Netrin 1

Overview
NameNetrin 1
Smed IDSMED30000153
Length (bp)1945
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Netrin 1 (SMED30000153) t-SNE clustered cells

Violin plots show distribution of expression levels for Netrin 1 (SMED30000153) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Netrin 1 (SMED30000153) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Netrin 1 (SMED30000153) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000153

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30000153h1SMcG0007922 dd_Smed_v4_9737_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000153h1SMcG0007922 dd_Smed_v4_9737_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000153h1SMcG0007922 dd_Smed_v4_9737_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30000153h1SMcG0007922 dd_Smed_v4_9737_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000153h1SMcG0007922 dd_Smed_v6_9737_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30000153h1SMcG0007922 OX_Smed_1.0.16909ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30000153h1SMcG0007922 dd_Smed_v4_9737_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000153h1SMcG0007922 dd_Smed_v4_9737_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 312.768 bits (800), Expect = 1.742e-97
Identity = 193/590 (32.71%), Postives = 307/590 (52.03%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK---CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C  E+G  + C PDF+N A      V+STCG+  +  R C      S   E +   C  C+   P+ +   + + D N   + T W S    +F   H++ +T++L K +EV Y+ ++F    P+SM +YK    G+TW+P+ ++S+ C+K +      P+  Q    N+    C      ++ ++  +  + F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S     S    +SD+ +G R +C GHA   ++ ++ + VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GYYR+   PI H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  + +   E C S     K + +I  +K+CKK   ++I I   +  G+W +F V ++ +++   S      +   + S   +W+ + DI CKCP ++    YLLL     ++  +Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   41 CSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPA--RYC----VVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFP--HNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ----NEQEAVCTDSHTDMRPLSGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTS-----RIRRGDQS---LWIRSRDIACKCPKIKPLKKYLLLGNA--EDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN3 (netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030])

HSP 1 Score: 240.35 bits (612), Expect = 2.739e-70
Identity = 161/571 (28.20%), Postives = 253/571 (44.31%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSV-QNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLL---TDGSKKRNKS--PYDHLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAP-----ETKNNLMATEERCGS-CGKNRP--RIRFRKFCKKHIMIKISIQSK-EIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTY----LLLTKIKLKNYLNQPELIVDRKSSALDWSDDWI 1786
            C  E G  + C P  +N A       +STCG+  +                     CD   P  + + +L+           W S  +P+     ++ +T+ L K +E+ ++ + F    P S+ L K   +G++W P  +FSS C   +       L           P    F   + Q   S +        +     L +S ++++WV+ TD+ + L    T G  +  ++  PY + + +D+ +G R +C GHA + L+   G  +CDC H T GPDC +C   + D+PW+     E   + C  C CN HA  C+F+ ++Y+ S  + G  CL+C H+T G HC+ C  G+YR+    ++  + C+ C CHP G+  ++ CN   G C CK GV G  CNRC  G+QQ++S   PC        T+++     + C S C   R   RI  +KFCKK   +++++ ++ E  G WTRF V VL ++R  +          +      +WV   D  C CP L  G  Y                  P LI  R S  L W D W 
Sbjct:   30 CHDEGGAPRGCVPGLVNAALGREVLASSTCGRPATR-------------------ACDASDPRRAHSPALLTSPGGTASPLCWRSESLPR--APLNVTLTVPLGKAFELVFVSLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGR-----LPAPANGPAGPGPEALCFPAPLAQPDGSGLLAFSMQDSSPPGLDLDSSPVLQDWVTATDVRVVLTRPSTAGDPRDMEAVVPYSY-AATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRATARE--SHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRALSDRRACRACDCHPVGAAGKT-CNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTPIPGPTEDSSPVQPQDCDSHCKPARGSYRISLKKFCKKDYAVQVAVGARGEARGAWTRFPVAVLAVFRSGEE--------RARRGSSALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAGGRGPGLIAARGSLVLPWRDAWT 562          
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN5 (netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208])

HSP 1 Score: 196.052 bits (497), Expect = 9.030e-55
Identity = 116/339 (34.22%), Postives = 160/339 (47.20%), Query Frame = 2
Query:  866 ARSQCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCA--PETKNNLMATEERCGS---------CGKNRPRIRFRKFCKKHIMIKISIQSKEIHG-EWTRFGVRVLKIW--RIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPE---LIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
             R QC+GHA     +     C C H T GP C  C  +H D PW+   P  P  + C  C CN HA  C+F+ ++++ S G+ G  C  C HHT G HC+ C PG++R+ + PI   + C+ C CHP G+     CN  +G C CK+GV G  CNRC  GYQQ++S   PC   PE    L  T     S             R  +  R++C++  +++  + + E  G  W R  VRVL ++  R Q   +   +           WV  AD+ C C  LQ G  YLL     L + +  P+   LI+DR   AL W   W R L   +  E  G C
Sbjct:  155 GRCQCHGHAARCAARARPPRCHCRHHTTGPGCESCRPSHRDWPWRPATPRHP--HPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPIGAT-GGTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSLRRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPVRRGDQD----------AWVPRADLTCGCLRLQPGTDYLL-----LGSAVGDPDPTRLILDRHGLALPWRPRWARPLKRLQQEERAGGC 475          
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN4 (netrin 4 [Source:HGNC Symbol;Acc:HGNC:13658])

HSP 1 Score: 186.037 bits (471), Expect = 2.902e-50
Identity = 160/617 (25.93%), Postives = 247/617 (40.03%), Query Frame = 2
Query:  122 GFSSCFSESGRA-KFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGS-----KKRNKSP--YDHLSISDITIGARSQCYGHAKSLIKKNGTTV-------------CDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGS--LPQ---SYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKS-SSTPCAPETKNNLMATEERCGSCGKNRPRI-------RFRKFCKK-----------------HIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYP-IWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMRE 1816
            G S     S R  K C P   N+A        +TCGQ  +      +  T     + KC KC+   P L+   S + D + +   T W S        +H   I ++L   +   ++IV F    P +MVL +    GKTW P+ YF+++C  +          ++     K +     +          +     +P     +  P S  ++E + +T++ + LL   S        N+ P  + H +I D  +     C GHA   I  +G                C C H TAG  C  C   +ND+PW+       A N C  C CN HA+ C FD  +++ S  + G  C  C H+T G +C  C PG+YR+   P + P  C+ C CHP GS  LP    ++C+P NG C CK GV G+ C+RC  GY         PC     +   + +   G C  +   I        FR    K                 H ++KI I S    G      V++ K+ +      +++ ++  + ++YP  W +     C CP L  G  YL+     ++      +LIV+ KS    W     R++     RE
Sbjct:   19 GLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDLTCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAE-----DVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSAT--------FGLEDDVVKKGAICTSKYSSPFPCTGGEVIFKALSPPYDTEN--PYSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRRCDRCMVGYWGFGDYGCRPC-----DCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWEWEDAQGFSALLHSVLKIKILSAHDKGTHVEVNVKIKKVLK-----STKLKIFRGKRTLYPESWTDRG---CTCPILNPGLEYLVAGHEDIRT----GKLIVNMKSFVQHWKPSLGRKVMDILKRE 603          
BLAST of Netrin 1 vs. Ensembl Human
Match: LAMC1 (laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:6492])

HSP 1 Score: 190.274 bits (482), Expect = 4.340e-50
Identity = 134/436 (30.73%), Postives = 211/436 (48.39%), Query Frame = 2
Query:  125 FSSCFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLN--EGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIH---SINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISLL---TDGSKKRN-----KSPYDHLSISDITIGARSQCYGHAKSLIKKN-GTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQ-TKSSSTPCA 1381
               C  E GR + C P+F+N A N T   T+TCG           +   +G+      C  CD   P L    + + D N Q   T W S  +   +G+    SIN+T++L K +++ Y+ ++F    P+S  +YKR +    W+P+ Y+S SC+ ++       +         +    FS    +  +T     + F+ + GR S     NS +++EWV+ TDI ++L    T G +  N     KS Y   +ISD  +G R +C GHA   +K      VC+C H T G DC +CL   ND+PW+    +  + + C  C CN  ++EC FD ++Y+++   HG  C +C  +T G HC  C   ++R     + + + C  C C P GSL  + C+   G C CK GV G  C+RC+ G+   T++   PC+
Sbjct:   37 MDECTDEGGRPQRCMPEFVNAAFNVTVVATNTCGTPP------EEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTM--LAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFS---DISPLTGG--NVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYY--YAISDFAVGGRCKCNGHASECMKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRA--TAESASECLPCDCNGRSQECYFDPELYRSTG--HGGHCTNCQDNTDGAHCERCRENFFR-----LGNNEACSSCHCSPVGSL-STQCD-SYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCS 446          

HSP 2 Score: 65.0846 bits (157), Expect = 3.723e-10
Identity = 56/206 (27.18%), Postives = 89/206 (43.20%), Query Frame = 2
Query:  878 CYGHAKSLIKKNGTTVCDCLHKTAGPDCSQC---------LKTHND-QPW---------------KIIFPSEPAGNICERC-FCNNH--------------AEECKFDEKIYKNSSG---KHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQ-SYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKS 1363
            C GH+++   + G  VC+C   TAGP C +C           T +D QP                +++  + P G   +RC  C++                  C+  + I  N+ G   +    CL C+++T G +C+ C  G++ N   P N    C+ C C+ YG++ Q S CNP  G C+C   V G+ C  C  G+   +S
Sbjct:  726 CNGHSETCDPETG--VCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAP-NPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGFYNLQS 928          

HSP 3 Score: 52.7582 bits (125), Expect = 2.197e-6
Identity = 47/150 (31.33%), Postives = 64/150 (42.67%), Query Frame = 2
Query:  917 TTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRC--LHCLHHTTGPHCNSCSPGYYRNRAFPINH----PQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGY 1348
            T  C+CL    G DC  C       P    F +  +G  CERC C  HA           +++G+   R     C    TG HC  C           +NH    P+ C+ C CHP GSL  S    D+G C+C+ G  G  C++C++ Y
Sbjct:  902 TGQCECLPHVTGQDCGAC------DPG---FYNLQSGQGCERCDC--HA---------LGSTNGQCDIRTGQCECQPGITGQHCERCE----------VNHFGFGPEGCKPCDCHPEGSL--SLQCKDDGRCECREGFVGNRCDQCEENY 1019          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 291.967 bits (746), Expect = 7.062e-90
Identity = 184/591 (31.13%), Postives = 298/591 (50.42%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMI-------------SLLTDGSKKRNKSPYD-----HLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAP-ETKNNLMAT-----EERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C   +GR   C P+FIN A       + TCG     D+ C       G+   +C  CD R    S   SL+ D N  G+ T WVS   P  S   ++++T++L K +E+ Y+ + F  +LPDSM LYK    GKTW P+ ++SS C++ F         +     N+    C +    +     N    PF           NS ++++WV+ TDI +              L  D +   N++  +       S+ ++ +G R +C GHA + +  K G   CDC H TAG +C  C   H D+PW     +  + N C  C CN HA+ C+FD ++++ S  + G  CL+C H+T G +C+ C PG+ R+ + P+ H + C+ CGCHP GSL +S CN  +G C CK GV G  CNRC KGYQQ++S+ TPC    TK + + +     +++C  C     R+  +KFCK+   +++ + S+E+   W ++ + V  +++     +   N+   E S   +W+    + CKCP L++G  YLLL K    +   +  L+V+ ++  ++W DD + ++  F  +++ G+C
Sbjct:   37 CHDHTGRPVRCVPEFINAAFGKPVIASDTCGTN-RPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVS--TPSLSP-QNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRDP----DVSITKSNEQEAVCTA--SHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRA--TANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKS-CNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFK-----RGTENMQRGETS---LWISPQGVICKCPKLRVGRRYLLLGKNDSDH--ERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQC 604          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 291.967 bits (746), Expect = 7.062e-90
Identity = 184/591 (31.13%), Postives = 298/591 (50.42%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMI-------------SLLTDGSKKRNKSPYD-----HLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAP-ETKNNLMAT-----EERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C   +GR   C P+FIN A       + TCG     D+ C       G+   +C  CD R    S   SL+ D N  G+ T WVS   P  S   ++++T++L K +E+ Y+ + F  +LPDSM LYK    GKTW P+ ++SS C++ F         +     N+    C +    +     N    PF           NS ++++WV+ TDI +              L  D +   N++  +       S+ ++ +G R +C GHA + +  K G   CDC H TAG +C  C   H D+PW     +  + N C  C CN HA+ C+FD ++++ S  + G  CL+C H+T G +C+ C PG+ R+ + P+ H + C+ CGCHP GSL +S CN  +G C CK GV G  CNRC KGYQQ++S+ TPC    TK + + +     +++C  C     R+  +KFCK+   +++ + S+E+   W ++ + V  +++     +   N+   E S   +W+    + CKCP L++G  YLLL K    +   +  L+V+ ++  ++W DD + ++  F  +++ G+C
Sbjct:   37 CHDHTGRPVRCVPEFINAAFGKPVIASDTCGTN-RPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVS--TPSLSP-QNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRDP----DVSITKSNEQEAVCTA--SHIMGPGGNRVAFPFLENRPSAQNFENSPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRA--TANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSLGKS-CNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFK-----RGTENMQRGETS---LWISPQGVICKCPKLRVGRRYLLLGKNDSDH--ERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQC 604          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 176.792 bits (447), Expect = 4.321e-46
Identity = 129/439 (29.38%), Postives = 208/439 (47.38%), Query Frame = 2
Query:  134 CFSESGRA-KFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGI-HSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISL--LTDGSKKRNKSPYD----HLSISDITIGARSQCYGHAK-----SLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKG-YQQTKSSSTPCAPETKNNL 1402
            C+  + R  + C PDF+N A N   +VT+TCG K  T    ++ +T        C  CDDR    S     + D N+  +ET W S  + +      + N+T+ L K +++ Y+ ++F    P+S  +YK+      W PW ++S SC+ ++ +    P+       N+ +  C      +  IT     + F+ + GR S      S ++++WV+ + I ISL  +     +  K P      + +ISD  +G R +C GHA      S +      VC C H T G DC++CL  +ND+PW+     E   N C  C C+  +  C FD+++++ +   HG  C+ C  +T G HC  C   ++R           C  CGC+  GSL  + C+ + G CQCK GV G+ C++C  G Y  + +    C  ET  +L
Sbjct:   40 CYDRATRQPQRCVPDFVNAAFNLEVQVTNTCGTKRPTKFCVQSGHTGQ---RSVCETCDDRHEGFSHPAKYLTDFNVGNNETWWQSDTMQEGQQYPTTTNLTLVLGKSFDITYVRLKFISPRPESFTIYKKTHTDSEWEPWQFYSGSCRATYGLSDRAPI----LPGNEATAQCTKEFSDISPITGG--NIAFSTLEGRPSAHAFEESEVLQKWVTASAIRISLNRMNTFGDEVFKDPQVLRSYYYAISDFAVGGRCKCNGHASECVGSSSVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVE--ANECIACNCSQLSNRCYFDQQLFEETG--HGGHCIDCQGNTQGVHCEQCIANHWRRPG-----ENYCVACGCNEIGSLS-TQCD-NEGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKNCGCETSGSL 458          

HSP 2 Score: 52.373 bits (124), Expect = 1.129e-6
Identity = 41/135 (30.37%), Postives = 59/135 (43.70%), Query Frame = 2
Query:  932 CLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRC 1336
            C+  T G +C  C   +    W      EP GN C+ C C         ++      + + G     CL +  G  C+ C+ G+Y      I     CQ+C C P GS   + C+ + G CQCK GV G+ C+RC
Sbjct:  859 CIFNTHGFNCENCKPGY----WGDALI-EPKGN-CQSCGCFAAGTRRPNNDYTLLECNQQDGQ--CDCLPNVIGIQCDQCAHGFYN-----ITSGLGCQECNCDPLGSEGNT-CDVNTGQCQCKPGVTGQRCDRC 979          

HSP 3 Score: 49.2914 bits (116), Expect = 9.252e-6
Identity = 54/201 (26.87%), Postives = 77/201 (38.31%), Query Frame = 2
Query:  878 CYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTH------------------NDQP------WKIIFPSEPAGNICERC-------FCN----NHAEECKFDEKIYKNSSG---KHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGS-LPQS-----YCNPDNGICQCKIGVEGKLCNRCKKGY 1348
            C+ H+ S   ++G+ +C+  H TAG  C +C + +                  ND P        +I    P G    RC       F N        EC        NS G   K    C  C+ +T G +C +C PGY+ +    I     CQ CGC   G+  P +      CN  +G C C   V G  C++C  G+
Sbjct:  738 CHNHSNSCEAESGSCICE--HNTAGDTCERCARGYYGDALQGTEEDCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDAL--IEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGF 934          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: lam-3 (LAMinin related. See also lmb; Laminin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5ECE3])

HSP 1 Score: 147.517 bits (371), Expect = 1.809e-36
Identity = 122/439 (27.79%), Postives = 182/439 (41.46%), Query Frame = 2
Query:  140 SESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRN-----WYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHS----VQNITSNIKVLPFNPMTGRTSL---------LPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKK--NGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKN-------SSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDN--------GICQCKIGVEGKLCNRCKKGYQ 1351
            SES R  F  P+  N+A N+    T TCGQ  + +  C+         ++     +C  CD         I    D    G    W S  +        +NITI+L + Y+V YII++          + ++  +G+ + PW Y++    +  +     P       F K      + ++S    ++N   +  ++   P    TSL             RLI       D+MI      S  ++ +     SISDI+IG +  CYGHA+S       G   C+C H T G  C++C    N  PWK    S P  N+C++C C NHA  C +D+++ +N          + G RCL C H+T G +C  C  GYYR           C+ C C P GS+  +    D         G C CK G  G+ C RC  GY+
Sbjct:   42 SESERGLF--PNIFNLATNSLITATDTCGQY-TAEEYCKLVEHVLLRKTTNTQSPQCDICDANNVHKRHPIEYAID----GTRRWWQSPSLANGLRFEKVNITIDLRQEYQVAYIILKMGNSPRPGTWVLEKSLDGEYYEPWQYYAMQDAECMRQFGI-PATTGVPRFQKEDEVHCTSEYSKITPLENGEIHTSLVNGRPGAENTSLELQKFTRARFVRLRLISPRTLNADLMIINKKSDSLDKSVTMRYFYSISDISIGGQCICYGHAESCPSDPVTGQFKCECRHNTCGESCNRCCPLFNQLPWKPGTNSHP--NVCQQCQCFNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGSVSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGYR 470          

HSP 2 Score: 75.485 bits (184), Expect = 1.068e-13
Identity = 62/185 (33.51%), Postives = 77/185 (41.62%), Query Frame = 2
Query:  860 IGARSQCYGHAKSLIKKNGTTVC-DCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMAT 1411
            IG    C  H  S      T+VC DC H T G  C  CL      P  I    E   N C +C C     E  F +       G+ G  C  C    TG +C +C  GYY +   P +    C  C CHP GSL    CNP +G C+CK GV G+ C+ C++ +       T C       LM T
Sbjct: 1534 IGWSEPCSCHGHSQTCNPDTSVCTDCEHNTFGDFCEHCL------PGYIGDAREGGANACTKCAC--PLVENSFSDSCVAVDHGR-GYVCNSCKPGYTGQYCETCVAGYYGD---PQHIGGTCSPCDCHPDGSL-HGACNPLSGQCECKPGVTGRTCSMCQERHAFINRVCTSCDQGCYLPLMET 1705          

HSP 3 Score: 61.2326 bits (147), Expect = 2.728e-9
Identity = 40/125 (32.00%), Postives = 58/125 (46.40%), Query Frame = 2
Query: 1007 FPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSL-PQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC 1378
            F  +P    C  C CN +      D     N   + G +CL C+ HTTG  C SC   ++ N          C+ CGCH  G++ PQ  C+ +NG C+CK    G  C+RCK+ +   ++    C
Sbjct:  877 FFEDPLTGKCIECTCNGN-----IDPMGIGNCDSETG-KCLKCIGHTTGDSCESCKEHHWGNAQL-----HTCKPCGCHTQGAVNPQ--CSEENGECECKENYIGAQCDRCKENHGDVENGCPAC 988          

HSP 4 Score: 59.3066 bits (142), Expect = 1.047e-8
Identity = 46/162 (28.40%), Postives = 64/162 (39.51%), Query Frame = 2
Query:  914 GTTVCDCLHKTAGPDCSQCLKTH---NDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYC-------------NPDNGIC-QCKIGVEGKLCNRCKKGY 1348
            G  VC+C    AG  C  C+  +   N+Q +         G  CE+C C+ ++EEC                 CL+C H+TTG  C  C PG+  N +        C++C C      P   C             N DN +C  C +G EG  C  C  G+
Sbjct:  737 GVEVCECPENFAGNSCESCVPGYRRVNNQLY---------GGRCEKCDCHGNSEECD-----------PFTGECLNCRHNTTGSRCELCKPGHVGNPSRG-GELGACEQCECPSLDLNPNPECISTELAVLGSVASNEDNYVCINCPLGYEGNKCEYCSDGF 877          

HSP 5 Score: 56.9954 bits (136), Expect = 4.599e-8
Identity = 40/147 (27.21%), Postives = 55/147 (37.41%), Query Frame = 2
Query:  926 CDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRC------LHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGY 1348
            C+C     G  C +C + H D             N C  C CN+               +G  GS C       +C     G  C+ C P Y+            CQ C C+ YGS+    C+   G C+C+  VEG +C +C  GY
Sbjct:  960 CECKENYIGAQCDRCKENHGD-----------VENGCPACDCND---------------TGSIGSDCDQVSGQCNCKQGVFGKQCDQCRPSYFNFT------DAGCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGY 1074          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: lam-1 (LAMinin related. See also lmb [Source:UniProtKB/TrEMBL;Acc:V6CIX7])

HSP 1 Score: 129.798 bits (325), Expect = 9.038e-31
Identity = 106/386 (27.46%), Postives = 158/386 (40.93%), Query Frame = 2
Query:  290 KCLKCDDRIP--------ELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXP--LHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTS-LLPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNG----TTV----------CDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDN--------GICQCKIGVEGKLCNRCKKGY 1348
            KC  CD R           LS  I  V    +      W        +G  +++I+ +L   +   ++I+ F    P +M++ +    GKTW  + YF+  C  SF      P   H      ++ S    S    +     +  ++  NP     S LL  + L   +  +  +   LL    +   K  Y   +I +I +     CYGHA   I  +      TV          C+C+H T G +C +C   +ND PW+     E   N C +C CN HA  C FD  +Y++S    G  C  C+H+T G +C  C P +YR+    I+ P VC  C C   GS  +  C  +         G C CK  V+G  C+RCK GY
Sbjct:   77 KCFYCDSRTEWKPQREPYRLSHRIENVVTEVMDDKNRNWYQSE----NGAQNVSISFDLEAEFHFTHLIMTFKSFRPAAMIIERSADFGKTWQVYRYFAYDCDSSFPGIPEGPPKKHTDVICTSQYSDVAPSTGGEIVYKVISPHIVTENPYADEISTLLKITNLRFNFTKLHTLGDDLLDYRPEIDEKYYY---AIYEIVVRGSCSCYGHASRCIPIDPHVSPNTVMERADIVHGRCECMHNTEGLNCEKCKAFYNDLPWRPAIGDEK--NECRQCNCNRHALRCHFDRAVYESSGFVSGGVCDDCMHNTQGKNCEQCKPFFYRDPRRTIDDPHVCLPCECDKAGSQNKGICEGEEDAERGLVAGKCYCKTNVDGNRCDRCKNGY 453          

HSP 2 Score: 66.6254 bits (161), Expect = 4.761e-11
Identity = 46/168 (27.38%), Postives = 70/168 (41.67%), Query Frame = 2
Query:  863 GARSQCYGHAKSLIKKNGTT-----VCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGS-LPQSYCNPDNGICQCKIGVEGKLCNRCKKGY 1348
            G  +  Y HA +   +N        VC+C     G  C +C + H   P ++       G  CERC CN + +         + S       CL CLHHT G  C  C  GYY +        + CQ+C C+  G+   +  C+  +G C C   + G  C++C + +
Sbjct:  928 GGPTSGYQHADTCYLRNSGNNTQDIVCNCKSGYQGERCGECAQNHWGSPREV-------GGTCERCDCNGNID------MAMEGSCDAATGECLKCLHHTEGAQCEHCVDGYYGDAKL-----KTCQRCVCNELGTNSTKGACDRVSGQCPCHDNIIGMQCDQCAENH 1077          

HSP 3 Score: 50.447 bits (119), Expect = 4.617e-6
Identity = 42/158 (26.58%), Postives = 60/158 (37.97%), Query Frame = 2
Query:  926 CDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRC------LHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCA 1381
            C C     G  C QC + H +           +G  CE C C+++         +  N  G    +C        C     G  C+ C   Y+ +   P      C +C C+P GS     C+ +NG C+C+ G  G LCN C +GY        PC 
Sbjct: 1059 CPCHDNIIGMQCDQCAENHFNLA---------SGAGCEACGCDSNG--------VVLNHEGVPHLQCNIFDGQCQCKPGRGGRKCDQCEDLYWGDPTTPDG----CHRCECNPTGS-KSLQCHRNNGTCECQAGSGGALCNECARGYTGQWPYCNPCG 1194          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0073942)

HSP 1 Score: 227.639 bits (579), Expect = 9.528e-65
Identity = 189/709 (26.66%), Postives = 293/709 (41.33%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFA--GQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDI--------------MISLLTDGSKKRNKSPYD---------------------------HLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC--APETKNNLMATE-------------------------------------ERCGSCGKNRPRIRFRKFCKKH--IMIKI-------SIQSKEIHGEWTRFGVRVLKIWRIQQ-SLKSQV-NLYESEYSIYP-------------------------------------------------IW-VENADIRCKCPNLQLGHTYLLLTKIKLK--NYLN-QPELIVDRKSSALDWSDDWIRRLDMFKMR 1813
            C++++   + C PDF+N A +A    +STCG  G+        Y     +E  C  CD   P  S     + D N   + T W S   P      ++ +T++L K +E+ Y+I++       PDSMV+YK   +G +W P+ +FSS C++ F      P        N+    C      +      +  + F+ + GR S   L +S ++++WV+ TDI              ++SL   G+       Y                            H +ISD ++G R +C GHA K     +G   C+C H TAG DC +C   H D+PW      E   N C+ C CN HA +C+F+ +I++ S G  G  C +C H TTG +C+ C  G+YR+   P+ H +VC+ C CHP GS  +  CN  +G C CK GV G  CNRC +GYQQ++S   PC   P    N++ T+                                       CG C  +  R+   KFCK+   IM K+          S+E+        V   ++ ++Q  S +S +  +YE + + YP                                                  W +   D+ C+CP +++  +YL+L +       YL   P  IV      ++W +DW RR+  F+ R
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDAPVVASSTCGSSGA------QRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSE--PVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGR----PARQSTGRHNEHEARCSDVTRPL------VSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKE--ANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSGK-ICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVSREVQRRAMDPDVADYEMDQVQPGSARSPITGVYEFQAADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSGAGNVYGMPNTTLKRGPMTWIIPTKDLECRCPRIRVNRSYLILGRDSEAPPGYLGIGPHSIV------IEWKEDWYRRMKRFQRR 721          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0346088)

HSP 1 Score: 227.639 bits (579), Expect = 9.528e-65
Identity = 189/709 (26.66%), Postives = 293/709 (41.33%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFA--GQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDI--------------MISLLTDGSKKRNKSPYD---------------------------HLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC--APETKNNLMATE-------------------------------------ERCGSCGKNRPRIRFRKFCKKH--IMIKI-------SIQSKEIHGEWTRFGVRVLKIWRIQQ-SLKSQV-NLYESEYSIYP-------------------------------------------------IW-VENADIRCKCPNLQLGHTYLLLTKIKLK--NYLN-QPELIVDRKSSALDWSDDWIRRLDMFKMR 1813
            C++++   + C PDF+N A +A    +STCG  G+        Y     +E  C  CD   P  S     + D N   + T W S   P      ++ +T++L K +E+ Y+I++       PDSMV+YK   +G +W P+ +FSS C++ F      P        N+    C      +      +  + F+ + GR S   L +S ++++WV+ TDI              ++SL   G+       Y                            H +ISD ++G R +C GHA K     +G   C+C H TAG DC +C   H D+PW      E   N C+ C CN HA +C+F+ +I++ S G  G  C +C H TTG +C+ C  G+YR+   P+ H +VC+ C CHP GS  +  CN  +G C CK GV G  CNRC +GYQQ++S   PC   P    N++ T+                                       CG C  +  R+   KFCK+   IM K+          S+E+        V   ++ ++Q  S +S +  +YE + + YP                                                  W +   D+ C+CP +++  +YL+L +       YL   P  IV      ++W +DW RR+  F+ R
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDAPVVASSTCGSSGA------QRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSE--PVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGR----PARQSTGRHNEHEARCSDVTRPL------VSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKE--ANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSGK-ICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVSREVQRRAMDPDVADYEMDQVQPGSARSPITGVYEFQAADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSGAGNVYGMPNTTLKRGPMTWIIPTKDLECRCPRIRVNRSYLILGRDSEAPPGYLGIGPHSIV------IEWKEDWYRRMKRFQRR 721          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0308337)

HSP 1 Score: 215.698 bits (548), Expect = 8.626e-61
Identity = 148/475 (31.16%), Postives = 223/475 (46.95%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFA--GQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDI--------------MISLLTDGSKKRNKSPYD---------------------------HLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC--APETKNNLMATE 1414
            C++++   + C PDF+N A +A    +STCG  G+        Y     +E  C  CD   P  S     + D N   + T W S   P      ++ +T++L K +E+ Y+I++       PDSMV+YK   +G +W P+ +FSS C++ F      P        N+    C      +      +  + F+ + GR S   L +S ++++WV+ TDI              ++SL   G+       Y                            H +ISD ++G R +C GHA K     +G   C+C H TAG DC +C   H D+PW      E   N C+ C CN HA +C+F+ +I++ S G  G  C +C H TTG +C+ C  G+YR+   P+ H +VC+ C CHP GS  +  CN  +G C CK GV G  CNRC +GYQQ++S   PC   P    N++ T+
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDAPVVASSTCGSSGA------QRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRS--EPVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGR----PARQSTGRHNEHEARCSDVTRPL------VSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKE--ANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSGK-ICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQ 493          
BLAST of Netrin 1 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0345031)

HSP 1 Score: 172.555 bits (436), Expect = 1.515e-44
Identity = 135/426 (31.69%), Postives = 210/426 (49.30%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHS---INITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLL--PNSRLIKEWVSVTDIMISL-----LTD---GSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNG-----TTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYY-RNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQ 1354
            C+   GR + C P+FIN A     E T+TCG++ + +  C      +  N   C K +D  P      S + D +     T W S  +  F GI     +N+T++L K Y++ Y+ + F    P+S  +YKR      W+P+ ++S++C+ ++ +  S+ +   +   + +  + +S    +++       + F+ + GR S +    S  ++EWV+ TDI I+L       D   G  +  KS +   +ISDI +GAR +C GHA   +   G     T VC+C H T GPDC +CL  +ND  WK    +E   N C+ C CN  A++C FD  ++ N +G HG  CL C  +  GP+C  C   +Y R+  + +N       C C P GS     CN  +G CQCK GV G  C+RC   Y Q
Sbjct:   57 CYDPYGRPQKCLPEFINAAYQLQIESTNTCGEQ-NDNHFCIQTMNQNHKNCEFC-KYNDHNP------SFLTDLHDPQSPTWWQSETM--FEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRD-----GEIAFSTLEGRPSGINFERSGELQEWVTATDIRITLDRLNTFGDELFGDSQVLKSYF--YAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEV--NECKACNCNGLADKCFFDANLF-NRTG-HGGHCLDCRENRDGPNCERCKENFYMRDDGYCVN-------CACDPVGSRSLQ-CNS-HGKCQCKPGVTGDKCDRCDNNYYQ 452          

HSP 2 Score: 56.6102 bits (135), Expect = 7.981e-8
Identity = 44/157 (28.03%), Postives = 68/157 (43.31%), Query Frame = 2
Query:  917 TTVC-DCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQ-VCQKCGCHPYGSLPQ----SYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSS 1369
            T +C +C     G  C QC       P  ++   +     C+ C CN +      D     N +   G  CL C+H+T G HC+ C  G++ +   P+  P   C +C C+  G+       + C+   G CQCK  V G+ C  C+ GY   +S +
Sbjct:  808 TVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQ----TCKSCDCNGN-----VDPNAVGNCNRTTG-ECLKCIHNTAGEHCDQCLSGHFGD---PLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGN 951          

HSP 3 Score: 50.0618 bits (118), Expect = 8.356e-6
Identity = 50/183 (27.32%), Postives = 60/183 (32.79%), Query Frame = 2
Query:  932 CLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSL--------PQSYCNP--------------------------------------DNGICQCKIGVEGKLCNRCKK 1342
            C+H TAG  C QCL  H   P  +     P G  C+RC C     E   DE+         G     C  +  G  C  C PGY     F I     C+ C C P GS          Q +C P                                       NG C C   VEG+ C+RCK+
Sbjct:  871 CIHNTAGEHCDQCLSGHFGDPLAL-----PHGR-CDRCSCYEAGTE--QDEQSITRCDQVTGQ--CQCKPNVIGRDCGECQPGY-----FNIRSGNGCENCLCDPVGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKGFQCDQNGQCPCNDNVEGRRCDRCKE 1038          
BLAST of Netrin 1 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0076382)

HSP 1 Score: 172.555 bits (436), Expect = 1.515e-44
Identity = 135/426 (31.69%), Postives = 210/426 (49.30%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHS---INITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLL--PNSRLIKEWVSVTDIMISL-----LTD---GSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNG-----TTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYY-RNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQ 1354
            C+   GR + C P+FIN A     E T+TCG++ + +  C      +  N   C K +D  P      S + D +     T W S  +  F GI     +N+T++L K Y++ Y+ + F    P+S  +YKR      W+P+ ++S++C+ ++ +  S+ +   +   + +  + +S    +++       + F+ + GR S +    S  ++EWV+ TDI I+L       D   G  +  KS +   +ISDI +GAR +C GHA   +   G     T VC+C H T GPDC +CL  +ND  WK    +E   N C+ C CN  A++C FD  ++ N +G HG  CL C  +  GP+C  C   +Y R+  + +N       C C P GS     CN  +G CQCK GV G  C+RC   Y Q
Sbjct:   57 CYDPYGRPQKCLPEFINAAYQLQIESTNTCGEQ-NDNHFCIQTMNQNHKNCEFC-KYNDHNP------SFLTDLHDPQSPTWWQSETM--FEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCTSEYSDISPLRD-----GEIAFSTLEGRPSGINFERSGELQEWVTATDIRITLDRLNTFGDELFGDSQVLKSYF--YAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEV--NECKACNCNGLADKCFFDANLF-NRTG-HGGHCLDCRENRDGPNCERCKENFYMRDDGYCVN-------CACDPVGSRSLQ-CNS-HGKCQCKPGVTGDKCDRCDNNYYQ 452          

HSP 2 Score: 56.6102 bits (135), Expect = 7.981e-8
Identity = 44/157 (28.03%), Postives = 68/157 (43.31%), Query Frame = 2
Query:  917 TTVC-DCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQ-VCQKCGCHPYGSLPQ----SYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSS 1369
            T +C +C     G  C QC       P  ++   +     C+ C CN +      D     N +   G  CL C+H+T G HC+ C  G++ +   P+  P   C +C C+  G+       + C+   G CQCK  V G+ C  C+ GY   +S +
Sbjct:  808 TVICTECPKGYFGSRCEQCSDGFFGDPTGLLGEVQ----TCKSCDCNGN-----VDPNAVGNCNRTTG-ECLKCIHNTAGEHCDQCLSGHFGD---PLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGN 951          

HSP 3 Score: 50.0618 bits (118), Expect = 8.356e-6
Identity = 50/183 (27.32%), Postives = 60/183 (32.79%), Query Frame = 2
Query:  932 CLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSL--------PQSYCNP--------------------------------------DNGICQCKIGVEGKLCNRCKK 1342
            C+H TAG  C QCL  H   P  +     P G  C+RC C     E   DE+         G     C  +  G  C  C PGY     F I     C+ C C P GS          Q +C P                                       NG C C   VEG+ C+RCK+
Sbjct:  871 CIHNTAGEHCDQCLSGHFGDPLAL-----PHGR-CDRCSCYEAGTE--QDEQSITRCDQVTGQ--CQCKPNVIGRDCGECQPGY-----FNIRSGNGCENCLCDPVGSYNSTCDRYSGQCHCRPGVMGQRCDQCENYFYGFSSEGCKPCECDESGSKGFQCDQNGQCPCNDNVEGRRCDRCKE 1038          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 312.383 bits (799), Expect = 1.436e-97
Identity = 195/598 (32.61%), Postives = 310/598 (51.84%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIK---------VLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC-----APETKNNLMATEE--RCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C+ E+G  + C PDF+N A       +STCG+  S  R C    T  G    + C  CD   P+ +   + + D N   + T W S    ++    ++ +T++L K +EV Y+ ++F    P+SM ++K    GK+W+P+ Y+S+ C               ++ +NK S A  + ++  + I ++           ++ F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S     S    +SD+ +G R +C GHA   +K ++G  VC+C H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GYYR+ + PI+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC  GYQQ++S   PC     AP T     +TEE   C S     K + +I  +K+CKK   +++ I   +  GEW +F V ++ +++  +S   + + +        +WV   D+ CKCP ++ G  YLLL     ++   Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   40 CYDENGHPRRCIPDFVNAAFGKEVRASSTCGKTPS--RYC--VVTEKGDERHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQYP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKSWVPFQYYSTQC---------------RKMYNKPSKATITKQNEQEAICTDSHTDMHPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVKDRDGNLVCECKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCIKIPIAPPT-TTASSTEEPSDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYKQGESRIRRGDQF--------LWVRAKDVACKCPKIKSGKKYLLLGND--EDSPGQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 312.383 bits (799), Expect = 1.436e-97
Identity = 195/598 (32.61%), Postives = 310/598 (51.84%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIK---------VLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC-----APETKNNLMATEE--RCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C+ E+G  + C PDF+N A       +STCG+  S  R C    T  G    + C  CD   P+ +   + + D N   + T W S    ++    ++ +T++L K +EV Y+ ++F    P+SM ++K    GK+W+P+ Y+S+ C               ++ +NK S A  + ++  + I ++           ++ F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S     S    +SD+ +G R +C GHA   +K ++G  VC+C H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GYYR+ + PI+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC  GYQQ++S   PC     AP T     +TEE   C S     K + +I  +K+CKK   +++ I   +  GEW +F V ++ +++  +S   + + +        +WV   D+ CKCP ++ G  YLLL     ++   Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   40 CYDENGHPRRCIPDFVNAAFGKEVRASSTCGKTPS--RYC--VVTEKGDERHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQYP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKSWVPFQYYSTQC---------------RKMYNKPSKATITKQNEQEAICTDSHTDMHPLSGGLIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVKDRDGNLVCECKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCIKIPIAPPT-TTASSTEEPSDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYKQGESRIRRGDQF--------LWVRAKDVACKCPKIKSGKKYLLLGND--EDSPGQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1b (netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168])

HSP 1 Score: 307.76 bits (787), Expect = 8.683e-96
Identity = 189/587 (32.20%), Postives = 302/587 (51.45%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRI-QQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+ E+G  + C PDF+N A      V+STCG   S  R C    T  G    + C  CD   P+ +   + + D N   + T W S    ++    ++ +T++L K +EV Y+ ++F    P+SM ++K    GKTW+P+ ++S+ CKK +       +  Q    N+    C      +Q +T  +  + F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S     S    +SD+ +G R +C GHA   +K + G  VC+C H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  + G  CL+C H+T G HC+ C  GYYR+ +  I+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC      AP +  +       C S     K + ++  +K+CKK   +++ +   +  GEW +F + ++ +++     ++    L         +WV   D+ CKCP ++ G  YLL+   + ++   Q  ++ DR S  + W D W RRL  F+ R+++GKC
Sbjct:   40 CYDENGNPRRCIPDFVNSAFGKDVRVSSTCGSPPS--RYC--VVTEKGEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQSENYVQYP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKTWVPFQFYSTQCKKMYNKPSKAAITKQ----NEQEAICTDSHTDMQPLTGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFNRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAAPTSSYSSPDGPTDCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGGHRIRRGDQL---------LWVRAKDVACKCPKIKPGRKYLLMGSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGKC 602          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1b (netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168])

HSP 1 Score: 307.76 bits (787), Expect = 8.683e-96
Identity = 189/587 (32.20%), Postives = 302/587 (51.45%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRI-QQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+ E+G  + C PDF+N A      V+STCG   S  R C    T  G    + C  CD   P+ +   + + D N   + T W S    ++    ++ +T++L K +EV Y+ ++F    P+SM ++K    GKTW+P+ ++S+ CKK +       +  Q    N+    C      +Q +T  +  + F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S     S    +SD+ +G R +C GHA   +K + G  VC+C H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  + G  CL+C H+T G HC+ C  GYYR+ +  I+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC      AP +  +       C S     K + ++  +K+CKK   +++ +   +  GEW +F + ++ +++     ++    L         +WV   D+ CKCP ++ G  YLL+   + ++   Q  ++ DR S  + W D W RRL  F+ R+++GKC
Sbjct:   40 CYDENGNPRRCIPDFVNSAFGKDVRVSSTCGSPPS--RYC--VVTEKGEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQSENYVQYP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKTWVPFQFYSTQCKKMYNKPSKAAITKQ----NEQEAICTDSHTDMQPLTGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFNRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAAPTSSYSSPDGPTDCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGGHRIRRGDQL---------LWVRAKDVACKCPKIKPGRKYLLMGSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGKC 602          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 294.664 bits (753), Expect = 7.180e-91
Identity = 182/596 (30.54%), Postives = 297/596 (49.83%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMI---------SLLTDGSKKRNKS------PYDHLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC--APETK-NNLMATEERCGSCG------KNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQ-QSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C+ E+G A+ C P+FIN A      V+S CG+  S  R C             C  CD   P  +   S + D N   + T W S  +   S   ++ +T++L K +E+ Y+ ++F    P+S+ +YK    G+TW P+ ++SS C++ +       +  Q    N+    C      +  ++  +  + F+ + GR S     +S ++++WV+VTDI +         +L   G +  +        P  + ++ D  +G R +C GHA   ++ K+G  +C+C H T GP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  C++C H+T G HC+ C  G+YR+    I H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC   P  K   +++T E    C       K   +I  +K+CKK   +++S+   E  G+W +F V ++ +++ +   LK   ++         +WV   D+ CKCP + +G  +L+L   +      +P L  D+ S  + W D W RRL  F+ +E++GKC +
Sbjct:   26 CYEETGAARRCIPEFINAAFGQEVSVSSVCGRPVS--RSCSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENLQ--SSPLNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGRTWTPYQFYSSQCRRMYNRPNKAAITKQ----NEQEALCTDGHTDLYPLSGGL--IAFSTLDGRPSGKDFDSSPVLQDWVTVTDIRVVFSRPQHTRALPMSGRESEDALGAPGSLPTYYYAVGDFQVGGRCKCNGHASRCVREKDGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKE--ANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVIKPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETVGDWAKFSVSLMSVYKSRGDPLKRGDHM---------LWVHMKDLACKCPRIHMGKRFLILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 599          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 299.671 bits (766), Expect = 1.227e-92
Identity = 181/584 (30.99%), Postives = 293/584 (50.17%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS------LLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC----APETKNNLMATEERCGSCGKNRP-----RIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+ E G  + C P+F+N A N   + +STCG+  +                     CD   P  S   S + D N  G+ T W S   P+ S   ++++T++L K +EV Y+ ++F    P+S+ ++K    GK+W+P+ Y+SS C+K +       +  Q    N+    C   +  +  +T  +  + F+ + GR S   L NS ++++W++ TDI +       L    S+  ++ P  + S+ +  +G R +C GHA    K K    +CDC H T GP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  G+YR+ +  I   + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC    A      L +TEE        +P     +I  +K+CKK  ++++++   E+ G W +F V +L +++ +     + + +        +W+   D+ CKCP + L   YL++   +  +   +P L  D+ S  + W D W RRL   + RE++GKC
Sbjct:   41 CYDEHGLPRRCVPEFVNAAFNKEVQASSTCGRLATR-------------------HCDTTDPRKSYPASYLTDLNTAGNMTCWRSETFPRHSS-QNVSLTLSLGKKFEVTYVSLQFCSPRPESVAIFKSMDYGKSWVPYQYYSSQCRKVYGKPSRASVTKQ----NEQEALCTDGQTELYPLTGGL--IAFSTLDGRPSAQDLDNSPVLQDWLTATDIRVFFSRPHLLGNKESEASDEGPGFYYSVGEFQVGGRCKCNGHASRCGKDKEARLICDCKHNTEGPECDRCKPFHYDRPWQRATARE--ANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTSTEEPADCEQYCKPPKGNYKINLKKYCKKDFVVQVNVLEMEMVGSWAKFTVNILSVYKCRDDRIKRGDNF--------LWIHIKDLSCKCPKILLSRRYLVMGSSEGPS--ERPGLTADKNSMVIQWRDAWTRRLRKLQRREKKGKC 585          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: ntn1 (netrin 1 [Source:NCBI gene;Acc:779839])

HSP 1 Score: 296.59 bits (758), Expect = 2.158e-91
Identity = 184/584 (31.51%), Postives = 293/584 (50.17%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISL--LTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCA----PETKNNLMATEERCGSCGK----------NRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+    R K+C PDFINVA       ++TCG+  +  ++C  +  S+ +   +C  CD + PE S   S + D + Q   T W S     F    ++ +T+ L + +E+ Y  + F    PDSM +YK    GKTW+P+ ++S+ C++ +    +  +    +        C  F+  V+ +T  +  + F P+ GR S      S ++++WV+ TDI +    L  G K   +       +S+I +G R +C GHA          +C+C H T GP+C  C   + D+PW+   PS    + C  C CN H+  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GY R+ + PI   + C+ C CHP G++  + CN   G CQCK GV G  CNRC  GYQQ++S+  PC       T       E + G+ G           +R  +  RK+CKK  +++  + S E  GEW +F   VL ++R     + +V +   +    P+WV + D+ C C  +Q+G +YL++     +   +   LI+D+ S AL W D W  +L  F+ +E +GKC
Sbjct:   42 CYDAKQRPKYCIPDFINVALGQEVITSNTCGR--TPQKLC-YFLDSTNVTSRRCQLCDQKRPENSYPPSYMTDTDAQ---TCWKSESGITFP--QNVTLTLPLGRRFELVYASLRFCSPRPDSMAIYKSMDYGKTWIPFQFYSTHCRRVYDQATTSAISKPMQH----EATCTDFQTGVKPLTKGL--VAFMPLAGRPSARRFEYSPVLQDWVTATDIRVVFNRLHHGKKMGIRRKTAFYGVSEIQVGGRCKCNGHASRCTAGKEGLMCECQHNTIGPECDACKPFYYDRPWQRATPSN--AHECVACECNLHSHRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKQGYKRDLSKPITSRKACKPCQCHPIGAV-NAMCNQTTGQCQCKTGVTGPTCNRCAPGYQQSRSAHMPCVRIQEEMTTTASYPQEWKAGTNGTECQSYCKPSHSRVHMNLRKYCKKDYVLRAQLLSMEKSGEWWQFTATVLTVYR-----QRRVPIRRGD---QPLWVPDHDLACDCLRVQVGKSYLIIGND--EESPDPARLILDKNSLALPWRDVWGHKLRRFQQQERRGKC 598          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 284.648 bits (727), Expect = 3.061e-87
Identity = 175/579 (30.22%), Postives = 283/579 (48.88%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS------LLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC----APETKNNLMATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+ E G  + C P+F+N A N   + +STCG+  +                     CD   P  S   S + D N  G+ T W S   P+ S   ++++T++L K +EV Y+ ++F    P+S+ ++K    GK+W+P+ Y+SS C+K +       +  Q    N+    C   +  +  +T  +  + F+ + GR S   L NS ++++W++ TDI +       L    S+  ++ P  + S+ +  +G R +C GHA    K K    +CDC H T GP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  G+YR+ +  I   + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC    A      L +TEE                      ++++++   E+ G W +F V +L +++ +     + + +        +W+   D+ CKCP + L   YL++   +  +   +P L  D+ S  + W D W RRL   + RE++GKC
Sbjct:   41 CYDEHGLPRRCVPEFVNAAFNKEVQASSTCGRLATR-------------------HCDTTDPRKSYPASYLTDLNTAGNMTCWRSETFPRHSS-QNVSLTLSLGKKFEVTYVSLQFCSPRPESVAIFKSMDYGKSWVPYQYYSSQCRKVYGKPSRASVTKQ----NEQEALCTDGQTELYPLTGGL--IAFSTLDGRPSAQDLDNSPVLQDWLTATDIRVFFSRPHLLGNKESEASDEGPGFYYSVGEFQVGGRCKCNGHASRCGKDKEARLICDCKHNTEGPECDRCKPFHYDRPWQRATARE--ANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTSTEE--------------------PAVVQVNVLEMEMVGSWAKFTVNILSVYKCRDDRIKRGDNF--------LWIHIKDLSCKCPKILLSRRYLVMGSSEGPS--ERPGLTADKNSMVIQWRDAWTRRLRKLQRREKKGKC 560          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 188.734 bits (478), Expect = 1.144e-49
Identity = 138/430 (32.09%), Postives = 213/430 (49.53%), Query Frame = 2
Query:  143 ESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLN--EGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIH---SINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSK-----KRNKSPYDHLSISDITIGARSQCYGHAKSLIKKN-GTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQ-TKSSSTPCA 1381
            E G  + C P+F+N A NAT   T+TCG           +   +G+      C  CD     L      + D N Q   T W S  +   +GI    +IN+T++L K +++ Y+ ++F    P+S  LYKR      W+P+ Y+S SC+K+++      +   +     +    FS    +  +T     + F+ + GR S     NS +++EWV+ TDI ++   L T G +     K  KS Y   +ISD  +G R +C GHA   ++      VC+C H T G DC +CL  +ND+PW+      P  N C  C CN  ++EC FD ++Y+++   HG  C  C  +T GP+C  C   YYR      ++ + C  C C+P GSL  + C+ + G C CK GV G+ C+RC+ G+   T++   PCA
Sbjct:   30 EEGSPQRCMPEFVNAAFNATVVATNTCGTPP------EEYCVQTGVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTM--LAGIQYPSTINLTLHLGKAFDITYVRLKFHTSRPESFALYKRTHEDGPWIPYQYYSGSCEKTYQKFNRGFIRTGEDEQQALCTDEFS---DISPLTGG--NVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFSDPKVLKSYY--YAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSP--NECLPCNCNGRSQECYFDPELYRSTG--HGGHCTGCADNTDGPNCERCRENYYRQ-----DNNEPCHACQCNPVGSL-STQCD-NYGRCSCKPGVMGEKCDRCQPGFHSLTEAGCRPCA 433          

HSP 2 Score: 51.9878 bits (123), Expect = 3.282e-6
Identity = 41/143 (28.67%), Postives = 55/143 (38.46%), Query Frame = 2
Query:  923 VCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGIC-QCKIGVEGKLCNRCKKGY 1348
            +C C     G  C +C   +  +      PS+   + C  C CN H++ C  +  +              C H+T GPHC  CS GYY +          CQ C C P GS           +C  C +G  GK C  C  GY
Sbjct:  676 ICSCPTGYIGQFCERCAPGYRREN-----PSQGPYSPCVLCTCNGHSDTCDPESGV------------CDCQHNTAGPHCERCSEGYYGDST--TGSASDCQPCPC-PGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGY 798          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 188.734 bits (478), Expect = 1.153e-49
Identity = 138/430 (32.09%), Postives = 213/430 (49.53%), Query Frame = 2
Query:  143 ESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLN--EGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIH---SINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSK-----KRNKSPYDHLSISDITIGARSQCYGHAKSLIKKN-GTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQ-TKSSSTPCA 1381
            E G  + C P+F+N A NAT   T+TCG           +   +G+      C  CD     L      + D N Q   T W S  +   +GI    +IN+T++L K +++ Y+ ++F    P+S  LYKR      W+P+ Y+S SC+K+++      +   +     +    FS    +  +T     + F+ + GR S     NS +++EWV+ TDI ++   L T G +     K  KS Y   +ISD  +G R +C GHA   ++      VC+C H T G DC +CL  +ND+PW+      P  N C  C CN  ++EC FD ++Y+++   HG  C  C  +T GP+C  C   YYR      ++ + C  C C+P GSL  + C+ + G C CK GV G+ C+RC+ G+   T++   PCA
Sbjct:   39 EEGSPQRCMPEFVNAAFNATVVATNTCGTPP------EEYCVQTGVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTM--LAGIQYPSTINLTLHLGKAFDITYVRLKFHTSRPESFALYKRTHEDGPWIPYQYYSGSCEKTYQKFNRGFIRTGEDEQQALCTDEFS---DISPLTGG--NVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFSDPKVLKSYY--YAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSP--NECLPCNCNGRSQECYFDPELYRSTG--HGGHCTGCADNTDGPNCERCRENYYRQ-----DNNEPCHACQCNPVGSL-STQCD-NYGRCSCKPGVMGEKCDRCQPGFHSLTEAGCRPCA 442          

HSP 2 Score: 63.5438 bits (153), Expect = 1.092e-9
Identity = 52/201 (25.87%), Postives = 85/201 (42.29%), Query Frame = 2
Query:  878 CYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTH-NDQPWKIIFPSEP----AGN-----------ICERCFCNNHAEECKF-DEKIYKNSSGKHGS--------------------------RCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLP-QSYCNPDNGICQCKIGVEGKLCNRCKKGY 1348
            C GH+ +   ++G  VCDC H TAGP C +C + +  D         +P     G+           +C  C      + C+  D+  + +  G++G+                           CL C+++T G +C+ C  G+Y N     N    C+ C C+PYG++  QS CN   G C+C   V  + C+ C+ G+
Sbjct:  691 CNGHSDTCDPESG--VCDCQHNTAGPHCERCSEGYYGDSTTGSASDCQPCPCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGFYGN-PLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCSACEPGF 888          

HSP 3 Score: 51.9878 bits (123), Expect = 3.573e-6
Identity = 41/143 (28.67%), Postives = 55/143 (38.46%), Query Frame = 2
Query:  923 VCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGIC-QCKIGVEGKLCNRCKKGY 1348
            +C C     G  C +C        ++   PS+   + C  C CN H++ C  +  +              C H+T GPHC  CS GYY +          CQ C C P GS           +C  C +G  GK C  C  GY
Sbjct:  654 ICSCPTGYIGQFCERCAPG-----YRRENPSQGPYSPCVLCTCNGHSDTCDPESGV------------CDCQHNTAGPHCERCSEGYYGDST--TGSASDCQPCPC-PGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGY 776          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 311.227 bits (796), Expect = 5.265e-97
Identity = 189/590 (32.03%), Postives = 308/590 (52.20%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK---CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYD----HLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C  E+G  + C PDF+N A      V+STCG+  +  R C      S   E +   C  C+   P+ +   + + D N   + T W S    +F   H++ +T++L K +EV Y+ ++F    P+SM +YK    G+TW+P+ ++S+ C+K +      P+  Q    N+    C      ++ ++  +  + F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S       + ++SD+ +G R +C GHA   ++ ++ + VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  G+YR+   PI H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  + +   E C S     K + ++  +K+C+K   ++I I   +  G+W +F V ++ +++   S      +   + S   +W+ + DI CKCP ++    YLLL     ++  +Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   41 CSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPA--RYC----VVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFP--HNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ----NEQEAVCTDSHTDMRPLSGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTS-----RIRRGDQS---LWIRSRDIACKCPKIKPLKKYLLLGNA--EDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 311.227 bits (796), Expect = 5.265e-97
Identity = 189/590 (32.03%), Postives = 308/590 (52.20%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK---CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYD----HLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C  E+G  + C PDF+N A      V+STCG+  +  R C      S   E +   C  C+   P+ +   + + D N   + T W S    +F   H++ +T++L K +EV Y+ ++F    P+SM +YK    G+TW+P+ ++S+ C+K +      P+  Q    N+    C      ++ ++  +  + F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S       + ++SD+ +G R +C GHA   ++ ++ + VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  G+YR+   PI H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  + +   E C S     K + ++  +K+C+K   ++I I   +  G+W +F V ++ +++   S      +   + S   +W+ + DI CKCP ++    YLLL     ++  +Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   41 CSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPA--RYC----VVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFP--HNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ----NEQEAVCTDSHTDMRPLSGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTS-----RIRRGDQS---LWIRSRDIACKCPKIKPLKKYLLLGNA--EDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn3 (netrin 3 [Source:MGI Symbol;Acc:MGI:1341188])

HSP 1 Score: 246.899 bits (629), Expect = 5.243e-73
Identity = 166/572 (29.02%), Postives = 262/572 (45.80%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLP--NSRLIKEWVSVTDIMISLLTDGSKKRNKS-----PYDHLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGSCGKNRP--RIRFRKFCKKHIMIKISIQSK-EIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPE----LIVDRKSSALDWSDDWI 1786
            C+ E+   + C P  +N A       +STCG+  S +R+C                 D   P+ + +  L+           W S  + +     ++ +T+ L K +E+ ++ + F    P S+ L K   +G++W+P  +FSSSC   +      P      S       CF    + Q       +L F+   G    L   NS ++++WV+ TDI I L     +   +      PY + S +++ +G R +C GHA + L+  +G  VCDC H T GPDCS+C   + D+PW+     E   + C  C CN HA  C+F+ ++Y+ S  + G  CL+C H+T G HC+ C  G+YR+    ++  + C+ C CHP G+  ++ CN   G C CK GV G  CNRC  G+QQ++S   PC       P  +++ +  ++    C   R   RI  +KFC+K   +++++ ++ E  G WTRF V VL ++R  +          +      +WV   D  C CP L  G  YLLL         +       L   R S  L W D W 
Sbjct:   30 CYDEAREPRSCIPGLVNAALGREVLASSTCGR--SANRVC-----------------DSSDPQRAHSADLLTSAPGTASPLCWRSDLLQQ--APFNVTLTVPLGKAFELVFVSLRFCSAPPTSVALLKSQDHGRSWVPLGFFSSSCTLDYGRL---PAPADGPSGPGPEALCFP---APQAQPDGGGLLAFSVQDGSPQGLDLDNSPVLQDWVTATDIRIVLTRPAIQGDTRDGGVTVPYSY-SATELQVGGRCKCNGHASRCLLDTHGHLVCDCQHGTEGPDCSRCKPFYCDRPWQRATGQE--AHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRVLSDRRACRACDCHPVGAAGKT-CNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTPVPGPTEESSPVEPQDCESHCRPARGSYRISLKKFCRKDYAVQVAVGARGEARGSWTRFPVAVLAVFRSGEE--------RARRGSSALWVPTLDAACGCPRLLPGRRYLLLGGGPGAAAGSTAGRGQGLSAARGSLVLPWRDAWT 562          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn5 (netrin 5 [Source:MGI Symbol;Acc:MGI:2685330])

HSP 1 Score: 191.43 bits (485), Expect = 2.636e-54
Identity = 120/381 (31.50%), Postives = 179/381 (46.98%), Query Frame = 2
Query:  770 VTDIMISLLTDGSKKRNKSPYDHLSISD----ITIGARS--QCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCA--PETKNNLMA------TEERC-GSCGKNRPRIR--FRKFCKKHIMIKISIQ------SKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKL----KNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            +TD      + G K R  + Y  +        +T G R   QC+GHA     +     C C H T GP C  C  +H D PW+   P  P  + C  C CN HA  C+F+ ++++ S G+ G  C  C HHT G HC+ C PG++R+ + PI   + C+ C CHP G+     CN  +G C CK+GV G  CNRC  GYQQ++S   PC   PE             ++ +C G C  +   +    +++C++  ++   +       S+ +  EW R  V VL +++ Q++   +    E+       WV  AD+ C C  L+ G  YLLL +        NY +   LI++R   AL W   W R L   + +E  G C
Sbjct:    1 MTDYRTLFSSPGPKTRIVASYLRVEFGGKAGLVTTGVRGRCQCHGHAARCATRAQPPRCRCRHHTTGPGCESCRPSHRDWPWRPATPQHP--HPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPITSHKACRACQCHPIGAT-GGMCNQTSGQCSCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTPATTPVASRSDPQCQGYCNVSVSSVHMSLQRYCQQDYVLHAQVSASSSQPSEAVGPEWWRLAVHVLAVFK-QRAWPVRRGGQEA-------WVPRADLICGCLRLRPGADYLLLGRAAQTHDDDNY-DPARLILNRHGLALPWRPRWARPLRRLQQKERGGAC 369          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Lamc3 (laminin gamma 3 [Source:MGI Symbol;Acc:MGI:1344394])

HSP 1 Score: 194.512 bits (493), Expect = 9.303e-52
Identity = 146/450 (32.44%), Postives = 215/450 (47.78%), Query Frame = 2
Query:  125 FSSCFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFS-GIH---SINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISL--LTDGSKKRNKSPYD----HLSISDITIGARSQCYGHAKSL-IKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQ-TKSSSTPCAPETKNNLMATEERCGSC 1432
              SC+   GRA+ C P+F N A     E + TCG+    D         +GL   +C +CDD  P    + S + D +     T W S   P  + G+    S+N+T++L K YE+ Y+ ++F    P+S  +YKR      W P+ Y+S+SC+K++        H  +   ++    C S    +  +  N   + F+ + GR S      S +++EWV+ TDI+ISL  L        K P      + ++SD ++G R +C GHA        G   C C H T G DC +CL    D+PW      +   N C  C C+ H+EEC FD ++Y+++   HG  C  C  HTTGPHC  C   YYR   +    P  CQ C CHP GSL  S    ++G+C CK  V G  C+RC  G+   ++    PCA     +L   + R G+C
Sbjct:   31 MGSCYDGVGRAQRCLPEFENAAFGRRAEASHTCGRP-PEDFCPHVGAPGAGL---QCQRCDDADPGRRHDASYLTDFHSPDDSTWWQS---PSMAFGVQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTYGRPEG---HYLRPGEDERVAFCTSEFSDISPL--NGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTDILISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACRCQHNTTGVDCERCLPFFQDRPWARGTAED--ANECLPCNCSGHSEECTFDRELYRSTG--HGGHCQRCRDHTTGPHCERCEKNYYR---WSPKTP--CQPCDCHPAGSL--SLQCDNSGVCPCKPTVTGWKCDRCLPGFHSLSEGGCRPCACNVAGSLGTCDPRSGNC 457          

HSP 2 Score: 65.855 bits (159), Expect = 1.620e-10
Identity = 49/159 (30.82%), Postives = 65/159 (40.88%), Query Frame = 2
Query:  890 AKSLIKKNGTTVCD-CLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKS 1363
            A + I ++G  VC  C     G  C  C       P  +    +P    C RC C+ +      D     N    H   CL CL++TTG HC  C  G+Y   A        C  C C   GS+ +  CNP  G C C   V G+ C+RC  G+   +S
Sbjct:  774 ACATIPESGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQP----CRRCQCSGN-----VDLNAVGNCD-PHSGHCLRCLYNTTGAHCEHCREGFY-GSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVCLPYVSGRDCSRCSPGFYDLQS 921          

HSP 3 Score: 65.4698 bits (158), Expect = 1.988e-10
Identity = 51/168 (30.36%), Postives = 76/168 (45.24%), Query Frame = 2
Query:  869 RSQCYGHAKSLIKKNGTTVCD--------CLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGY 1348
            R QC G+    +  N    CD        CL+ T G  C  C +      +     + P  + C  C C+         EK     +G+    C+ CL + +G  C+ CSPG+Y      +   + CQ C CHP GSL ++ C+P  G C C+ GV G+ C+RC+ G+
Sbjct:  821 RCQCSGN----VDLNAVGNCDPHSGHCLRCLYNTTGAHCEHCREGF----YGSAVATRPV-DKCAPCSCDLRG---SVSEKTCNPVTGQ----CV-CLPYVSGRDCSRCSPGFYD-----LQSGRGCQSCKCHPLGSL-ENKCHPKTGQCPCRPGVTGQACDRCQLGF 965          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|O95631|NET1_HUMAN (Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 8.364e-97
Identity = 193/590 (32.71%), Postives = 307/590 (52.03%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK---CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C  E+G  + C PDF+N A      V+STCG+  +  R C      S   E +   C  C+   P+ +   + + D N   + T W S    +F   H++ +T++L K +EV Y+ ++F    P+SM +YK    G+TW+P+ ++S+ C+K +      P+  Q    N+    C      ++ ++  +  + F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S     S    +SD+ +G R +C GHA   ++ ++ + VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GYYR+   PI H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  + +   E C S     K + +I  +K+CKK   ++I I   +  G+W +F V ++ +++   S      +   + S   +W+ + DI CKCP ++    YLLL     ++  +Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   41 CSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPA--RYC----VVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFP--HNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ----NEQEAVCTDSHTDMRPLSGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTS-----RIRRGDQS---LWIRSRDIACKCPKIKPLKKYLLLGNA--EDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|O09118|NET1_MOUSE (Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=3)

HSP 1 Score: 311.227 bits (796), Expect = 3.683e-96
Identity = 189/590 (32.03%), Postives = 308/590 (52.20%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK---CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYD----HLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C  E+G  + C PDF+N A      V+STCG+  +  R C      S   E +   C  C+   P+ +   + + D N   + T W S    +F   H++ +T++L K +EV Y+ ++F    P+SM +YK    G+TW+P+ ++S+ C+K +      P+  Q    N+    C      ++ ++  +  + F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S       + ++SD+ +G R +C GHA   ++ ++ + VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  G+YR+   PI H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  + +   E C S     K + ++  +K+C+K   ++I I   +  G+W +F V ++ +++   S      +   + S   +W+ + DI CKCP ++    YLLL     ++  +Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   41 CSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPA--RYC----VVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFP--HNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ----NEQEAVCTDSHTDMRPLSGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTS-----RIRRGDQS---LWIRSRDIACKCPKIKPLKKYLLLGNA--EDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|Q90922|NET1_CHICK (Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 1.183e-94
Identity = 192/586 (32.76%), Postives = 305/586 (52.05%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC---APETKNNLMATEERCGSC------GKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+ E G  + C PDF+N A     +V+STCG+  S  R C    T  G  + + C  C+   P+ +   S + D N   + T W S    ++   H++ +T++L K +EV Y+ ++F    P+SM +YK    GKTW+P+ ++S+ C+K +       +  Q    N+    C      V+ ++  +  + F+ + GR +     NS ++++WV+ TDI ++   L T G +  + S     S    +SD+ +G R +C GHA   ++ ++   VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  G+YR+ + PI+H + C++C CHP G+  Q+ CN   G C CK GV G  CNRC KGYQQ++S   PC            ++ E    C       K + +I  +K+CKK   ++I I   E + +W +F V ++ +++     +    L   + +   +WV   DI CKCP ++    YLLL     ++  +Q  +I D+ S  + W D W RRL  F+ RE++GKC
Sbjct:   43 CYDEHGLPRRCIPDFVNSAFGKEVKVSSTCGKPPS--RYC--VVTEKGEEQVRSCHLCNASDPKRAHPPSFLTDLNNPHNLTCWQSDSYVQYP--HNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCRKMYNKPSRAAITKQ----NEQEAICTDSHTDVRPLSGGL--IAFSTLDGRPTAHDFDNSPVLQDWVTATDIKVTFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVRDRDDNLVCDCKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKECDCHPVGAAGQT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPAAPPPTAASSTEEPADCDSYCKASKGKLKINMKKYCKKDYAVQIHILKAEKNADWWKFTVNIISVYK-----QGSNRLRRGDQT---LWVHAKDIACKCPKVKPMKKYLLLGST--EDSPDQSGIIADKSSLVIQWRDTWARRLRKFQQREKKGKC 603          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|Q924Z9|NET1_RAT (Netrin-1 OS=Rattus norvegicus OX=10116 GN=Ntn1 PE=1 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 5.722e-94
Identity = 187/590 (31.69%), Postives = 305/590 (51.69%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK---CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYD----HLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C  E+G  + C PDF+N A      V+STCG+  +  R C      S   E +   C  C+   P+ +   + + D N   + T W S    +F   H++ +T++L K +EV Y+ ++F    P+SM +YK    G+TW+P+ ++S+ C+K +      P+  Q    N+    C      ++ ++  +  + F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S       + ++SD+ +G R +C GHA   ++ ++ + VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  G+YR+   PI H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  + M   E C S     K + ++  +K+C+K   ++I I   +  G+W +F V ++ +++   S      +   + S   +W+ + DI  KCP ++    YLLL     ++  +Q  ++ D+    + W D W RR   F+ RE++GKC +
Sbjct:   41 CSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPA--RYC----VVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFP--HNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ----NEQEAVCTDSHTDMRPLSGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSMEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTS-----RIRRGDQS---LWIRSRDIAXKCPKIKPLKKYLLLGNA--EDSPDQSGIVADKSXLVIQWRDTWARRXRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|Q2HXW4|NET1_PIG (Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 1.336e-93
Identity = 188/585 (32.14%), Postives = 302/585 (51.62%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK---CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQ 1822
            C  E+G  + C PDF+N A      V+STCG+  +  R C      S   E +   C  C+   P+ +   + + D N   + T W S    +F   H++ +T++L K +EV Y+ ++F    P+SM +YK    G+TW+P+ ++S+ C+K +      P+  Q    N+    C      ++ ++  +  + F+ + GR S     NS ++++WV+ TDI ++   L T G +  + S     S    +SD+ +G R +C GHA   ++ ++ + VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GY+R+   PI H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  + +   E C S     K + +I  +K+CKK   ++I I   +  G+W +F V ++ +++   S   + +          +W+ + DI CKCP ++    YLLL     ++  +Q  ++ D+ S  + W D W RRL  F+ RE++
Sbjct:   41 CSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPA--RYC----VVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFP--HNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ----NEQEAVCTDSHTDMRPLSGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYFRDLGKPITHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGVTCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGASRIRRGDQN--------LWIRSRDIACKCPKIKPLKKYLLLGNA--EDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKK 598          
BLAST of Netrin 1 vs. TrEMBL
Match: A0A4D6FZR0 (Netrin-5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=netrin-5 PE=2 SV=1)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 288/288 (100.00%), Postives = 288/288 (100.00%), Query Frame = 2
Query:  152 RAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPS 1015
            RAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFSSSCKKSFKMKRSKPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPS
Sbjct:    1 RAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFSSSCKKSFKMKRSKPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPS 288          
BLAST of Netrin 1 vs. TrEMBL
Match: Q49BF9 (Netrin 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 2.444e-103
Identity = 222/652 (34.05%), Postives = 341/652 (52.30%), Query Frame = 2
Query:  128 SSCFSESGRAKFCEPDFINVAQNAT-FEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQL-PDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPA-------CFSFKHS-VQNITSNIKVLPFNPMTGRTSLLPN-SRLIKEWVSVTDIMISLL----------TDG-------------------------------SKKRNKSPY----DHLSISDITIGARSQCYGHAKSLIKK--NGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLM----ATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQS---------LKSQVNLYESEY--SIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKHSK 1864
            S C+SE G+A  C P F N+ +N    E+TSTCGQ        + W     +N   C+K        + +I+ + D+++  + T W S  +       ++NIT +  KL+E+YYI +     L PDS+++ K   NG +W  W+YFS  C +SF ++   P+     S +KI+ +       C S   S + N+ ++  VL F   T   +   + S     W+S T+I I+L            DG                                KKRN        D  +++DI+IG R QCYGHA   +K   + T  CDC H TAG DC  C +   D+ W +   +  A   C+RC CN H+++C+F+EK+Y  S+ + G  C+ C H+T G +C+ C+ GY+R+ + P++H  VC KC CHP GS+    C+  N  C CK GV G  CNRC+KG+QQTKS  TPC      + +    A E RC  C   R RIRF+K+C+K  ++ +++QS+E HGE  RF ++V  ++RI  S         L S   +  +++  S +P+W++  D++CKCP+LQLG TYL++ K+    YL + EL++D+KS AL W   W RR+  F  +E QG C++++ KR++ +
Sbjct:   33 SLCYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNK------KQWICVDHINCHSCMK-------DTHSINYLTDQHLNNNITFWASDFVNHGD---NVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQ---PMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFT--TNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAE--CKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYR 660          
BLAST of Netrin 1 vs. TrEMBL
Match: A0A4S2M7W2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002075 PE=4 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 1.379e-100
Identity = 212/667 (31.78%), Postives = 329/667 (49.33%), Query Frame = 2
Query:  128 SSCFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKC--DDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQN--ITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISL-----LTD------------------------GSKKRNKSPYD----------------------HLSISDITIGARSQCYGHAKSLIKKN------------GTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------------------APETKNNLMATEE--RCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSI--YPIWVE---------NADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCD 1834
            S C SE GRA  C P F N+A+ A    TSTCG    T++ C+    ++G  + +C +C  +D+ P        + DR+   +ET WVSG + +     +INIT+++ K +EVYY+ ++  G+LPD++ LYK    GKTW PW YFS+ C ++F++  S   + Q  + N     C + K S  N     ++KV+ F+   GR S  P S  + +W+++TD+ +SL     L D                        G  ++NK                          H + SD+ IG R +C GH+   ++              G   CDC H TAG DC +C   + D+PW     +    N C+ C C NH  EC F  K +K S G+ G  C+ C H+T G HC+ CS G+ RN A P+ H Q C++C CHP GS+    C+  +G C CK GV G+ CNRC++GY+QT+ S  PC                  A  + +  + TE   +C  C  +R RIRF+KFC++  +    ++S    G+ TRF +R+ + WR+  +   ++   ++ +S+  +P+W++         N  IRC CP L+ G +YL  T+     + N+ EL++D  S  + W + W RRL+ F  R  + +C+
Sbjct:   53 SPCHSE-GRASQCMPPFTNIAEGAPVVATSTCGASDKTEKFCKQQVDATGRIQWRCEQCTSEDKFP-----THHLTDRHQMVNETYWVSGAVLRG---QTINITLSMGKTFEVYYVSLQPYGRLPDAIALYKSSDFGKTWHPWQYFSTDCFRAFRLPTSNEHNAQISAANIQEVLCVALKSSEDNEPYGRSLKVIAFSTTIGRPSSQPWSAALVDWMTMTDLRVSLTRFSDLADMTQHDASGLLLTPNLLSPAEVFRVGEVEKNKMSAGTLGMSRHHFQSDAASFMPDKGIHFAFSDLAIGGRCKCNGHSNRCVRDRLVDAAGKETGEWGPLRCDCQHNTAGIDCEKCAPGYLDRPWARA--TRELANECKPCRCGNHTSECVFSVKHFKQSGGQTGGICVACRHNTEGIHCDQCSAGFTRNPAVPMGHEQACRECRCHPIGSVANEPCDRKSGQCPCKPGVIGQACNRCEEGYKQTRLSDHPCVRVMEHFAYRRKTVPPPVAASSHHQPINTEPHLKCPPCKPHRRRIRFKKFCRREAVFMGKVESYRAEGDKTRFEIRIRETWRVDGA-AGRLLPKKASHSLPPFPVWIQSQLIGGDNGNPAIRCLCPELKTGESYLFFTQPYQIPHGNRMELMLDPSSIIIPWRESWRRRLNKFVRRAAKNRCN 707          
BLAST of Netrin 1 vs. TrEMBL
Match: A0A5N5Q759 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00011220 PE=4 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 5.718e-100
Identity = 187/583 (32.08%), Postives = 291/583 (49.91%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNN---LMATEERCGSC------GKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQY 1846
            C+SESG A++C P+F+N A       +STCG  G       + Y++  L                               T W S  +       ++ +T++L K +E+ YI + F  + PDSM +YK    G++W P+ ++SS C++ +      P   +    N+  P C    +S  N  +   +L F+ + GR S     +S ++++W++VTDI ++       K  + P    ++SD  +G R +C GHA   I+ K G  VCDC H T GP+C +C   H D+PW+   P E   N C  C CN HA  C+F+ ++YK S  K G  C++C H+T G HC+ C  GYYR+ + PI H + C  C CHP G+  ++ CN  +G CQCK GV G  CNRC KGYQQ++S   PC      N   L+++ E    C       K   +I  +K+CKK   + +S+   E  G+W +F V ++ +++ ++ LK   N          +WV+  D+ CKCP + +G  +L+L          +  L  D+ S  + W D W RRL  F+ RE++GKC   ++
Sbjct:   41 CYSESGAARYCIPEFVNAAFGQEVVASSTCGHHGCESTHLTDLYSAQNL-------------------------------TCWQSEMLRSMP--FNVTLTLSLGKKFEITYISLHFCSEKPDSMAIYKSMDYGRSWTPFQFYSSQCRRVYDR----PNRAEITKLNEQEPLCMELPNSADNSNA---ILVFSTLDGRPSRTNFVSSPVLQDWITVTDIRVTFARPKMSKDVREPAYFYAVSDFQVGGRCKCNGHAHRCIRDKEGKMVCDCKHNTEGPECDRCKPFHYDRPWQRATPKE--ANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGYYRDMSRPITHRKACTACDCHPVGAAGKT-CNQTSGQCQCKDGVTGLTCNRCAKGYQQSRSPVAPCIKIPTVNPTALVSSTEGPADCESYCRPAKGNLKINTKKYCKKDYAVLVSVLDMETVGDWAKFSVSLVSVYKSREPLKRGENT---------LWVQMKDLACKCPRIHMGKRFLILGSGGGGASAERAGLTADKNSLVIQWRDIWTRRLRKFQRREKKGKCSAAEH 571          
BLAST of Netrin 1 vs. TrEMBL
Match: W5UHM1 (Netrin-1 OS=Ictalurus punctatus OX=7998 GN=NTN1 PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 2.124e-99
Identity = 193/585 (32.99%), Postives = 299/585 (51.11%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDH-----LSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C+ E+G+A+ C PDF+N A       +STCGQK +  R C       G    +C  CD   P+     S + D +   + T W S    ++    ++ +T++L K +EV Y+  +F    PDSM ++K    GKTW+P+ Y+SS C+K +       +  Q       + A    +   Q   S   ++ F+ + GR S     NS ++++WV+ TDI I+      ++R     D       ++SD+ +G R +C GHA   ++ + G  VC+C H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GYYR+ + PI H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  ++      C S     K + +I  +K+CKK   +++ I   +  GEW +F V ++ +++  +S   + +          +WV   D+ CKCP ++ G  YLLL     ++   Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   36 CYDENGQARRCIPDFVNAAFGREVRASSTCGQK-TPSRYCLGTERGGGERSRECRMCDASDPKRRHPASHLTDLHNPHNLTCWQSENGIRYP--QNVTLTLSLGKKFEVTYVSAQFCSIRPDSMAIFKSMDYGKTWVPFQYYSSQCRKVYNKPNRAAITKQNEQEAVCTDAHQQQQPHHQQPVSG-GLVAFSTLDGRPSAHDFDNSPVLQDWVTATDIRITFSRLHGEERKAEAEDEDDSHFYAVSDLQVGGRCKCNGHASRCVRDRTGELVCECKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPITHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPSAPPTTTASITEQPADCDSYCKASKGKLKINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIVSVYKQSESRIRRGDQL--------LWVRAKDVACKCPKMKTGKKYLLLGNN--EDAPGQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 318.546 bits (815), Expect = 4.713e-100
Identity = 194/586 (33.11%), Postives = 301/586 (51.37%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGR-IPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISL--LTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKK--NGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC-----APETKNNLMATEERCGSC------GKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C+ E G A+ C PDF+N A       +STCG KG + R C       G     C  CD   P+ +   S + D N   + T W S   +    G  ++ +T++L K +EV Y+ V+F  + PDSM ++K    GKTW+P+ ++S+ C+K F       +  Q    N+    C       + ++  +  + F+ + GR S     NS ++++WV+ TD+ ++   LT   +          ++SD+ +G R +C GHA   +K+   G  VCDC H TAGP+C +C   H D+PW+     E   + C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GYYR+ + PI+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC     AP T     ++ E    C       K + +I  +K+CKK   +++ I   +  GEW +F V ++ +++  +S   + +          +WV   D+ CKCP ++ G  YLLL     ++   Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   37 CYDEHGAARRCIPDFVNAAFGKEVRASSTCGLKGPS-RYCAQDKGEEGART--CHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQALQG--NVTLTLSLGKKFEVTYVSVQFCSKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQ----NEQEAVCTDAHADGRPLSGGL--VAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLTAPGEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATARE--AHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPT--TTASSPEEPADCDSYCKASKGKLKINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVYKQGESRIRRGDQL--------LWVRAKDVACKCPKIKTGKKYLLLGND--EDSPGQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 596          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 318.161 bits (814), Expect = 4.607e-98
Identity = 193/593 (32.55%), Postives = 303/593 (51.10%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGR-IPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIK---------VLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISL--LTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKK--NGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC-----APETKNNLMATE-ERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C+ E G A+ C PDF+N A       +STCG KG + R C       G     C  CD   P+ +   S + D N   + T W S   +    G  ++ +T++L K +EV Y+ V+F  + PDSM ++K    GKTW+P+ ++S+ C               ++ FN+ + A  + ++  + + ++           ++ F+ + GR S     NS ++++WV+ TD+ ++   LT   +          ++SD+ +G R +C GHA   +K+   G  VCDC H TAGP+C +C   H D+PW+     E   + C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GYYR+ + PI+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC     AP T       E   C S     K + +I  +K+CKK   +++ I   +  GEW +F V ++ +++  +S   + +          +WV   D+ CKCP ++ G  YLLL     ++   Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:  214 CYDEHGAARRCIPDFVNAAFGKEVRASSTCGLKGPS-RYCAQDKGEEGART--CHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQALQG--NVTLTLSLGKKFEVTYVSVQFCSKRPDSMAIFKSMDYGKTWVPFQFYSTQC---------------RKVFNRPNRAAITKQNEQEAVCTDAHADGRPLSGGLVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLTAPGEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATARE--AHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTTASSPEEPADCDSYCKASKGKLKINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVYKQGESRIRRGDQL--------LWVRAKDVACKCPKIKTGKKYLLLGND--EDSPGQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 773          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 297.745 bits (761), Expect = 8.906e-92
Identity = 187/588 (31.80%), Postives = 297/588 (50.51%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIKK--NGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC-----APETKNNLMATE-ERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRI-QQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+ E+G+ + C PDF+N A       +STCG + +  R C    T  G    + C  CD   P+ +   + + D N   + T W S    +     ++ +T++L K +EV Y+ ++F    P+SM +YK    GKTW+P+ ++S+ CKK F       +  Q    N+    C      ++ +   +  + F+ + GR S     NS ++++WV+ TD+ ++   L T G +  + S     S    +SD+ +G R +C GHA   +K    G  VC+C H TAG +C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  + G  CL+C H+T G HC+ C  GYYR+    I+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC     A  T     A E   C S     K + ++  +K+CKK   +++ +   +  GEW +F + ++ +++  +  ++    L         +WV   D+ CKCP ++ G  YLLL      +   Q  ++ D+ S  + W D W RRL  F+ R+++GKC
Sbjct:   57 CYDENGQPRRCIPDFVNAAFGKEVRASSTCGAQTAA-RYC--VVTERGEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQSESYVQHP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCKKMFNRPSRAAITKQ----NEQEAVCTDSHTDMRPLAGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATARE--ANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVASPTATYTSAEEPTDCDSHCKASKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGEHRIRRGDQL---------LWVRAKDVACKCPKIKPGKKYLLLGSDD-DDSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 620          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 257.299 bits (656), Expect = 1.206e-75
Identity = 168/584 (28.77%), Postives = 276/584 (47.26%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGR-IPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIK---------VLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISL--LTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKK--NGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C+ E G A+ C PDF+N A       +STCG KG + R C       G     C  CD   P+ +   S + D N   + T W S   +    G  ++ +T++L K +EV Y+ V+F  + PDSM ++K    GKTW+P+ ++S+ C               ++ FN+ + A  + ++  + + ++           ++ F+ + GR S     NS ++++WV+ TD+ ++   LT   +          ++SD+ +G R +C GHA   +K+   G  VCDC H TAGP+C +C   H D+PW+     E   + C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  GYYR+ + PI+H + C++    P  +   S   P +    CK   +GKL                                         +I  +K+CKK   +++ I   +  GEW +F V ++ +++  +S   + +          +WV   D+ CKCP ++ G  YLLL     ++   Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:  214 CYDEHGAARRCIPDFVNAAFGKEVRASSTCGLKGPS-RYCAQDKGEEGART--CHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQALQG--NVTLTLSLGKKFEVTYVSVQFCSKRPDSMAIFKSMDYGKTWVPFQFYSTQC---------------RKVFNRPNRAAITKQNEQEAVCTDAHADGRPLSGGLVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLTAPGEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATARE--AHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKEIPVAPPTTTASSPEEPADCDSYCKAS-KGKL-----------------------------------------KINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVYKQGESRIRRGDQL--------LWVRAKDVACKCPKIKTGKKYLLLGND--EDSPGQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 723          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 236.113 bits (601), Expect = 3.776e-69
Identity = 161/579 (27.81%), Postives = 271/579 (46.80%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIKK--NGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRI-QQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+ E+G+ + C PDF+N A       +STCG + +  R C    T  G    + C  CD   P+ +   + + D N   + T W S    +     ++ +T++L K +EV Y+ ++F    P+SM +YK    GKTW+P+ ++S+ CKK F       +  Q    N+    C      ++ +   +  + F+ + GR S     NS ++++WV+ TD+ ++   L T G +  + S     S    +SD+ +G R +C GHA   +K    G  VC+C H TAG +C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  + G  CL+C H+T G HC+ C  GYYR+    I+H + C++    P  S   +Y + +                             T C    K +            K + ++  +K+CKK   +++ +   +  GEW +F + ++ +++  +  ++    L         +WV   D+ CKCP ++ G  YLLL      +   Q  ++ D+ S  + W D W RRL  F+ R+++GKC
Sbjct:   57 CYDENGQPRRCIPDFVNAAFGKEVRASSTCGAQTAA-RYC--VVTERGEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQSESYVQHP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCKKMFNRPSRAAITKQ----NEQEAVCTDSHTDMRPLAGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATARE--ANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACKEI---PVASPTATYTSAEE---------------------------PTDCDSHCKAS------------KGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGEHRIRRGDQL---------LWVRAKDVACKCPKIKPGKKYLLLGSDD-DDSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 570          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009682.1 (pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 gene:ENSPMAG00000008750.1 transcript:ENSPMAT00000009682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 3.829e-37
Identity = 102/335 (30.45%), Postives = 162/335 (48.36%), Query Frame = 2
Query:  446 KLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISLL---TDGSKKRN-----KSPYDHLSISDITIGARSQCYGHAKSLIKKN-GTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMATEE 1417
            K +++ Y+ ++F    P+S  +YKR      W P+ Y+S SC+ ++  +    L       ++ +P C      +  +T     + F+ + GR S     NS ++++WV+ T+I ++L    T G +  N     +S Y   +ISD  +G R +C GHA   +K   G   C C H T G DC +CL  +ND+PW     +  + N C  C CN  A+EC FD ++Y+ +   HG  C +C  +T G  C  C   +YR  A      + C  C C+P GS  +  C+ + G C CK GV G+ C++C  G+     +   C P T N     E+
Sbjct:    2 KAFDITYVRLKFHTSRPESFAIYKRASMDGPWTPYQYYSGSCEPTYGKRNRGFLRSGD---DEQTPLCTDEFSDISPLTGG--NVAFSTLEGRPSAYNFDNSPVLQDWVTSTEIRVTLNRLNTFGDEVFNDHKVLRSYY--YAISDFAVGGRCKCNGHASECVKNELGALACKCRHNTMGADCEKCLPLYNDRPWHRA--TSESANECTLCDCNGRADECYFDPELYRATG--HGGHCTNCRDNTDGKTCERCLENFYRRSA-----SEHCLPCNCNPVGSYSRQ-CD-EQGRCSCKQGVMGERCDQCLPGFHSMDEAG--CRPCTCNPAGTLED 316          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008925.1 (pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 gene:ENSPMAG00000008054.1 transcript:ENSPMAT00000008925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 2.123e-23
Identity = 114/477 (23.90%), Postives = 189/477 (39.62%), Query Frame = 2
Query:  446 KLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMI------SLLTDGSKKRNKSPYD---------HLSISDITIGARSQCYGHAKSLIKKNGT--TVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSG-------KHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQ------SYCNPDN----GICQCKIGVEGKLCNRCK---KGYQQTK---------SSSTPCAPETKNNLMATEERCGSC--GKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRI--QQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLN 1726
            ++++V Y+IV+ A        + +R  +G T+ PW Y+S S  +        P  +    + +      +  + V  + +  K+   + + GR S    S  + ++ S   I +      +L  D     ++ P +         + SI DI++G    C GHA +      T    C C H T G +C  C   +N + W+    +   GN CE+C C+   E+C +D ++ + +           G  C++C  +T G +C +C  G+YR      N P  C+ C C P GSL Q       + +P+     G C C+ G  G+ C RC    +GY   K         ++  PC+           E C  C  G    R R  + C       +S   + +   W    V  ++ WR+  +Q L+      E    +  + V NAD+R   P L     Y L     L N L 
Sbjct:    1 QVFQVAYVIVKAANSPRPGNWILERSLDGATYHPWQYYSVSDSECLTRYGITPT-VGNPVYRRDDEVICTSYYVVLLMLARGKIH-TSLINGRPSADDPSPKLLDFTSARYIRLRLQRIRTLNADLMTLSHRDPREVDPIVTRRYYYSIKDISVGGMCICSGHASTCPWNEDTQKMECQCEHNTCGENCQHCCPGYNQRRWRPGTINN--GNTCEKCNCHGKTEDCYYDAEVDRTNRSLSVHGRFSGGGVCVNCSANTAGTNCETCRDGFYRPTGVLPNDPYPCRLCQCDPQGSLSQVCIKDEKHADPEKDLSPGQCLCRPGFAGERCERCAFAYRGYPDCKPCLCSMAGGTNDDPCSEPCVCKERVEGEHCDRCRAGFYDLRPRNPRGCSACFCFGLSSSCRSL--PWGVTQVVDMRGWRVTDRQGLRKVKTFVE----VDQVAVRNADVRRTLPALY----YWLAPTSYLGNKLT 463          

HSP 2 Score: 61.6178 bits (148), Expect = 4.692e-10
Identity = 57/177 (32.20%), Postives = 76/177 (42.94%), Query Frame = 2
Query:  914 GTTVCD-CLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGS-LPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKS----SSTPCAP-ETKNNLMATEERC 1423
            G   CD CL    G  C +C      +P      S P G+ C RC CN + EE     ++    +G+    CL C   T G HC  C+ G+Y +          CQ C CHP G+  PQ  C+  NG C C+  V G+ C +C  G+    S    S  PC P  T     + + RC
Sbjct:  700 GVLTCDQCLPGYIGLRCERCADDFFGEP------SSPGGS-CRRCECNGN-EEAWGGGRVCDARTGQ----CLRCRERTAGFHCERCADGFYGD----ATGTGGCQPCQCHPEGATAPQ--CDRINGQCPCRPSVVGRTCEQCAIGFYGLSSGAGCSPCPCHPVGTAGVACSADGRC 858          

HSP 3 Score: 51.9878 bits (123), Expect = 3.954e-7
Identity = 48/173 (27.75%), Postives = 71/173 (41.04%), Query Frame = 2
Query:  680 TSNIKVLPFNPMTGRTSLLPNSR--LIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRN 1192
            T ++++LP N    R++  P SR  L+    +VT + I      S    K     LS   + + +     G   +L  +     C C H  AG  C  C++ H      +       G  CE C C+ HA++C        + SG        C H+T GPHC  C PG+Y N
Sbjct:  517 TLSLRLLPENFFDFRSNA-PVSRDALMTALANVTRLQIR----ASYSSVKQAVYRLSAVSLDVASPDAAVGSPAALDVEQ----CHCPHGYAGTSCESCMRGHRRVDGTL------HGGRCEPCRCHGHADDCD-------DLSGDCMLPLSGCRHNTMGPHCELCRPGFYGN 667          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004606.1 (pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004606.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 1.341e-19
Identity = 58/197 (29.44%), Postives = 96/197 (48.73%), Query Frame = 2
Query:  443 NKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLP---NSRLIKEWVSVTDIMISL-----LTD---GSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPW 997
             K +++ Y+ + F    P+S  +YKR      W P+ ++S +C+++F +     L         +    FS    +  +T     + F+ + GR   L    N +L +EWV+ TD+ +SL       D   G  K  +S Y   ++SD+ +G R +C+GHA    +  +G  VC C H T G DC +CL +HN +PW
Sbjct:    3 GKAFQITYVRLRFHTSRPESFAIYKRTSPASPWQPYQFYSGTCERTFGLPSRGFLRAGDEERTALCSDEFS---DISPLTGG--NVAFSTLEGRPGALAFDGNDKLQQEWVTATDVRVSLRRLNTFGDEVFGDPKVLRSYY--YAVSDLAVGGRCKCHGHASECGRGSDGRLVCRCQHNTTGDDCERCLPSHNSRPW 192          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004614.1 (pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 1.485e-17
Identity = 55/202 (27.23%), Postives = 89/202 (44.06%), Query Frame = 2
Query:  452 YEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRT-----------SLLPNSRLIKEWVSVTDIMISL-----LTD---GSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPW 997
            +++ Y+ + F    P+S  +YKR      W P+ ++S +C               +R+F   S          +    + +    +P+TG             S  P S   +EWV+ TD+ +SL       D   G  K  +S Y   ++SD+ +G R +C+GHA    +  +G  VC C H T G DC +CL +HN +PW
Sbjct:    1 FQITYVRLRFHTSRPESFAIYKRTSPASPWQPYQFYSGTC---------------ERTFGLPSRGFLRAGDEERTALCSDEFSDISPLTGGNVAFSTLEGLFHSTGPLSSATQEWVTATDVRVSLRRLNTFGDEVFGDPKVLRSYY--YAVSDLAVGGRCKCHGHASECGRGSDGRLVCRCQHNTTGDDCERCLPSHNSRPW 185          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007784.1 (pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1 gene:ENSPMAG00000007035.1 transcript:ENSPMAT00000007784.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 1.613e-17
Identity = 79/307 (25.73%), Postives = 126/307 (41.04%), Query Frame = 2
Query:  305 DDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHS-INITINL-NKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPN------SRLIKEWVSVTDIMISLL-----TDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHK--TAGPDCSQCLKTHNDQPWKIIFPSEPAG-----NICERCFCNNHAEECKFDEKIYKNSSGKH----GSRCLHCLHHTTG 1153
            DDR+P +S +   +   N     TVWVS   P        + ++I L    Y+V+Y+IV+F    P+ + + +R   G  W+ W  F+  C   + M ++ PL  +  S N     C  F   V     N+    F+ +T   +L P       +  ++ +V   ++ + L        G       PY   ++S++ +  R +C+GHA+          C C  +  T GP+C  C     D+PW+       AG     N C  C C   A  C++ E I     G H    G  C  C  +TTG
Sbjct:   67 DDRVPRVSPHARPLSHVNDDDASTVWVSAPSPGPGQPPPSVAVSIELRGGSYQVFYVIVQFLSPQPEGVRIQRRPAAGSPWVDWQVFAKDCVSMYNMSKNGPLE-KPDSVN-----CLQFPREVPLSRGNVT---FSVLTPEPNLRPGYNAFYATPALQAFVLAAEVRVLLEGRLLGVAGVAGGPLRPYH--AVSEVIVSGRCECHGHAERCDSSTTPYRCLCSAQSNTEGPNCELCRPLFRDKPWR-------AGDTRNQNACRPCLCYGRALSCRY-EAILDPHPGLHWRGGGGVCQDCTQNTTG 354          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI5])

HSP 1 Score: 253.062 bits (645), Expect = 4.594e-76
Identity = 166/581 (28.57%), Postives = 290/581 (49.91%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGR--TSLLPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHL--SISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMATE--------ERCGSCGKNRPRIRFRKFCKKHIMIKISI--QSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C++E  RA+ C+P F ++A N    V+ TCG+K  + R C      S      C  CD+R  + S     + D + + + T W +  +       ++ + ++  K Y++ Y+ ++F G  PDSM +YK    GK+W  + ++SS C+K +    +  +  +         A  +  H ++ +      + F+ + GR   S +  S +++EWV  TDI +         R+  P D L  ++S+  +G R  C GHA   +  +NG  VCDC H T G DC  C    ND+PW+    +  + N C+ C CN HA  C F  +++K S G+ G  C+ C H+T G +C+ C  G+Y++    I H +VC++C CHP+GS  +  CN   G C CK GV G+ C++C  GY+ TKS+  PC  ET N +M+ E        + C  C   R  ++ ++FC+K   +K+++    K++   W R  V +  +++  ++ + +       Y    +W++  D RC+CP L+ G +Y +     L+    +  ++++ +S  L W++  ++R+  F   +    C
Sbjct:    5 CYNEFNRAQLCQPAFHDLAYNKDVYVSHTCGEK--SRRFCP---PMSVRGRTACGFCDERNAKTSHPAKYLTDVHNENNVTCWQADPV---QSRENVTLILSFGKTYDITYVSLQFCGIRPDSMGIYKSMDYGKSWQAYQFYSSRCEKMYGRVTNGEISPENEQV-----ALCTDGHLLRPLYGG--RIAFSTLEGRPSASKMDYSAVMQEWVMATDIKVEF---NMISRSARPRDSLYYAVSEFNVGGRCHCNGHASECVSDRNGRQVCDCKHNTVGVDCGACRPFFNDRPWRPA--THHSANECKMCNCNLHARTCVFSMELFKLSGGRSGGVCVKCRHNTAGRYCHYCREGFYKDPNKHITHIKVCRQCNCHPHGSRGR-VCNQSTGQCPCKEGVVGRSCDKCAPGYKSTKSNIVPCI-ETPNVVMSQESSTPRSRDQGCSQC--RRVPLKVKRFCRKDFALKVTVVRVEKKLPNSWVRATVNINTLFKRSRTRRVRRG---DGY----VWIKKRDFRCRCPKLKPGRSYFIAG--NLRGQSRKRSIVLNGRSVVLPWNEKLLKRIYRFIKLQRNNNC 552          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF3])

HSP 1 Score: 160.999 bits (406), Expect = 3.531e-41
Identity = 126/422 (29.86%), Postives = 197/422 (46.68%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNE--GKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMISL-----LTD---GSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKK---NGTT--VCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGY 1348
            C+   GRA+ C P F N A        +TCG         + +   +G+ E   +C  C+   P L      + D     + T W S  + + +    + +T++L K Y+V YI + F    P+SM +YK+      W+P+ YFS++C+K++ +  +  +  +    N+    C     ++  +T     + F+ +  R       NS  ++EWV+   + I L       D   G     +S Y   +I D++IG R +C GHA    +    +G T   C C H T G DC +C   +ND+PW     S    N C RC CN  AE C FDE +Y+ +   HG RC +C  +T GP+C  C   +YR  +      + C  CGC+P GS+    CN + G C+CK GV G  C++C+  Y
Sbjct:   21 CYDSQGRAQRCMPQFGNAAFGKRVISNNTCGDPP------KKFCVQTGVLEVRKECEMCNSSDPALEHPALKITDIKDDTNRTWWQSETLLE-NPDKPVTLTLDLGKSYDVSYIRIRFRSPRPESMAIYKKTTPSSKWIPYQYFSATCEKTYGVTTNGIVDPR----NQQVALCTDAFSTITPLTGG--NVAFSTLEDRPDAYNFDNSPALQEWVTAVAVRIHLRRMNTFGDEVFGDPNVLRSYY--YAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPW--ARASSRNANECVRCNCNGLAESCVFDEALYRQTG--HGGRCQNCKQNTDGPNCERCKENFYRKTSL-----EPCVACGCNPVGSVSLQ-CNSE-GQCRCKPGVTGIKCDKCQANY 416          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF6])

HSP 1 Score: 152.525 bits (384), Expect = 2.247e-38
Identity = 121/411 (29.44%), Postives = 189/411 (45.99%), Query Frame = 2
Query:  167 EPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVS-------GRIPKFSGIHSINITINLNKLYEVY-YIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKV-LPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLL---TDG---SKKRNKSPYDHLSISDITIGARSQCYGHAK--SLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGY 1348
            EP F    ++     TSTCG   S    CR       LN   C KC+   P     I  + D++     T W S        + P+      +N++I+ NK Y++  +I+  F    P   +L K    G+TW P  Y+S +C+K F M+ + P    +  F   S  C + K+S  +   N KV   F     + S       +++++S TD+ + +    TDG   +K        + ++SD+ + AR +C+GHA+      + G   CDCLH T G DC +CL   N++ W +   SE   N CERC C++HA+ C + ++       +    C  C H+T G  C  C   +YRN +  +NHP++C  C C P G      CN   G C+C+  V G+ C+ C   +
Sbjct:   35 EPRFAAKMKHRAVSSTSTCGSPPS--EYCR----VKPLN--GCFKCNASSPTERHPIEYIADKSPGSDATFWQSETWWDWYQKNPRDD--LKVNVSISFNKTYDITGHIMFTFESPRPSKAILEKSFDKGQTWDPLQYYSFNCRKDFGMENTDPT---ENRFGDFSAKC-TEKYSSSSPQQNGKVTFDFLRRYNKASFFDTQ--VQQYLSATDLRLRMEYPGTDGLEVAKDEVTLKQYYYAVSDLEVIARCKCHGHARWCDFPHETGKN-CDCLHNTTGDDCERCLPLFNNKTW-MPATSETEPNPCERCECHSHADSCTYSQQ-------EGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNNGTCNQTTGQCECRANVTGRQCDSCADTF 420          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO39502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X8])

HSP 1 Score: 120.168 bits (300), Expect = 5.420e-28
Identity = 91/338 (26.92%), Postives = 149/338 (44.08%), Query Frame = 2
Query:  407 SGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLL-PNSRLIKEWVSVTDIMIS---LLTDGSKKRNKSPYD----HLSISDITIGARSQCYGHAKSLIKKNGTTV--------CDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDN--------GICQCKIGVEGKLCNRCKKGY 1348
            +G  ++ + ++L   +   ++I+ F    P  MV+ +    GK W  + YFS+ C K F         I +     I     + K+S    ++N +V+ F  +  +  +    S  ++  + +T+I I+   L T G    +  P      + ++ D+ I     CYGHA+  + + G           C+C H T G +C +C   + D PW+      P  N C +C CN HA +C+FD  +Y+ S    G  C  C H+T G +C  C P +Y++ +   + P  C  C C P G +    C   N        G C CK  V G  C+RCK G+
Sbjct:  102 NGRENVYLQLDLESEFHFTHLIMRFRTFRPAGMVIERSWDYGKKWQIYRYFSADCDKIFP-------GIPKGEPKDIDDVICTNKYSTVEPSTNGEVI-FRALKSQIPIKNAYSSKVQNLLKITNIRINFTKLHTLGDDLLDPRPEIKRKYYYAVYDLVIRGSCSCYGHAEQCLPEPGQPTTPGMVYGRCNCTHNTTGKNCERCQDGYFDVPWRPADADNP--NECRKCNCNGHAVKCRFDPAVYQASGNVSGGVCQDCEHNTVGRNCERCKPLHYQDPSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGF 429          

HSP 2 Score: 64.3142 bits (155), Expect = 1.181e-10
Identity = 60/210 (28.57%), Postives = 80/210 (38.10%), Query Frame = 2
Query:  875 QCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCL---------KTHND----------------QPWKIIFPSEPAGNICERC---FCNNHAEECK----------------------FDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSY--CNPDNGICQCKIGVEGKLCNRCKKGY 1348
            +CYGHA S   K G  V DC H T G +C  C           T ND                +   +   + P   +C++C   +     EEC                        D  +  N     GS CL CL++T G +C  C PGY+ + A   N    C  C C   G+ P  +  CN   G C C   VEGK C+RC +G+
Sbjct:  851 RCYGHASSCNPKTGVCV-DCQHNTVGKNCEACAVGFYGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGYYGNPLVPGGSCKPCSCNNNIDPTVSGNCDRLTGS-CLQCLYNTAGFNCERCKPGYFGD-AIARN----CTSCVCDKKGTNPGFHYSCNHKTGQCNCLPDVEGKQCDRCAEGF 1053          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO46760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNY3])

HSP 1 Score: 113.235 bits (282), Expect = 8.382e-26
Identity = 99/376 (26.33%), Postives = 174/376 (46.28%), Query Frame = 2
Query:  425 NITINLNKLYE---VYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKIS-PACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAK--SLIKKNGTTV------CDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKH---GSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCH-PYGSLPQSYCNPDN-------GICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMATEERCGSCGKNRPRIRFRKFCKKHI 1483
            N T+ ++ LY+   ++++I+ F G  P+++++ +    G T+ PW YF+S C+ SF M+ +  L +   S N I    C    H+ Q +T  IK    +P   R    P++    E    +++ I L      +  K  Y   ++  + +  R +C+GHA+  + IK N ++       CD    T G  C  CL  +N++ +      +P    C +C CNNHA  C ++  +  + + +    G  C++CLH+T G  C+ C   ++R     ++   VC  C C  P     ++ C  D+       G C+CK   +G+ C+ CK G+   KSS +        N   T  R  SC ++R +     +CK ++
Sbjct:  353 NATVEVDLLYQELQIFFVIMLFYGPPPEAILIERSRDRGSTYKPWQYFASDCQSSFGMENNGNL-VNPDSINCIQYQRCECHGHA-QKVTF-IKGNSSSPGRCRCECDPSTFTQGE--KASNVRIQLYNHTLIQNEKHRY--FALKRVLVTGRCECHGHAQKVTFIKGNSSSPGRCRCECDPSTFTQGEKCESCLPMYNNKAFLRGTNDDPYP--CVKCECNNHATACYYNSSLDPSPASRTVGGGGVCINCLHNTAGQFCHVCRDDFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGRQCDACKPGFYDLKSSHSTGCVTCGCNTAGTVNRNASCDQSRGQC----YCKSNV 715          

HSP 2 Score: 78.9518 bits (193), Expect = 4.006e-15
Identity = 53/185 (28.65%), Postives = 79/185 (42.70%), Query Frame = 2
Query:  842 SISDITIGARSQCYG----HAKSLIKKNGTT------VCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSS 1366
            S+S + + +  QC G      K+   ++ +T       C+C   T G  C  C     D     +  S   G  C  C CN           + +N+S        +C  + TG  C++C  G+Y  R    N P  C+ C C P+G+LP S C+  +G C+CK G  G  C+ C+ GY    SS
Sbjct:  618 SLSAVDVCSPCQCTGPGVETGKTSCARDDSTPGVIAGQCECKQYTQGRQCDACKPGFYD-----LKSSHSTG--CVTCGCNTAG-------TVNRNASCDQSRGQCYCKSNVTGRTCDTCESGFYGLRD---NDPSGCRACECDPFGTLPGSVCDAGSGQCRCKAGSTGLRCHLCEDGYHSLDSS 785          

HSP 3 Score: 67.0106 bits (162), Expect = 2.267e-11
Identity = 52/173 (30.06%), Postives = 68/173 (39.31%), Query Frame = 2
Query:  926 CDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHA----EECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMATEERCGSC 1432
            C C      P C QC+K + +     +  S P G  C+ C CN       +     E     S+GK       CL +  G  C+ C   YY N   P  +   C  C C   GSL  + CN   G CQCK  + G+ C+RC  G      S  PC      +L  T +  G C
Sbjct:  865 CTCKKYVREPTCGQCMKGYFN-----LSSSNPEG--CQACNCNPKGTLGGDRTPAGELECSGSNGKCA-----CLTNVQGLRCDQCVSAYYWN---PSGYG--CSPCNCDASGSLATN-CN-STGYCQCKPNIGGRRCDRCMPGSYGGPGSCKPCNCNMAGSLSDTCDDSGKC 1018          

HSP 4 Score: 60.4622 bits (145), Expect = 2.372e-9
Identity = 43/150 (28.67%), Postives = 59/150 (39.33%), Query Frame = 2
Query:  926 CDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRC-----LHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTK 1360
            C CL    G  C QC+  +    W       P+G  C  C C+               +SG   + C       C  +  G  C+ C PG Y         P  C+ C C+  GSL  + C+ D+G C CK  V+G  C+ CK G Q  +
Sbjct:  924 CACLTNVQGLRCDQCVSAYY---WN------PSGYGCSPCNCD---------------ASGSLATNCNSTGYCQCKPNIGGRRCDRCMPGSY-------GGPGSCKPCNCNMAGSLSDT-CD-DSGKCNCKPNVQGDKCDTCKDGTQNLQ 1040          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 320.857 bits (821), Expect = 6.447e-101
Identity = 194/588 (32.99%), Postives = 306/588 (52.04%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMI---SLLTDGSKKRNKSPYDH----LSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C+ E G  + C PDF+N A     +V+STCG+  S  R C       G    + C  CD   P+     + + D N   + T W S    ++    ++ +T++L K +EV Y+ ++F    P+SMV+YK   NGKTW+P+ ++S+ C+K +       +  Q    N+    C      +  +T  +  + F+ + GR S     NS ++++WV+ TDI +    L T G +  + S         ++SD+ +G R +C GHA   +K ++G+ VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  G+YR+ + PI+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  +       C S     K + +I  +K+CKK   +++ I   +  GEW +F V ++ +++  +S   + + +        +WV   D+ CKCP ++ G  YLLL   ++    +Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   38 CYDEHGNPRRCIPDFVNAAFGKEVKVSSTCGKTPS--RYCVVTSAEKGEERTRNCHSCDASDPKKYHPPAYLTDLNNPHNLTCWQSENFIQYP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMVIYKSMDNGKTWVPFQFYSTQCRKMYNKPNRAVITKQ----NEQEAVCTDSHTDMYPLTGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVVFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVKDRDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVSPPTTPASSTEEASDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKMGEWWKFTVNIISVYKQGESRIRRGDQF--------LWVRAKDVACKCPKIKPGKKYLLLGNDEVSP--SQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 313.153 bits (801), Expect = 3.767e-98
Identity = 189/587 (32.20%), Postives = 300/587 (51.11%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMI---SLLTDGSKKRNKSPYDH----LSISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
            C+ E G  + C PDF+N A     +V+STCG+                        CD   P+     + + D N   + T W S    ++    ++ +T++L K +EV Y+ ++F    P+SMV+YK   NGKTW+P+ ++S+ C+K +       +  Q    N+    C      +  +T  +  + F+ + GR S     NS ++++WV+ TDI +    L T G +  + S         ++SD+ +G R +C GHA   +K ++G+ VCDC H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  CL+C H+T G HC+ C  G+YR+ + PI+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC       P T  +       C S     K + +I  +K+CKK   +++ I   +  GEW +F V ++ +++  +S   + + +        +WV   D+ CKCP ++ G  YLLL   ++    +Q  ++ D+ S  + W D W RRL  F+ RE++GKC +
Sbjct:   38 CYDEHGNPRRCIPDFVNAAFGKEVKVSSTCGKT-----------------------CDASDPKKYHPPAYLTDLNNPHNLTCWQSENFIQYP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMVIYKSMDNGKTWVPFQFYSTQCRKMYNKPNRAVITKQ----NEQEAVCTDSHTDMYPLTGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVVFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASRCVKDRDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVSPPTTPASSTEEASDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKMGEWWKFTVNIISVYKQGESRIRRGDQF--------LWVRAKDVACKCPKIKPGKKYLLLGNDEVSP--SQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 580          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: ntn1b (netrin-1 [Source:NCBI gene;Acc:101161061])

HSP 1 Score: 298.901 bits (764), Expect = 1.869e-92
Identity = 185/587 (31.52%), Postives = 300/587 (51.11%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMI---SLLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRI-QQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+ E+G  + C PDF+N A      V+STCG   +  R C    +  G    + C  CD   P+ +   + + D N   + T W S    ++    ++ +T++L K +EV Y+ ++F    P+SM +YK    GK+W+P+ ++S+ CKK +  +    +  Q    N+    C      +  +T  +  + F+ + GR S     NS ++++WV+ TDI +    L T G +  + S     S    +SD+ +G R +C GHA   +K + G  VC+C H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  + G  CL+C H+T G HC+ C  GY+R+ + PI+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC      +P +  +       C S     K + +I  +K+CKK   +++ +   +  GEW +F V ++ +++  +  ++    L         +WV   D+ C+CP ++ G  YLLL      +      ++ D+ S  + W D W RRL  F+ R+++GKC
Sbjct:   41 CYDENGNPRRCIPDFVNSAFGKDVRVSSTCGNPAA--RFC--VVSEKGEERTRDCHTCDSNDPKKAHPPAYLTDLNNPHNLTCWQSETYVQYP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKSWVPFQFYSTQCKKMYNRQNKATITKQ----NEQEAICTDSHTDMHPLTGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVIFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYFRDMSKPISHRRACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVASPTSTYSSYEEPSDCDSYCKASKGKMKITMKKYCKKDYAVQVHVLKGDKAGEWWKFTVNIISVYKQGRHRIRRGDQL---------LWVRAKDVACRCPKIKPGRKYLLLGTD--DDSPGHSGVVADKGSLLIPWKDLWGRRLRKFQQRDKRGKC 601          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: ntn1b (netrin-1 [Source:NCBI gene;Acc:101161061])

HSP 1 Score: 298.516 bits (763), Expect = 2.090e-92
Identity = 185/587 (31.52%), Postives = 300/587 (51.11%), Query Frame = 2
Query:  134 CFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMI---SLLTDGSKKRNKSPYDHLS----ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC------APETKNNLMATEERCGS---CGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRI-QQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKC 1831
            C+ E+G  + C PDF+N A      V+STCG   +  R C    +  G    + C  CD   P+ +   + + D N   + T W S    ++    ++ +T++L K +EV Y+ ++F    P+SM +YK    GK+W+P+ ++S+ CKK +  +    +  Q    N+    C      +  +T  +  + F+ + GR S     NS ++++WV+ TDI +    L T G +  + S     S    +SD+ +G R +C GHA   +K + G  VC+C H TAGP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  + G  CL+C H+T G HC+ C  GY+R+ + PI+H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC      +P +  +       C S     K + +I  +K+CKK   +++ +   +  GEW +F V ++ +++  +  ++    L         +WV   D+ C+CP ++ G  YLLL      +      ++ D+ S  + W D W RRL  F+ R+++GKC
Sbjct:   40 CYDENGNPRRCIPDFVNSAFGKDVRVSSTCGNPAA--RFCV--VSEKGEERTRDCHTCDSNDPKKAHPPAYLTDLNNPHNLTCWQSETYVQYP--QNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKSWVPFQFYSTQCKKMYNRQNKATITKQ----NEQEAICTDSHTDMHPLTGGL--IAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVIFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATARE--ANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYFRDMSKPISHRRACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVASPTSTYSSYEEPSDCDSYCKASKGKMKITMKKYCKKDYAVQVHVLKGDKAGEWWKFTVNIISVYKQGRHRIRRGDQL---------LWVRAKDVACRCPKIKPGRKYLLLGTD--DDSPGHSGVVADKGSLLIPWKDLWGRRLRKFQQRDKRGKC 600          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: ntn2 (netrin-3 [Source:NCBI gene;Acc:101160359])

HSP 1 Score: 289.656 bits (740), Expect = 1.210e-88
Identity = 190/633 (30.02%), Postives = 305/633 (48.18%), Query Frame = 2
Query:  125 FSSCFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-------CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIK---------VLPFNPMTGRTSL--LPNSRLIKEWVSVTDIMIS----------LLTDGSKK--RNKSPYDHLS--------ISDITIGARSQCYGHAKSLIK-KNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNN---LMATEERCGSCG------KNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQ-QSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNY-------------LNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDR 1837
               C+ E+G A+ C P+FIN A      V+S CG+  S  R C      S +  G        C  CD   P  +   S + D N   + T W S  +   +  H++ +T++L K +E+ Y+ ++F    P+S+ +YK    GKTW+P+ ++SS C               +R +NK + A  + ++  + + ++           ++ F+ + GR S     NS ++++WV+VTDI +           +L  GS    R+  P    S        + D  +G R +C GHA   +K K G  VCDC H T GP+C +C   H D+PW+     E   N C  C CN HA  C+F+ ++YK S  K G  C++C H+T G HC+ C  G+YR+   PI H + C+ C CHP G+  ++ CN   G C CK GV G  CNRC KGYQQ++S   PC      N   ++++ E    C       K   +I  +K+CKK   +++++   E  G+W +F V ++ +++ + + LK   N+         +WV   D+ CKCP +Q+   +L++   +                   +  L+ D+ S  + W D W RRL  F+ +E++GKC +
Sbjct:   34 LDPCYDETGTARRCIPEFINAAFGKEVMVSSVCGRPPS--RSC------SVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQSENL--NTSPHNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGKTWMPYQFYSSQC---------------RRMYNKPNKATITKQNEQEALCTDGHTDLYPLSGGLIAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVVFGRPQLSREFVLGAGSNNGGRDDDPVAVTSTLSTYFYAVGDFQVGGRCKCNGHASRCLKDKEGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANARE--ANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDCHPVGAAGKT-CNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSSTEEPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETVGDWAKFSVSLVSVYKSRGEPLKRGDNI---------LWVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLVADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSK 629          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000006779.1 (SMESG000006779.1)

HSP 1 Score: 1186.4 bits (3068), Expect = 0.000e+0
Identity = 586/586 (100.00%), Postives = 586/586 (100.00%), Query Frame = 2
Query:  122 GFSSCFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKHSKLMNSR 1879
            GFSSCFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFSSSCKKSFKMKRSKPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKHSKLMNSR
Sbjct:   22 GFSSCFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFSSSCKKSFKMKRSKPLHIQQRSFNKISPACFSFKHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGSKKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKHSKLMNSR 607          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 385.185 bits (988), Expect = 1.021e-124
Identity = 215/606 (35.48%), Postives = 327/606 (53.96%), Query Frame = 2
Query:  146 SGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFK--HSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGSKK-------------------------RNKSPYDHLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMA-TEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKHSKLMN 1873
            +GR + C P F N+ +N   E TSTCG  G  ++ICRNWY  +     + C  CD +    S   S + DR+I  ++T W SG + +  G + +NIT++L K +EVYYI ++  G LPDS+ +YK    G +W PW +FS  C ++FKM  +   + Q    N     C   K      +      VLPF+ + GR S  P S+ + EW+++TD+ ISL+    +K                             P  H  +SD+ +G R +C GHA + LI  N    CDC H T G +C +C   + D+PW+    +    N+C+ C C NH+++C F   +YK + G+HG  CL C H+T G  C+ C+  +YR+   P+ HPQ C  C CH  GS+ Q+ C+   G C C+ GV G+ C+RCK GY+Q+ S+  PC P +    MA T   C  C + R RI F+KFC++  + + +  SKEIHG   R+ +++ +IWR+ +++   +         Y  W+ + D+RC CP ++LG +YL+LT+ K   YL   EL +D +S  L W + W RRL  F+ RE++GKC+  QY +K  K+++
Sbjct:   33 NGRPQQCLPSFTNIIENVKAETTSTCGTNGP-EQICRNWYDKTTAEARQYCSICDAK--HRSYPPSHITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGTLPDSIAIYKSLDFGVSWKPWQFFSQDCYRAFKMPTTNEQNSQITPANIHEVLCVELKAPERYNDYGQAETVLPFSTIYGRPSGPPWSQDLVEWMTMTDLRISLMRFTPEKSTPYRLKELYYHTESLPQAPPNLVNHKTEPIVHFGLSDLAVGGRCKCNGHANRCLIDDNDEIKCDCHHNTEGQECERCKSNYLDRPWQ--RATRQNANVCKLCQCYNHSDKCMFSMGMYKQTRGQHGGVCLECKHNTEGHACDECAAFHYRDITKPVTHPQACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGYKQSNSTVRPCIPSSGMADMANTSPVCKKCNEKRKRIVFKKFCRRKSVFRATALSKEIHGNMIRYELKIDEIWRVDKNVWEFLPRETPAMHTYRAWINSEDVRCNCPKVELGQSYLILTRAKYYLYLRNKELYIDSRSVMLPWHNSWERRLQKFQKREKRGKCE--QYFKKKMKIID 631          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 375.17 bits (962), Expect = 6.372e-121
Identity = 213/606 (35.15%), Postives = 325/606 (53.63%), Query Frame = 2
Query:  146 SGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGK-CLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSFK--HSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGSKK-------------------------RNKSPYDHLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMA-TEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKHSKLMN 1873
            +GR + C P F N+ +N   E TSTCG  G  ++ICRNWY  +     + C  CD +    S   S + DR+I  ++T W SG + +  G + +NIT++L K +EVYYI ++  G LPDS+ +YK    G +W PW +FS  C ++FKM  +   + Q    N     C   K      +      VLPF+ + GR S  P S+ + EW+++TD+ ISL+    +K                             P  H  +SD+ +G R +C GHA + LI  N    CDC H T G +C +C   + D+PW+    +    N+C+ C CN H+  C F+ +IY  ++  +G  C++C HHTTG +C +C  G++RN   P  H   C  C CH  GS+ Q+ C+   G C C+ GV G+ C+RCK GY+Q+ S+  PC P +    MA T   C  C + R RI F+KFC++  + + +  SKEIHG   R+ +++ +IWR+ +++   +         Y  W+ + D+RC CP ++LG +YL+LT+ K   YL   EL +D +S  L W + W RRL  F+ RE++GKC+  QY +K  K+++
Sbjct:   33 NGRPQQCLPSFTNIIENVKAETTSTCGTNGP-EQICRNWYDKTTAEARQYCSICDAK--HRSYPPSHITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGTLPDSIAIYKSLDFGVSWKPWQFFSQDCYRAFKMPTTNEQNSQITPANIHEVLCVELKAPERYNDYGQAETVLPFSTIYGRPSGPPWSQDLVEWMTMTDLRISLMRFTPEKSTPYRLKELYYHTESLPQAPPNLVNHKTEPIVHFGLSDLAVGGRCKCNGHANRCLIDDNDEIKCDCHHNTEGQECERCKSNYLDRPWQ--RATRQNANVCKYCDCNLHSYRCYFNSQIYVRNNYTNGGVCINCRHHTTGNNCENCENGFFRNWTKPQEHRAACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGYKQSNSTVRPCIPSSGMADMANTSPVCKKCNEKRKRIVFKKFCRRKSVFRATALSKEIHGNMIRYELKIDEIWRVDKNVWEFLPRETPAMHTYRAWINSEDVRCNCPKVELGQSYLILTRAKYYLYLRNKELYIDSRSVMLPWHNSWERRLQKFQKREKRGKCE--QYFKKKMKIID 631          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000076695.1 (SMESG000076695.1)

HSP 1 Score: 365.54 bits (937), Expect = 2.346e-117
Identity = 212/627 (33.81%), Postives = 334/627 (53.27%), Query Frame = 2
Query:  149 GRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPACFSF--KHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISL--LTD------------------GSKKRNKSPYD---------HLSISDITIGARSQCYGHA-KSLIKKNGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPC--------APETKN--------NLMATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKHSKLMNSR*N 1885
            G+  +C P FIN+AQ A   VTS+CG+    D IC +W   S  +   C  CD+       +I  + D   Q + T W SG +    G++ +NI+I   K +EV+Y+ ++F  +LPDS+ +YK   NGK W+PW Y+S +C+K+F +  ++   IQ+     +SP CF    K    N+     +LPF+   GR     N  LIK W+++TD+ I+L    D                  G    N S +          +  +SD+++G R QCYGH+ K +I  +G  VCDC H T G DC +C +  +D  W+      P    C+RC CN H++ CKF++ +Y  +  K G  C  C H+T G  C+ C  GYYR+   P++H   C+KC CH  GS   + C+   G C CK GV G+ C++CK GY QT+S   PC        + +TK         ++  TE  C  C + R RIRF+KFC++  +    I+SKE+HG+  RF +++ ++WR+   +   ++    E    P+W+ + ++RC CPN+ LG +YL+L K K+ ++ ++ EL++D ++  L W   W RRL  F+ +  + KC+++  K+  SK+ ++R N
Sbjct:   37 GKDYYCTPPFINIAQRAKITVTSSCGEILPDD-ICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM---NDTLIK-WITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFS--CKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEKRKRIRFKKFCRRDSVFMGVIESKEVHGKMVRFELQIKEVWRVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKK--SKIKHNRIN 654          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000006806.1 (SMESG000006806.1)

HSP 1 Score: 337.035 bits (863), Expect = 1.842e-106
Identity = 224/652 (34.36%), Postives = 343/652 (52.61%), Query Frame = 2
Query:  128 SSCFSESGRAKFCEPDFINVAQNAT-FEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQL-PDSMVLYKRDKNGKTWLPWNYFXXXXXXXXXXXXXXPLHIQQRSFNKISPA-------CFSFKHS-VQNITSNIKVLPFNPMTGRTSLLPN-SRLIKEWVSVTDIMISLL----------TDG-------------------------------SKKRNKSPY----DHLSISDITIGARSQCYGHAKSLIKK--NGTTVCDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLM----ATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIWRIQQS---------LKSQVNLYESEY--SIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKHSK 1864
            S C+SE G+A  C P F N+ +N    E+TSTCGQ     RIC +      +N   C+K        + +I+ + D+++  + T W S  +       ++NIT +  KL+E+YYI +     L PDS+++ K   NG +W  W+YFS  C +SF ++   P+     S +KI+ +       C S   S + N+ ++  VL F   T   +   + S     W+S T+I I+L            DG                                KKRN        D  +++DI+IG R QCYGHA   +K   + T  CDC H TAG DC  C +   D+ W +   +  A   C+RC CN H+++C+F+EK+Y  S+ + G  C+ C H+T G +C+ C+ GY+R+ + P++H  VC KC CHP GS+    C+  N  C CK GV G  CNRC+KG+QQTKS  TPC      + +    A E RC  C   R RIRF+K+C+K  ++ +++QS+E HGE  RF ++V  ++RI  S         L S   +  +++  S +P+W++  D++CKCP+LQLG TYL++ K+    YL + EL++D+KS AL W   W RR+  F  +E QG C++++ KR++ +
Sbjct:   33 SLCYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQ-NKKQRICVD-----HINCHSCMK-------DTHSINYLTDQHLNNNITFWASDFVNHGD---NVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQ---PMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFT--TNNPNFFSHASDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAE--CKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVGCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYR 660          
The following BLAST results are available for this feature:
BLAST of Netrin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN11.742e-9732.71netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN32.739e-7028.20netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030][more]
NTN59.030e-5534.22netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208][more]
NTN42.902e-5025.93netrin 4 [Source:HGNC Symbol;Acc:HGNC:13658][more]
LAMC14.340e-5030.73laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-67.062e-9031.13Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
unc-67.062e-9031.13Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
lam-24.321e-4629.38Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
lam-31.809e-3627.79LAMinin related. See also lmb; Laminin alpha chain... [more]
lam-19.038e-3127.46LAMinin related. See also lmb [Source:UniProtKB/T... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NetA9.528e-6526.66gene:FBgn0015773 transcript:FBtr0073942[more]
NetA9.528e-6526.66gene:FBgn0015773 transcript:FBtr0346088[more]
NetA8.626e-6131.16gene:FBgn0015773 transcript:FBtr0308337[more]
LanB21.515e-4431.69gene:FBgn0267348 transcript:FBtr0345031[more]
LanB21.515e-4431.69gene:FBgn0267348 transcript:FBtr0076382[more]
back to top
BLAST of Netrin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ntn1a1.436e-9732.61netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn1a1.436e-9732.61netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn1b8.683e-9632.20netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168][more]
ntn1b8.683e-9632.20netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168][more]
ntn27.180e-9130.54netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
back to top
BLAST of Netrin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps161.227e-9230.99ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
ntn12.158e-9131.51netrin 1 [Source:NCBI gene;Acc:779839][more]
rps163.061e-8730.22ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
utp41.144e-4932.09UTP4 small subunit processome component [Source:Xe... [more]
utp41.153e-4932.09UTP4 small subunit processome component [Source:Xe... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ntn15.265e-9732.03netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn15.265e-9732.03netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn35.243e-7329.02netrin 3 [Source:MGI Symbol;Acc:MGI:1341188][more]
Ntn52.636e-5431.50netrin 5 [Source:MGI Symbol;Acc:MGI:2685330][more]
Lamc39.303e-5232.44laminin gamma 3 [Source:MGI Symbol;Acc:MGI:1344394... [more]
back to top
BLAST of Netrin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O95631|NET1_HUMAN8.364e-9732.71Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2[more]
sp|O09118|NET1_MOUSE3.683e-9632.03Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=... [more]
sp|Q90922|NET1_CHICK1.183e-9432.76Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=... [more]
sp|Q924Z9|NET1_RAT5.722e-9431.69Netrin-1 OS=Rattus norvegicus OX=10116 GN=Ntn1 PE=... [more]
sp|Q2HXW4|NET1_PIG1.336e-9332.14Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1[more]
back to top
BLAST of Netrin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6FZR00.000e+0100.00Netrin-5 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
Q49BF92.444e-10334.05Netrin 1 OS=Schmidtea mediterranea OX=79327 PE=2 S... [more]
A0A4S2M7W21.379e-10031.78Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5N5Q7595.718e-10032.08Uncharacterized protein OS=Pangasianodon hypophtha... [more]
W5UHM12.124e-9932.99Netrin-1 OS=Ictalurus punctatus OX=7998 GN=NTN1 PE... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN14.713e-10033.11netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN14.607e-9832.55netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b8.906e-9231.80netrin-1-like [Source:NCBI gene;Acc:111191060][more]
NTN11.206e-7528.77netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b3.776e-6927.81netrin-1-like [Source:NCBI gene;Acc:111191060][more]
back to top
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009682.13.829e-3730.45pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 ge... [more]
ENSPMAT00000008925.12.123e-2323.90pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 ... [more]
ENSPMAT00000004606.11.341e-1929.44pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 g... [more]
ENSPMAT00000004614.11.485e-1727.23pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 g... [more]
ENSPMAT00000007784.11.613e-1725.73pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Netrin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368364.594e-7628.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365233.531e-4129.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365012.247e-3829.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395025.420e-2826.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467608.382e-2626.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN16.447e-10132.99netrin-1 [Source:NCBI gene;Acc:101155405][more]
NTN13.767e-9832.20netrin-1 [Source:NCBI gene;Acc:101155405][more]
ntn1b1.869e-9231.52netrin-1 [Source:NCBI gene;Acc:101161061][more]
ntn1b2.090e-9231.52netrin-1 [Source:NCBI gene;Acc:101161061][more]
ntn21.210e-8830.02netrin-3 [Source:NCBI gene;Acc:101160359][more]
back to top
BLAST of Netrin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006779.10.000e+0100.00SMESG000006779.1[more]
SMESG000050895.11.021e-12435.48SMESG000050895.1[more]
SMESG000050895.16.372e-12135.15SMESG000050895.1[more]
SMESG000076695.12.346e-11733.81SMESG000076695.1[more]
SMESG000006806.11.842e-10634.36SMESG000006806.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000153 ID=SMED30000153|Name=Netrin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1945bp
TTACTTCATGAAAATGCAAGAAACTATTAAAAAATAAAATTACTTATTTT
AATCTTGAATGAATTCAACGAATATTTTGTTGATTTTATTGAATATCATT
TGGAAATTGACTATAATTAAAGGTTTTTCCTCGTGTTTTTCCGAGTCCGG
CAGAGCAAAATTCTGTGAACCTGACTTTATCAATGTTGCACAAAATGCTA
CATTTGAAGTTACAAGTACATGCGGTCAGAAAGGATCAACAGACAGAATT
TGCCGAAACTGGTACACATCTTCAGGCTTAAACGAAGGCAAATGTTTGAA
GTGCGATGATAGAATTCCGGAATTATCGAGAAATATATCTCTCGTATTCG
ATCGAAACATTCAAGGCCATGAAACGGTATGGGTTTCTGGACGTATTCCA
AAATTTAGTGGAATTCACTCCATTAATATCACGATTAATTTAAATAAGCT
ATATGAAGTATATTATATAATTGTCGAATTTGCCGGTCAGCTTCCAGATT
CTATGGTTTTATATAAAAGGGATAAAAATGGAAAAACTTGGTTACCTTGG
AATTATTTTTCGTCTTCTTGTAAGAAATCATTTAAAATGAAGAGAAGTAA
ACCTTTACACATTCAACAACGATCATTTAACAAGATAAGTCCTGCTTGCT
TTTCTTTCAAACACAGTGTCCAAAATATCACATCTAATATTAAAGTTCTT
CCATTTAATCCGATGACAGGCCGAACTTCTTTATTACCGAATTCCAGATT
AATTAAAGAATGGGTCAGTGTTACTGATATTATGATATCATTACTAACTG
ATGGCTCTAAAAAACGAAATAAGTCACCATATGATCACTTGTCAATATCT
GATATTACGATTGGTGCTAGAAGTCAGTGTTATGGTCATGCTAAGAGTTT
AATTAAAAAAAATGGCACCACAGTTTGTGACTGTCTACACAAGACAGCAG
GACCGGATTGTTCACAATGTCTTAAAACTCATAATGATCAACCCTGGAAA
ATAATTTTTCCCTCGGAACCAGCTGGGAATATTTGTGAAAGATGTTTTTG
TAATAACCATGCGGAAGAATGCAAATTCGATGAGAAAATTTATAAGAATT
CTAGCGGGAAGCATGGAAGTCGCTGTCTTCACTGTTTGCATCATACTACA
GGTCCTCATTGCAACTCATGTTCCCCTGGTTACTATAGGAACCGTGCATT
CCCTATAAATCATCCTCAAGTCTGCCAAAAATGCGGTTGCCATCCTTACG
GGTCTTTGCCCCAATCTTATTGTAATCCTGATAATGGGATCTGTCAATGC
AAAATTGGTGTCGAGGGTAAATTATGTAACAGGTGTAAAAAAGGCTACCA
ACAAACAAAATCTTCAAGCACACCATGTGCTCCAGAGACGAAAAATAATC
TCATGGCTACAGAAGAACGTTGCGGAAGTTGTGGGAAAAACCGTCCGAGA
ATTAGGTTTCGAAAATTCTGCAAAAAACACATAATGATTAAAATATCCAT
TCAATCAAAGGAGATCCACGGTGAATGGACTCGATTCGGAGTTCGGGTGT
TAAAGATCTGGAGAATCCAGCAATCATTAAAATCACAAGTCAACCTCTAT
GAATCTGAGTATTCAATATACCCAATATGGGTGGAAAATGCAGACATACG
CTGTAAATGCCCGAATCTTCAACTTGGTCACACCTACCTCCTTTTGACTA
AAATCAAATTAAAAAATTATCTCAATCAGCCAGAATTAATCGTTGATAGA
AAGAGCAGTGCACTTGATTGGAGTGACGACTGGATTCGAAGGCTGGACAT
GTTTAAAATGAGAGAGGAACAGGGTAAATGTGACCGCTATCAATATAAAC
GGAAACACTCGAAATTGATGAACTCTAGATGAAATGTTGAGTTGACCCTT
AGATGTCTAGATATTTCATTTTTACTTTTCATTCTCCATGTAAAA
back to top

protein sequence of SMED30000153-orf-1

>SMED30000153-orf-1 ID=SMED30000153-orf-1|Name=SMED30000153-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=608bp
MNSTNILLILLNIIWKLTIIKGFSSCFSESGRAKFCEPDFINVAQNATFE
VTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRN
IQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMV
LYKRDKNGKTWLPWNYFSSSCKKSFKMKRSKPLHIQQRSFNKISPACFSF
KHSVQNITSNIKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMISLLTDGS
KKRNKSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTVCDCLHKTAGPD
CSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSG
KHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSL
PQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETKNNLMA
TEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKI
WRIQQSLKSQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIK
LKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKH
SKLMNSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038684Laminin_N_sf
IPR002049Laminin_EGF
IPR008211Laminin_N
IPR018933Netrin_module_non-TIMP
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0001764neuron migration
GO:0006915apoptotic process
GO:0006930substrate-dependent cell migration, cell extension
GO:0007265Ras protein signal transduction
GO:0007409axonogenesis
GO:0007411axon guidance
GO:0008284positive regulation of cell proliferation
GO:0016337single organismal cell-cell adhesion
GO:0030334regulation of cell migration
GO:0030517negative regulation of axon extension
GO:0030879mammary gland development
GO:0032488Cdc42 protein signal transduction
GO:0033564anterior/posterior axon guidance
GO:0040023establishment of nucleus localization
GO:0042472inner ear morphogenesis
GO:0045773positive regulation of axon extension
GO:0060603mammary gland duct morphogenesis
GO:2000147positive regulation of cell motility
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
GO:0005604basement membrane
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002049Laminin EGF domainSMARTSM00180lamegf_3coord: 267..326
e-value: 3.7
score: 4.5
coord: 392..440
e-value: 9.0E-9
score: 45.2
coord: 329..389
e-value: 1.3E-5
score: 34.6
IPR002049Laminin EGF domainPFAMPF00053Laminin_EGFcoord: 274..313
e-value: 1.7E-4
score: 21.7
coord: 329..389
e-value: 1.2E-6
score: 28.5
coord: 392..440
e-value: 1.5E-7
score: 31.4
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 412..440
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 356..392
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 329..391
score: 12.311
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 392..442
score: 16.348
IPR008211Laminin, N-terminalSMARTSM00136LamNT_2coord: 30..270
e-value: 3.3E-17
score: 71.3
IPR008211Laminin, N-terminalPFAMPF00055Laminin_Ncoord: 36..269
e-value: 4.3E-40
score: 137.8
IPR008211Laminin, N-terminalPROSITEPS51117LAMININ_NTERcoord: 32..271
score: 26.396
IPR038684Laminin, N-terminal domain superfamilyGENE3DG3DSA:2.60.120.1490coord: 17..292
e-value: 3.0E-55
score: 189.4
IPR018933Netrin module, non-TIMP typePFAMPF01759NTRcoord: 469..583
e-value: 1.9E-12
score: 46.9
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 393..441
e-value: 1.0E-8
score: 37.0
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 293..392
e-value: 8.8E-18
score: 66.0
NoneNo IPR availablePANTHERPTHR10574:SF292NETRIN-3coord: 24..592
NoneNo IPR availablePANTHERPTHR10574NETRIN/LAMININ-RELATEDcoord: 24..592
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 392..440
e-value: 2.54751E-9
score: 51.201
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 328..378
e-value: 4.57002E-5
score: 39.2598
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.757
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 273..314
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 392..434
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 329..394
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldGENE3DG3DSA:2.40.50.120coord: 450..591
e-value: 5.0E-13
score: 51.0
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 451..582
IPR001134Netrin domainPROSITEPS50189NTRcoord: 455..591
score: 15.233