AEK Y+  L +A W G LI   Q S ESP LFL+ Q +F+RQ PE      K   V++ D   F  Y   V GNLGNY+SFGD+K +P + EE  D+II +S+A+ + E+ R  + +++    SLT RN+Q+GLG  G++ Y+S NC   DAK  Q ++D   ISAYNTR+FK  + G   Y + QA++  +V     +   E S  S    V+   G Y+E+M L +  L+ A+  ALN N+  M++ Y  SF  GSID HK GS+ WI DKGP VE Y+GFIESYRDPFGVRGEFE+F+AVVNKE S KF +LV  A   L  LPWP  YEKDKFLQPDFT+L+I+ F  SG+P+GINIPNYDDIRQ+ GFKNVSL NVL S F DPK+ F+  E K+I+I+    +FEVQVGLHEL+GHGSGKLF    DG++NFD ++  DL+T  P+ SWYK  ETWD  F+ +AS FEECRAECVG+YLC + E+  +FG   +   +++I+VNWL M ++ + S+E Y+PE    WRQAH +ARF IL+ LLEAGQ L+ I+ IT EDG+PDL + L+RSKI +V +P IG+FL  LQ +KST +V+ G +FF  YS ++  F  LR+IV+ R+ PR + IQ  +  D   S  ++EY      MI+SF DRFS +     + AL++ W+RD
Sbjct:   54 SLYTVPTDAPVTFLACGPAFEKLSQAEKAYAYHLYRASWIGGLICLHQTSAESPGLFLVLQSVFRRQTPEQLRAACKA-GVSDADWDAFLMYATQVLGNLGNYKSFGDTKILPDLSEEALDKIITVSEAHASSERVRVAWQRVRAAASSLTERNRQLGLGTAGVTAYFSDNCDESDAKLAQAFLDSRQISAYNTRLFKSADGG--SYRIVQAAAESSVVAEPTDFTDEASGRSGKFSVE--RGGYRELMSLALPHLRNAEAAALNANQAEMLRRYAASFAGGSIDEHKAGSRAWIRDKGPAVETYMGFIESYRDPFGVRGEFESFVAVVNKEQSAKFNALVSNAEKFLSLLPWPAAYEKDKFLQPDFTALEIVTFANSGVPLGINIPNYDDIRQSEGFKNVSLANVLSSSFSDPKTTFLVAEDKDIWIRRIAQSFEVQVGLHELLGHGSGKLFKQDSDGKFNFDPSSVVDLVTGKPVASWYKVGETWDGKFSNLASAFEECRAECVGVYLCDVPEVLAVFGHPDKAEADEVIYVNWLCMARAGVASLEMYSPENGGTWRQAHSRARFAILRALLEAGQGLVTIDEITGEDGKPDLTVRLDRSKISSVAKPAIGEFLKRLQSFKSTCSVEAGREFFESYSTVDAYFQRLRDIVIARRKPRRVFIQANLSMDSAGSVSIVEYSDGPAEMIRSFRDRFSDEDWGRIEEALWQQWERD 762          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Cavefish
Match: dpp3 (dipeptidyl peptidase 3 [Source:NCBI gene;Acc:103042368])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 349/727 (48.01%), Postives = 483/727 (66.44%), Query Frame = 1
Query:  103 MSSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYK-TDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKN---VNRRLEISNPS---HNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKS--NFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFKD-GQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSIL----NEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRDSSIF 2241
            + S Y +  +  +  LDC  +F+ L+  EK Y+  L +A WYG L+  +Q SPESP +++L Q +F++Q P           +   + + F  Y A +Y N+GNY+SFGD+KFIP + +E F  ++  S AYK   ++   +++    L++SL  + KQ+GLG++GI+TY+S NC ++DA+  Q ++D  N+SAYNTR+FK+   G   YEVR AS++K    V    E    +    N    +  GDY  +ME + + L+KAK  A +EN+  M++ Y+ SF  GS+DAHKEGS+YWI DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK MS +F  LV  A  +L ELPWP  +EKD+FL+PDFTSLD++ F  SG+P GINIPNYDDIRQ  GFKNVSLGNVL   +   K    F+  + K+++IK    +FEVQVGLHEL+GHGSGKLF   D G +NF+    ++  T   I+SWYKG+ETWDS F+TIAS +EECRAECVGLYLC  K++  IFG  G+E   ++++VNWL+M+++ L+ +EFYTPE K WRQAH QARFVIL+VLLEAG+ L+ +   T  DGRPD LI L+RSK+ TVG+  I KFL  LQ +KSTA+V+ G   +  YS +    +  FL LRE VL RK  R + +Q   C   E + +L EY +++ G+IQSF +RF+  + ++ +  L E+  +DS+ +
Sbjct:    2 VDSQYYLPNDIGISALDCAEAFRLLSPKEKLYAHYLSRAAWYGGLVVLLQTSPESPTIYVLLQRIFRKQPPAELEAVATAAGLTSEEYQAFLVYAAGLYANMGNYKSFGDTKFIPNLPKEKFKALVWESQAYKERPDEIEVLWNSCSNLLYSLEDKQKQLGLGDKGITTYFSGNCCLEDAELAQKFLDSKNLSAYNTRLFKKECGGKRCYEVRLASAVKKDCAVEGEAESRCGTFEFENASFTVCRGDYALLMEKVSHNLEKAKAYASDENQTRMLEEYVRSFTYGSVDAHKEGSRYWIKDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSARFAQLVSSAEVLLPELPWPSAFEKDRFLKPDFTSLDVLTFAGSGIPAGINIPNYDDIRQTEGFKNVSLGNVLAVAYATQKEKLTFLDEKDKDLYIKWKGPSFEVQVGLHELLGHGSGKLFVQDDKGNFNFNQAEVRNPETGELISSWYKGSETWDSKFSTIASSYEECRAECVGLYLCLNKQVLGIFGHEGEEA-EEVVYVNWLNMVRAGLLGLEFYTPESKSWRQAHMQARFVILRVLLEAGEGLVSLSETTGADGRPDALITLDRSKVHTVGKNAIQKFLCRLQVHKSTADVEGGRALYQGYSAVTSDGSHDFLRLRETVLLRKEARKMFVQANTCVKGE-AVELEEYESSAAGLIQSFTERFTDDAEEV-EAHLLEMASKDSTCW 725          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008248.1 (pep scaffold:Pmarinus_7.0:GL482619:3980:14578:1 gene:ENSPMAG00000007464.1 transcript:ENSPMAT00000008248.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 255.758 bits (652), Expect = 1.261e-80
Identity = 119/193 (61.66%), Postives = 150/193 (77.72%), Query Frame = 1
Query:  880 ALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKD--PKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF 1452
            A NE+E  M+  YI+SF  GSIDAHK GS +WI DKGPIVE+YIGFIESYRDPFG RGEFE F+A+VNK+MS K+  LV  A  +L +LPWP  +EKD+FL+PDFTSL+++ F  SG+P GINIPNYDDIRQ+ GFKNVSLGNVL + +++   K  F+    K+++++    +FEVQVGLHEL+GHGSGKL 
Sbjct:    1 AANEHEVGMLAGYIDSFTYGSIDAHKRGSSHWIKDKGPIVESYIGFIESYRDPFGSRGEFEGFVAMVNKDMSAKYSRLVASAEELLPQLPWPASFEKDRFLKPDFTSLEVLTFAGSGIPAGINIPNYDDIRQSEGFKNVSLGNVLSASYQEEREKLTFMTESDKDLYVQWKGPSFEVQVGLHELLGHGSGKLL 193          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007104.1 (pep scaffold:Pmarinus_7.0:GL478023:160466:171152:-1 gene:ENSPMAG00000006426.1 transcript:ENSPMAT00000007104.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 9.894e-34
Identity = 75/192 (39.06%), Postives = 100/192 (52.08%), Query Frame = 1
Query: 1519 INSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSL-VSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILN----EQFLHLREIVLDRKLPRGITIQ 2079
            I SWYK  ETWD  F++IAS +EECRAE VGLYL     + +    S     + +  V  +++   S   + E        W      + FVIL V L     L+ +E     DGRPD  I L+R+KI TVGR  I  FL  LQ YKSTA+V  G   +   S +N    ++FL LR+ V+ RK PR + +Q
Sbjct:    1 IKSWYKSKETWDGKFSSIASTYEECRAESVGLYLSLDLGVLRQMPLSKSPKDSHVKIVGMMAIAWHSWGAARESEEARAAPWLARASASIFVILHVCLSTTGGLVSVEHTVGADGRPDARISLDRAKIPTVGRAAIQDFLLKLQVYKSTADVDAGRALYAALSAVNDDTEQRFLALRDTVMLRKEPRKMFVQ 192          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Yeast
Match: YOL057W_mRNA (Dipeptidyl-peptidase III; cleaves dipeptides from the amino terminus of target proteins; highly active on synthetic substrate Arg-Arg-2-naphthylamide; mammalian ortholog may be a biomarker for some cancers [Source:SGD;Acc:S000005418])

HSP 1 Score: 446.817 bits (1148), Expect = 4.525e-147
Identity = 273/729 (37.45%), Postives = 401/729 (55.01%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNS-FQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLK-ELKVNEVDIKH------FFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLS-----------------DAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTM---DDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNVNRRLEISNPSHNI-------EVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVL----KSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQD--LLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDR 2169
            SH+  + + P+  L  K   F  LT+ E+KY+  + KA   G+ +   Q S ES  +F L             A+H K   K  E DI        +  Y +    NLGN++SFGD+KFIPR + + F ++++L+                   + +   F  I + I   I+ +  +   +G   +G ++ Y L   +   D A   +    E  I   NTR+ K  EN    +++  AS  +NV  ++  + PS  I       +V+ + GD+   M L+ + LK+A+  A N+ +K+M++ YI  F TGS  AHKE  K W+ D  P++E  IGFIE+YR+P G+ GEFE+ +A+ NKE + KF SLV  A   +  LPW K+YEK  F  PDFTSL+++ F  SG+P GINIPNYDD+R  +GFKNVSLGN+L    KS  K P S FI  E + IF K    +FEVQVG+HEL+GHGSGKL   F DG +NFD  N    +   P++++YK  ETW S F  +A PFEECRAE + ++L + K+I  IFGF   E+ + +I+  +L M ++ L+++E++ P+  KW Q H QARF I++  ++   D   LK+E  +  D   D  I L++S I+T G   +  +L  L  YK + +V++G K+F   S +      LR+IVL ++LPR   IQ     D      L EY  T +GM+QSF+DR
Sbjct:    2 SHFFADHDAPLSMLSVKTEYFPQLTDKEQKYAHFMSKASHAGSRVVMRQVSHESEPIFDL-----------ILAIHSKLNGKYPEDDITQKQQTGLYLEYVSQFLSNLGNFKSFGDTKFIPRCEVKFFKQLLELAKINPCSSPLTLSPVDVNHEFTSHHLFSTINELIDIGIYHVEEKAALLGFPSQGYTSAYYLGLPVTPEDMALLKEQLFAELAILPENTRINKVGENS---FQIWVAS--ENVKNQITETYPSGQITLSNAVTKVEFIFGDHSREMRLVASYLKEAQKFAANDTQKAMLQEYINHFVTGSSQAHKEAQKLWVKDISPVIETNIGFIETYREPSGIIGEFESLVAIQNKERTAKFSSLVNNAEEFISLLPWSKDYEKPIFNPPDFTSLEVLTFTGSGIPAGINIPNYDDVRLKIGFKNVSLGNILSAAAKSSSKHPPS-FISQEDRPIFEKYQSDSFEVQVGIHELLGHGSGKLLTEFTDG-FNFDKENPPLGLDGKPVSTYYKVGETWGSKFGQLAGPFEECRAEVIAMFLLTNKKILDIFGFHDVESQDKVIYAGYLQMARAGLLALEYWNPKTGKWGQPHMQARFSIMKTFMKHSTDKNFLKLEMNSTND---DFAIKLDKSLIKTAGHECVKDYLKHLHVYKCSGDVEQGSKYFIDRSTVTPDLASLRDIVLSKRLPRRQFIQSNSYIDDNNKVTLKEYDETPQGMLQSFLDR 709          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Nematostella
Match: DPP3 (Dipeptidyl peptidase 3 [Source:UniProtKB/Swiss-Prot;Acc:A7RZW4])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 348/725 (48.00%), Postives = 470/725 (64.83%), Query Frame = 1
Query:  109 SHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVN----EVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEK-FREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQI-ENGITKYEVRQASSL----------KNVNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFK-DGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQC-VVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRD 2229
            + YI+  E  +  L+C+ +F  LTE EK Y+  L KA W GALI  +Q SPE+P +FLL Q LF  ++    +L  K LK +    E +   F  Y A  YGN+GNY+SFGD+KFIP + +E F  I+  S AY T+ K    ++      ++SL  + +Q+G GE+GISTYYS NC   DA+ IQ ++ E NI  +NTR+FK+I + G   Y +R AS+           K+    L  S       VK+  GDY  +++ +V+ L  AK  A NENE +M+  Y+ SF TGS++AHK+GS++WI DKGP+VE YIGFIESYRDPFGVR E+E F+++VNK MS KF  LV  A ++L +LPWP  YEKD FL+PDFTSLD++ F  SG+P GINIPNYD+IRQ+ GFKNVSLGNVL +   D K  F+  E  E++ K    +FEVQVGLHEL+GHGSGKLF  K DG YNFD  +  +  T   I SWY   ETW + F  ++S +EECRAECVG+YLC  K++ +IFG  G    +DI++VNWL+M+++ L+ +EFYTPE  KWRQAH QAR+VIL+VLLEAG+ L+++  I   DG+PD+L+ L+R+KI  VG+P IG FL  LQ +KSTA+   G   ++KYS ++  FL +R IVL RK PR + +Q     +D   S K  E+  ++ GMI SF+ RF G      D  L ++W+ D
Sbjct:    9 TQYIIPNEANINFLECRTAFGGLTEKEKCYAHYLYKASWEGALICLLQTSPEAPGIFLLFQKLFSSES--VGSLKEKALKSSVAPTEEEFTSFLTYVAAFYGNIGNYKSFGDTKFIPNLPKEKFQTIVFSSQAYATNAKSVVTLWSDCCEAMYSLKPKLRQLGFGEQGISTYYSSNCNKSDAEFIQGFLKEKNIEGWNTRLFKEINDKGHVTYNLRLASTALSAEDCSAEKKDDVASLVKSYEYQGTTVKITRGDYAGLLKKVVDNLIMAKGFASNENEVAMLDHYVHSFTTGSVEAHKDGSRHWIRDKGPVVETYIGFIESYRDPFGVRAEYEGFVSIVNKSMSAKFADLVSSAETLLPQLPWPSSYEKDTFLRPDFTSLDVLGFGSSGIPAGINIPNYDEIRQDEGFKNVSLGNVLSAHSADQKITFLTEEDAELYSKLKAPSFEVQVGLHELLGHGSGKLFIKKPDGSYNFDHKSVVNTETGEKIQSWYTEGETWSTKFAELSSSYEECRAECVGIYLCLNKDVLRIFGHEGAAG-DDIVYVNWLNMVRAGLLGLEFYTPENNKWRQAHMQARYVILRVLLEAGEQLVQLTRIAGSDGKPDILVTLDRNKISCVGQPAIGAFLRKLQVFKSTADYASGKDLYDKYSAVDAHFLEMRNIVLARKTPRRMFVQSHTTIQDGVVSLK--EFEASASGMIASFIARFPGD-----DPVLEKLWRDD 723          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Nematostella
Match: EDO30098 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1R9])

HSP 1 Score: 201.83 bits (512), Expect = 1.295e-60
Identity = 94/173 (54.34%), Postives = 125/173 (72.25%), Query Frame = 1
Query: 1432 HGSGKLFHFK-DGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQ 1947
            HGSGKLF  K DG YNFD  +  +  T   I SWY   ETW + F  ++S +EECRAECVG+YLC  K++ +IFG  G    +DI++VNWL+M+++ L+ +EFYTPE  KWRQAH QAR+VIL+VLLEAG+ L+++  IT  DG+PD+L+ L+R+KI  VG+P IG FL  LQ
Sbjct:    1 HGSGKLFIKKPDGSYNFDHKSVVNTETGEKIQSWYTEGETWSTKFAELSSSYEECRAECVGIYLCLNKDVLRIFGHEGAAG-DDIVYVNWLNMVRAGLLGLEFYTPENNKWRQAHMQARYVILRVLLEAGEQLVQLTRITGSDGKPDILVMLDRNKISCVGQPAIGAFLRKLQ 172          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Medaka
Match: dpp3 (dipeptidyl peptidase 3 [Source:NCBI gene;Acc:101174283])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 342/727 (47.04%), Postives = 490/727 (67.40%), Query Frame = 1
Query:  103 MSSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDE-KFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKN---VNRRLEISNPSHNIEVK---LVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKS--NFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQ----FLHLREIVLDRKLPRGITIQC---VVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRDS 2232
            + S Y +  +  +  LDC+ +F+ L+  EK Y+  L +A WYG L+  +Q SPES  +F+L Q +F+++ PE        + ++  + K F  Y A +Y N+GNY+SFGD+KF+P + ++  + +++ S A++    +   +++    LI+SL  R KQ+GLG++GI+TY+S NCT++DA+  Q ++D   +SAYNTR+FK+ + G   YEVR AS+++    V+   E S  +   E K   +  GDY  +ME +   L++A+  A NEN++ M++ Y  SF  GS+++HKEGS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK MS +F  LV  A  +L ELPWP+E+EKD FL+PDFTSLD++ F  SG+P GINIPNYDDIRQ+ GFKNVSLGNVL   +   K    F+  E K++FIK    +FEVQVGLHEL+GHGSGKLF     G+ NF+ +   +  T   ++SWY+G+ETWDS F+TIAS +EECRAECVGLYLC  KE+ +IFG  GQ +  D++++NWLSM+++ L+ +EFYTPE K WRQAH QARFVIL+VLLEAG+ L+ ++ +   DG+PD  I L+R+KI TVG+  I +FL  LQ +KSTA+V+ G   ++ YS + +     FL LRE VL RK  R + +Q    V  + +E    L+EY +++ G+I+SF +RF  +  D  +  L E+ K+D+
Sbjct:    2 VDSQYYLPNDIGISALDCREAFRLLSPQEKMYAHYLSRASWYGGLVVLLQTSPESANIFVLLQRIFRKETPEELEKVAATVGLSSEEYKAFLVYAAGLYANMGNYKSFGDTKFVPNLPKDKLEALVRASQAFQEKPVEMEALWNSSSTLIYSLEDRQKQLGLGDKGITTYFSGNCTLEDAELAQRFLDSKKLSAYNTRLFKRNDGGKVCYEVRLASAVQKDCAVDGEKETSCGTFTFEDKEFIVKRGDYCPLMEKVCFYLQQAEAYAANENQQKMLEQYRHSFNFGSVESHKEGSRFWIKDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSERFTKLVSSAEVLLSELPWPQEFEKDTFLKPDFTSLDVLTFAGSGIPAGINIPNYDDIRQSEGFKNVSLGNVLAVAYATQKEKLTFLKEEDKDLFIKWKGPSFEVQVGLHELLGHGSGKLFVQDHKGKLNFNKDKVINPETGELVSSWYQGSETWDSKFSTIASSYEECRAECVGLYLCLNKEVLRIFGLEGQ-DAEDVVYINWLSMVRAGLLGLEFYTPESKNWRQAHMQARFVILRVLLEAGEGLVGLKEVVGHDGKPDAQITLDRTKIHTVGKHAIQRFLCKLQVFKSTADVEGGRALYDGYSSVGDSGANNFLRLRETVLLRKEARKMFVQANTKVNGDHVE----LVEYESSAAGLIRSFTERFQ-EDADQLEADLLELSKKDT 722          
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Medaka
Match: dpp3 (dipeptidyl peptidase 3 [Source:NCBI gene;Acc:101174283])

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 332/721 (46.05%), Postives = 474/721 (65.74%), Query Frame = 1
Query:  103 MSSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDE-KFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNVNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKS--NFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF-HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQ----FLHLREIVLDRKLPRGITIQC---VVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRDS 2232
            + S Y +  +  +  LDC+ +F+ L+  EK Y+  L +A WYG L+  +Q SPES  +F+L Q +F+++ PE        + ++  + K F  Y A +Y N+GNY+SFGD+KF+P + ++  + +++ S A++    +   +++    LI+SL  R KQ+GLG++GI+TY+S NCT++DA+  Q ++D   +SAYNTR+FK+ + G   YEVR AS+++       +  P           D  +               A NEN++ M++ Y  SF  GS+++HKEGS++WI DKGPIVE+YIGFIESYRDPFG RGEFE F+AVVNK MS +F  LV  A  +L ELPWP+E+EKD FL+PDFTSLD++ F  SG+P GINIPNYDDIRQ+ GFKNVSLGNVL   +   K    F+  E K++FIK    +FEVQVGLHEL+GHGSGKLF     G+ NF+ +   +  T   ++SWY+G+ETWDS F+TIAS +EECRAECVGLYLC  KE+ +IFG  GQ +  D++++NWLSM+++ L+ +EFYTPE K WRQAH QARFVIL+VLLEAG+ L+ ++ +   DG+PD  I L+R+KI TVG+  I +FL  LQ +KSTA+V+ G   ++ YS + +     FL LRE VL RK  R + +Q    V  + +E    L+EY +++ G+I+SF +RF  +  D  +  L E+ K+D+
Sbjct:    2 VDSQYYLPNDIGISALDCREAFRLLSPQEKMYAHYLSRASWYGGLVVLLQTSPESANIFVLLQRIFRKETPEELEKVAATVGLSSEEYKAFLVYAAGLYANMGNYKSFGDTKFVPNLPKDKLEALVRASQAFQEKPVEMEALWNSSSTLIYSLEDRQKQLGLGDKGITTYFSGNCTLEDAELAQRFLDSKKLSAYNTRLFKRNDGGKVCYEVRLASAVEK-----NVVLPLFKCFFFFFFTDSWQAY-------------AANENQQKMLEQYRHSFNFGSVESHKEGSRFWIKDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSERFTKLVSSAEVLLSELPWPQEFEKDTFLKPDFTSLDVLTFAGSGIPAGINIPNYDDIRQSEGFKNVSLGNVLAVAYATQKEKLTFLKEEDKDLFIKWKGPSFEVQVGLHELLGHGSGKLFVQDHKGKLNFNKDKVINPETGELVSSWYQGSETWDSKFSTIASSYEECRAECVGLYLCLNKEVLRIFGLEGQ-DAEDVVYINWLSMVRAGLLGLEFYTPESKNWRQAHMQARFVILRVLLEAGEGLVGLKEVVGHDGKPDAQITLDRTKIHTVGKHAIQRFLCKLQVFKSTADVEGGRALYDGYSSVGDSGANNFLRLRETVLLRKEARKMFVQANTKVNGDHVE----LVEYESSAAGLIRSFTERFQ-EDADQLEADLLELSKKDT 698          
BLAST of Dipeptidyl peptidase 3 vs. Planmine SMEST
Match: SMESG000079740.1 (SMESG000079740.1)

HSP 1 Score: 1466.44 bits (3795), Expect = 0.000e+0
Identity = 712/714 (99.72%), Postives = 713/714 (99.86%), Query Frame = 1
Query:  103 MSSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNVNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADIALYEVWKRDSSIFL 2244
            MSSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNVNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRP IGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLA+IALYEVWKRDSSIFL
Sbjct:    1 MSSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQCSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYGNLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIFSLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFKQIENGITKYEVRQASSLKNVNRRLEISNPSHNIEVKLVNGDYQEVMELMVNELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVENYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPWPKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSLGNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLFHFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAECVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQKKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIETVGRPAIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDRKLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLAEIALYEVWKRDSSIFL 714          
The following BLAST results are available for this feature:
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DPP30.000e+047.92dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGN... [more]
DPP30.000e+047.92dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGN... [more]
DPP30.000e+047.92dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGN... [more]
DPP30.000e+045.71dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGN... [more]
DPP39.490e-4941.41dipeptidyl peptidase 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dpt-10.000e+044.82Dipeptidyl peptidase 3 [Source:UniProtKB/TrEMBL;A... [more]
dpt-10.000e+044.82Dipeptidyl peptidase 3 [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DppIII0.000e+045.34gene:FBgn0037580 transcript:FBtr0081840[more]
DppIII0.000e+045.34gene:FBgn0037580 transcript:FBtr0081841[more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dpp30.000e+047.74dipeptidyl-peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dpp36.435e-2135.65dipeptidyl-peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DPP30.000e+048.45dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:10173... [more]
DPP30.000e+048.45dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:10173... [more]
DPP30.000e+047.91dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:10173... [more]
DPP30.000e+048.37dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:10173... [more]
DPP30.000e+048.65dipeptidyl-peptidase 3 [Source:NCBI gene;Acc:10173... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dpp30.000e+047.69dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1... [more]
Dpp34.001e-13847.42dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1... [more]
Dpp35.698e-4137.77dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1... [more]
Dpp37.244e-3750.00dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1... [more]
Dpp33.536e-2735.33dipeptidylpeptidase 3 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7RZW4|DPP3_NEMVE0.000e+048.00Dipeptidyl peptidase 3 OS=Nematostella vectensis O... [more]
sp|O55096|DPP3_RAT0.000e+047.48Dipeptidyl peptidase 3 OS=Rattus norvegicus OX=101... [more]
sp|Q9NY33|DPP3_HUMAN0.000e+047.92Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q99KK7|DPP3_MOUSE0.000e+047.69Dipeptidyl peptidase 3 OS=Mus musculus OX=10090 GN... [more]
sp|Q9VHR8|DPP3_DROME0.000e+045.34Dipeptidyl peptidase 3 OS=Drosophila melanogaster ... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UB740.000e+050.76Dipeptidyl peptidase 3 OS=Mesocestoides corti OX=5... [more]
A0A2B4R4C20.000e+049.58Dipeptidyl peptidase 3 OS=Stylophora pistillata OX... [more]
A0A267FVS40.000e+050.28Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A0B6YUJ30.000e+049.93Dipeptidyl peptidase 3 OS=Arion vulgaris OX=102868... [more]
A0A267FUB80.000e+049.58Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dpp30.000e+048.01dipeptidyl peptidase 3 [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008248.11.261e-8061.66pep scaffold:Pmarinus_7.0:GL482619:3980:14578:1 ge... [more]
ENSPMAT00000007104.19.894e-3439.06pep scaffold:Pmarinus_7.0:GL478023:160466:171152:-... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOL057W_mRNA4.525e-14737.45Dipeptidyl-peptidase III; cleaves dipeptides from ... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
DPP30.000e+048.00Dipeptidyl peptidase 3 [Source:UniProtKB/Swiss-Pr... [more]
EDO300981.295e-6054.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dpp30.000e+047.04dipeptidyl peptidase 3 [Source:NCBI gene;Acc:10117... [more]
dpp30.000e+046.05dipeptidyl peptidase 3 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Dipeptidyl peptidase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000079740.10.000e+099.72SMESG000079740.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000158 ID=SMED30000158|Name=Dipeptidyl peptidase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2383bp
CAATTTAGTATTTAAACTTTTTGACATTACAATTTCTTTTATTTACAGGT
ATTATTAACTTAAGTTGAATTGAATTATTATAAAACTTTTTACTCGATTA
ATATGAGTAGCCATTACATCGTTGAAGAAGAATTTCCAGTTTATTGTCTA
GATTGTAAAAATAGTTTTCAGAACTTGACCGAAGCCGAGAAAAAATATTC
ATTAGCTTTAATTAAAGCAGGATGGTATGGTGCCTTAATTGACTATGTTC
AATGTTCACCGGAATCTCCAGCTTTATTCTTGCTTTCTCAAATATTATTC
AAAAGGCAAAATCCTGAAACATTCGCTTTGCACTTAAAAGAATTAAAAGT
TAATGAAGTTGATATTAAACACTTTTTCAATTATTTTGCTACAGTATATG
GAAATTTAGGCAATTATCGATCTTTTGGTGATTCCAAATTTATTCCTCGA
ATAGATGAAGAAAATTTTGACAGAATTATAAAGTTATCAGACGCTTACAA
AACAGATGAAAAATTTAGAGAAATTTATGATAAAATCAAACCTCTGATAT
TTTCCTTAACTTCAAGAAATAAGCAAATGGGTCTTGGCGAAGAAGGGATT
AGTACATATTACTCTTTAAATTGTACTATGGATGATGCTAAAGAAATTCA
AGTCTATATGGATGAAAATAACATTAGTGCTTACAACACAAGAGTTTTTA
AGCAAATTGAAAATGGTATTACAAAATATGAAGTGAGACAAGCATCTTCA
TTAAAAAATGTTAACAGGAGATTAGAAATTTCCAATCCTTCCCATAATAT
CGAAGTAAAATTGGTCAATGGAGACTACCAGGAAGTGATGGAGTTGATGG
TTAATGAATTAAAAAAAGCAAAAGATTTAGCATTAAATGAAAACGAAAAA
TCAATGATAAAATGCTACATTGAAAGCTTTGAAACAGGGTCAATTGATGC
TCACAAGGAAGGTTCAAAATACTGGATTCTAGACAAAGGACCTATCGTTG
AGAATTATATTGGATTTATTGAATCATATCGAGATCCATTTGGAGTTCGT
GGTGAATTCGAAACATTTATAGCAGTAGTTAATAAAGAAATGAGTAGGAA
ATTTGAAAGTTTAGTCAGGGAAGCTCCTTCTATTTTAAAAGAGTTGCCAT
GGCCTAAAGAATATGAAAAAGATAAATTTTTGCAGCCAGACTTCACATCA
TTAGATATCATTAATTTTCCCGTTAGTGGAATGCCAGTGGGAATAAACAT
TCCAAATTATGATGATATTCGTCAAAATGTGGGATTCAAGAATGTTTCGT
TGGGCAATGTATTGAAATCAAGATTTAAGGATCCAAAATCTAATTTTATT
CCAAATGAGCACAAGGAAATCTTTATCAAAAATGCAGAGAGCGCATTCGA
AGTTCAAGTTGGGCTTCATGAATTGATTGGTCACGGTAGTGGAAAGCTGT
TTCATTTCAAGGATGGACAATATAATTTTGATTCCAATAATACTAAAGAT
TTAATAACAAATCTTCCTATAAATAGCTGGTATAAAGGCAATGAAACTTG
GGATAGTGTTTTTACGACAATTGCATCTCCATTTGAAGAATGTAGGGCAG
AGTGTGTTGGTCTGTATTTATGTTCTCTAAAAGAAATAGGAAAAATATTT
GGATTTAGTGGTCAAGAAAATCTTAATGACATTATATTCGTTAATTGGTT
GTCAATGATTAAGTCGTCTCTAGTTTCCATGGAATTTTATACTCCAGAAC
AAAAAAAATGGCGACAAGCGCATTGTCAAGCGCGTTTTGTTATTCTACAA
GTTTTATTAGAAGCTGGACAGGATTTGTTAAAAATCGAAACAATTACTGC
AGAAGATGGTCGACCAGATTTGCTAATCCATCTGAACCGTTCTAAAATTG
AAACCGTTGGTCGACCTACAATCGGAAAATTTTTGAGTTGTTTACAATGT
TACAAAAGCACTGCAAATGTGAAAGAGGGTGTCAAATTTTTCAATAAATA
TTCAATTCTCAATGAACAGTTTTTGCATCTCCGAGAAATAGTTTTGGATC
GTAAATTGCCAAGAGGTATTACAATTCAATGTGTAGTTTGTGAGGATATT
GAAAAATCCCCGAAACTTATCGAGTACCCAACCACTTCTGAAGGCATGAT
CCAATCTTTTGTGGATCGATTTTCCGGGAAATCTGGTGATCTAGCCGATA
TTGCATTGTATGAGGTTTGGAAACGAGACAGTTCAATTTTCCTATGAGGA
TTTTCTGAAACTTAATTTGCTAATTATTTAAAAACATTTTTAATAAATAA
CTGTGTTTATTTGTTTTTACATATTATTTTGTCTTGCTTATAATATTTAA
TGCAAATAAAATATTCAAAATTTTTAAAAAAAA
back to top

protein sequence of SMED30000158-orf-1

>SMED30000158-orf-1 ID=SMED30000158-orf-1|Name=SMED30000158-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=715bp
MSSHYIVEEEFPVYCLDCKNSFQNLTEAEKKYSLALIKAGWYGALIDYVQ
CSPESPALFLLSQILFKRQNPETFALHLKELKVNEVDIKHFFNYFATVYG
NLGNYRSFGDSKFIPRIDEENFDRIIKLSDAYKTDEKFREIYDKIKPLIF
SLTSRNKQMGLGEEGISTYYSLNCTMDDAKEIQVYMDENNISAYNTRVFK
QIENGITKYEVRQASSLKNVNRRLEISNPSHNIEVKLVNGDYQEVMELMV
NELKKAKDLALNENEKSMIKCYIESFETGSIDAHKEGSKYWILDKGPIVE
NYIGFIESYRDPFGVRGEFETFIAVVNKEMSRKFESLVREAPSILKELPW
PKEYEKDKFLQPDFTSLDIINFPVSGMPVGINIPNYDDIRQNVGFKNVSL
GNVLKSRFKDPKSNFIPNEHKEIFIKNAESAFEVQVGLHELIGHGSGKLF
HFKDGQYNFDSNNTKDLITNLPINSWYKGNETWDSVFTTIASPFEECRAE
CVGLYLCSLKEIGKIFGFSGQENLNDIIFVNWLSMIKSSLVSMEFYTPEQ
KKWRQAHCQARFVILQVLLEAGQDLLKIETITAEDGRPDLLIHLNRSKIE
TVGRPTIGKFLSCLQCYKSTANVKEGVKFFNKYSILNEQFLHLREIVLDR
KLPRGITIQCVVCEDIEKSPKLIEYPTTSEGMIQSFVDRFSGKSGDLADI
ALYEVWKRDSSIFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039461Peptidase_M49
IPR005317Dipeptidyl-peptase3
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0008239dipeptidyl-peptidase activity
GO:0004177aminopeptidase activity
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005317Dipeptidyl-peptidase 3PIRSFPIRSF007828Dipeptidyl-peptidase_IIIcoord: 1..692
e-value: 3.2E-269
score: 892.3
IPR039461Peptidase family M49PFAMPF03571Peptidase_M49coord: 141..689
e-value: 1.3E-218
score: 726.9
IPR039461Peptidase family M49PANTHERPTHR23422DIPEPTIDYL PEPTIDASE III-RELATEDcoord: 3..691
NoneNo IPR availableGENE3DG3DSA:1.20.120.1470coord: 344..410
e-value: 1.8E-25
score: 91.4
NoneNo IPR availableGENE3DG3DSA:1.20.120.1470coord: 222..332
e-value: 3.0E-34
score: 119.9
NoneNo IPR availablePANTHERPTHR23422:SF11DIPEPTIDYL PEPTIDASE 3coord: 3..691