GLI-3

Overview
NameGLI-3 (ACZ64516.1)
Smed IDSMED30000146
Length (bp)1892
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GLI-3 (SMED30000146) t-SNE clustered cells

Violin plots show distribution of expression levels for GLI-3 (SMED30000146) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GLI-3 (SMED30000146) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GLI-3 (SMED30000146) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000146

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000146h1SMcG0021523 dd_Smed_v4_17566_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000146h1SMcG0021523 dd_Smed_v4_17566_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GLI-3 vs. Ensembl Human
Match: GLIS3 (GLIS family zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:28510])

HSP 1 Score: 251.906 bits (642), Expect = 3.626e-73
Identity = 113/160 (70.62%), Postives = 128/160 (80.00%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQ 1164
            K  C WIDC   +   + LV HIEK+H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC+KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H + + Q
Sbjct:  344 KHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGED-FTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCEKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQQ 502          
BLAST of GLI-3 vs. Ensembl Human
Match: GLIS1 (GLIS family zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:29525])

HSP 1 Score: 248.054 bits (632), Expect = 4.951e-73
Identity = 114/167 (68.26%), Postives = 130/167 (77.84%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH----QNFQSQLNASID 1182
            C W+DC  ++   + LV HIEK H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H    Q  + +L+A  D
Sbjct:  197 CRWVDCCAAYEQQEELVRHIEKSHIDQRKGED-FTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKEQQVRKKLHAGPD 362          
BLAST of GLI-3 vs. Ensembl Human
Match: GLIS3 (GLIS family zinc finger 3 [Source:HGNC Symbol;Acc:HGNC:28510])

HSP 1 Score: 252.677 bits (644), Expect = 1.769e-72
Identity = 113/160 (70.62%), Postives = 128/160 (80.00%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQ 1164
            K  C WIDC   +   + LV HIEK+H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC+KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H + + Q
Sbjct:  499 KHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGED-FTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCEKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQQ 657          
BLAST of GLI-3 vs. Ensembl Human
Match: GLIS1 (GLIS family zinc finger 1 [Source:HGNC Symbol;Acc:HGNC:29525])

HSP 1 Score: 248.825 bits (634), Expect = 7.063e-72
Identity = 114/167 (68.26%), Postives = 130/167 (77.84%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH----QNFQSQLNASID 1182
            C W+DC  ++   + LV HIEK H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H    Q  + +L+A  D
Sbjct:  372 CRWVDCCAAYEQQEELVRHIEKSHIDQRKGED-FTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKEQQVRKKLHAGPD 537          
BLAST of GLI-3 vs. Ensembl Human
Match: GLI2 (GLI family zinc finger 2 [Source:HGNC Symbol;Acc:HGNC:4318])

HSP 1 Score: 201.83 bits (512), Expect = 3.494e-54
Identity = 89/151 (58.94%), Postives = 111/151 (73.51%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            C W DC + +   + LV+HI   H+     K E+ C WQ C+R+ KPF A+Y L++HMR H+GEKP+KC + GC KA+SRLENLK H RSHTGE+PY C++ GC KAFSN+SDRAKHQ RTH + KPY C + GC KRYTDPSSLRKH K+
Sbjct:  439 CHWEDCTKEYDTQEQLVHHINNEHI--HGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKT 587          
BLAST of GLI-3 vs. Ensembl Celegans
Match: tra-1 (Sex-determining transformer protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P34708])

HSP 1 Score: 187.963 bits (476), Expect = 4.903e-50
Identity = 91/187 (48.66%), Postives = 118/187 (63.10%), Query Frame = 1
Query:  589 GDYYSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKD-EYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            G +  PQ N    SN    + +    D      L C W  C  SF   K+LV+H+++ HV     +   + C W+GC R  + F A Y L++H+R H+GEKPNKC+Y GC K +SRLENLK H R+HTGE+PY+C++  C KAFSN+SDRAKHQ RTH + KPY C +  C K YTDPSSLRKH K+
Sbjct:  181 GTFKRPQNNAANSSNSGNDSDMMGDHD------LTCRWKSCNSSFQTLKALVDHVQESHVQSTEQEHHAWRCEWEGCDRN-ETFKALYMLIVHVRRHTGEKPNKCEYPGCGKEYSRLENLKTHRRTHTGEKPYKCEFADCEKAFSNASDRAKHQNRTHSNLKPYSCQIPQCTKSYTDPSSLRKHIKA 360          
BLAST of GLI-3 vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 157.532 bits (397), Expect = 4.635e-43
Identity = 89/209 (42.58%), Postives = 118/209 (56.46%), Query Frame = 1
Query:  577 HSYSGDYYSPQINIHQFSNCNLSNQIY-TSIDSRPHPKLI-CFWID----CYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNF-QSQLNASID 1182
            H+YS  +Y     +  F    +   IY  ++ S    K + C W      C     +   L  HI   H+   +   ++ C W+GC R+ K F A+YKL+ HMRVH+GE+P  C    C+K F+R ENLKIH+R H+GE+P+QC + GC K F+NSSDR KH   H   KPY C    CGK YT PSSLRKHTK H+N  +SQL+   D
Sbjct:   44 HAYSPSFYMNMSQVPHFLPAQVDPFIYPNTLGSYGGDKQVQCLWETNGQVCMHVCQNSGELSTHISSNHITHDS---KFVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHENEKKSQLSPEHD 247          
BLAST of GLI-3 vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 156.762 bits (395), Expect = 6.619e-43
Identity = 89/209 (42.58%), Postives = 118/209 (56.46%), Query Frame = 1
Query:  577 HSYSGDYYSPQINIHQFSNCNLSNQIY-TSIDSRPHPKLI-CFWID----CYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNF-QSQLNASID 1182
            H+YS  +Y     +  F    +   IY  ++ S    K + C W      C     +   L  HI   H+   +   ++ C W+GC R+ K F A+YKL+ HMRVH+GE+P  C    C+K F+R ENLKIH+R H+GE+P+QC + GC K F+NSSDR KH   H   KPY C    CGK YT PSSLRKHTK H+N  +SQL+   D
Sbjct:   31 HAYSPSFYMNMSQVPHFLPAQVDPFIYPNTLGSYGGDKQVQCLWETNGQVCMHVCQNSGELSTHISSNHITHDS---KFVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHENEKKSQLSPEHD 234          
BLAST of GLI-3 vs. Ensembl Celegans
Match: ref-2 (REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:Q7JNM3])

HSP 1 Score: 156.762 bits (395), Expect = 6.619e-43
Identity = 89/209 (42.58%), Postives = 118/209 (56.46%), Query Frame = 1
Query:  577 HSYSGDYYSPQINIHQFSNCNLSNQIY-TSIDSRPHPKLI-CFWID----CYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNF-QSQLNASID 1182
            H+YS  +Y     +  F    +   IY  ++ S    K + C W      C     +   L  HI   H+   +   ++ C W+GC R+ K F A+YKL+ HMRVH+GE+P  C    C+K F+R ENLKIH+R H+GE+P+QC + GC K F+NSSDR KH   H   KPY C    CGK YT PSSLRKHTK H+N  +SQL+   D
Sbjct:   31 HAYSPSFYMNMSQVPHFLPAQVDPFIYPNTLGSYGGDKQVQCLWETNGQVCMHVCQNSGELSTHISSNHITHDS---KFVCLWKGCDREFKMFKAKYKLVNHMRVHTGERPFLCDV--CNKVFARSENLKIHKRIHSGEKPFQCTHNGCTKLFANSSDRKKHMHVHSSHKPYSCMYPDCGKTYTHPSSLRKHTKVHENEKKSQLSPEHD 234          
BLAST of GLI-3 vs. Ensembl Celegans
Match: ztf-14 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:Q93902])

HSP 1 Score: 130.954 bits (328), Expect = 3.229e-32
Identity = 67/151 (44.37%), Postives = 85/151 (56.29%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKH-QRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            C W  C  +  D  +       +HVD    K+E  C W+ C R    F   Y+   H R H+ +K   C+   C K + RLENLK H R+HTGE+PY C    C K+F+N+SDR+KH +RTH + KPYCC    C   YTDPSSLRKH KS
Sbjct:  233 CLWDGCTLTLDDRATFF-----VHVDNHIQKNEVNCKWRYCERS---FKQTYEFTAHKRTHTKQKLYCCEV--CPKRYGRLENLKTHRRTHTGEKPYHCNVPNCNKSFTNASDRSKHSKRTHSNEKPYCCDFGSCACAYTDPSSLRKHVKS 373          

HSP 2 Score: 49.6766 bits (117), Expect = 5.994e-6
Identity = 25/88 (28.41%), Postives = 41/88 (46.59%), Query Frame = 1
Query:  883 EKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            E   +C + GC           +H  +H  +    C++  C ++F  + +   H+RTH   K YCC V  C KRY    +L+ H ++H
Sbjct:  228 EDVRQCLWDGCTLTLDDRATFFVHVDNHIQKNEVNCKWRYCERSFKQTYEFTAHKRTHTKQKLYCCEV--CPKRYGRLENLKTHRRTH 313          
BLAST of GLI-3 vs. Ensembl Fly
Match: lmd (gene:FBgn0039039 transcript:FBtr0084364)

HSP 1 Score: 244.973 bits (624), Expect = 2.430e-70
Identity = 115/162 (70.99%), Postives = 128/162 (79.01%), Query Frame = 1
Query:  688 LICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH--QNFQSQL 1167
            LIC W  C + F   ++ V HIEK HVD R  +D ++CFW  C R+ KPFNARYKLLIHMRVHSGEKPNKC + GC+KAFSRLENLKIH+RSHTGERPY CQY GC KAFSNSSDRAKHQRTHYDTKPY C + GC KRYTDPSSLRKH K+H  +N   QL
Sbjct:  435 LICRWTGCDEEFPHQQAFVEHIEKCHVDVRKGED-FSCFWLDCPRRYKPFNARYKLLIHMRVHSGEKPNKCPFPGCNKAFSRLENLKIHQRSHTGERPYGCQYKGCLKAFSNSSDRAKHQRTHYDTKPYACQLPGCTKRYTDPSSLRKHVKNHALRNANGQL 595          
BLAST of GLI-3 vs. Ensembl Fly
Match: ci (gene:FBgn0004859 transcript:FBtr0306168)

HSP 1 Score: 193.741 bits (491), Expect = 8.264e-52
Identity = 90/151 (59.60%), Postives = 106/151 (70.20%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            C W  C   F     LV HI   H+ Q N K  + C W+ C+R  KPF A+Y L++HMR H+GEKP+KC + GC KA+SRLENLK H RSHTGE+PY C+Y GC KAFSN+SDRAKHQ RTH + KPY C   GC KRYTDPSSLRKH K+
Sbjct:  335 CHWRSCRIEFITQDELVKHINNDHI-QTN-KKAFVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKT 483          
BLAST of GLI-3 vs. Ensembl Fly
Match: ci (gene:FBgn0004859 transcript:FBtr0089178)

HSP 1 Score: 193.741 bits (491), Expect = 1.016e-51
Identity = 90/151 (59.60%), Postives = 106/151 (70.20%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            C W  C   F     LV HI   H+ Q N K  + C W+ C+R  KPF A+Y L++HMR H+GEKP+KC + GC KA+SRLENLK H RSHTGE+PY C+Y GC KAFSN+SDRAKHQ RTH + KPY C   GC KRYTDPSSLRKH K+
Sbjct:  453 CHWRSCRIEFITQDELVKHINNDHI-QTN-KKAFVCRWEDCTRGEKPFKAQYMLVVHMRRHTGEKPHKCTFEGCFKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKHQNRTHSNEKPYICKAPGCTKRYTDPSSLRKHVKT 601          
BLAST of GLI-3 vs. Ensembl Fly
Match: sug (gene:FBgn0033782 transcript:FBtr0331985)

HSP 1 Score: 178.718 bits (452), Expect = 1.410e-50
Identity = 83/152 (54.61%), Postives = 103/152 (67.76%), Query Frame = 1
Query:  688 LICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
             +C W DC + F    +L  H+ + H         Y C W+GC R  + FNARYK+L+H R H+ EKP++C    C+K+FSR ENLKIH RSH+GE+PY+C + GC KA+SNSSDR KH RTH   KPY C VAGC KRYTDPSSLRKH K+
Sbjct:   66 FVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHL--CEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKT 215          
BLAST of GLI-3 vs. Ensembl Fly
Match: sug (gene:FBgn0033782 transcript:FBtr0087789)

HSP 1 Score: 179.104 bits (453), Expect = 3.899e-50
Identity = 83/155 (53.55%), Postives = 105/155 (67.74%), Query Frame = 1
Query:  688 LICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQN 1152
             +C W DC + F    +L  H+ + H         Y C W+GC R  + FNARYK+L+H R H+ EKP++C    C+K+FSR ENLKIH RSH+GE+PY+C + GC KA+SNSSDR KH RTH   KPY C VAGC KRYTDPSSLRKH K+ ++
Sbjct:  128 FVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHL--CEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKH 280          
BLAST of GLI-3 vs. Ensembl Zebrafish
Match: glis1b (GLIS family zinc finger 1b [Source:ZFIN;Acc:ZDB-GENE-081105-172])

HSP 1 Score: 245.358 bits (625), Expect = 5.956e-77
Identity = 113/162 (69.75%), Postives = 129/162 (79.63%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLN 1170
            K +C WIDC  ++   + LV HIEK+H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC+KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K H   + Q+ 
Sbjct:   64 KQVCRWIDCSAAYEQQEELVRHIEKVHIDQRKGED-FTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCNKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKIHSAKEQQVR 224          
BLAST of GLI-3 vs. Ensembl Zebrafish
Match: glis1b (GLIS family zinc finger 1b [Source:ZFIN;Acc:ZDB-GENE-081105-172])

HSP 1 Score: 251.136 bits (640), Expect = 2.935e-73
Identity = 113/165 (68.48%), Postives = 130/165 (78.79%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASI 1179
            K +C WIDC  ++   + LV HIEK+H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC+KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K H   + Q+   +
Sbjct:  482 KQVCRWIDCSAAYEQQEELVRHIEKVHIDQRKGED-FTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCNKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKIHSAKEQQVRRKL 645          
BLAST of GLI-3 vs. Ensembl Zebrafish
Match: glis1a (GLIS family zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-070912-8])

HSP 1 Score: 242.276 bits (617), Expect = 4.605e-72
Identity = 110/151 (72.85%), Postives = 124/151 (82.12%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            C W+DC  ++   + LV HIEK+H+DQR   +E+TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC+KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K H
Sbjct:  129 CKWMDCRATYGQREELVRHIEKIHIDQRK-GEEFTCFWAGCVRRHKPFNARYKLLIHMRVHSGEKPNKCMFEGCNKAFSRLENLKIHLRSHTGEKPYICQHPGCLKAFSNSSDRAKHQRTHLDTKPYACQLPGCTKRYTDPSSLRKHVKVH 278          
BLAST of GLI-3 vs. Ensembl Zebrafish
Match: glis3 (GLIS family zinc finger 3 [Source:ZFIN;Acc:ZDB-GENE-070112-2232])

HSP 1 Score: 248.054 bits (632), Expect = 7.750e-72
Identity = 112/151 (74.17%), Postives = 123/151 (81.46%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            C W+ C   +    +LV HIEK+HVDQR  +D +TCFW GC+RK KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY C + GC KAFSNSSDRAKHQRTH DTKPY C + GCGKRYTDPSSLRKH KSH
Sbjct:  386 CCWLHCGAIYSHRDALVKHIEKIHVDQRKGED-FTCFWAGCARKHKPFNARYKLLIHMRVHSGEKPNKCSFEGCQKAFSRLENLKIHLRSHTGEKPYVCPHPGCLKAFSNSSDRAKHQRTHVDTKPYACQIQGCGKRYTDPSSLRKHVKSH 535          
BLAST of GLI-3 vs. Ensembl Zebrafish
Match: glis3 (GLIS family zinc finger 3 [Source:ZFIN;Acc:ZDB-GENE-070112-2232])

HSP 1 Score: 248.054 bits (632), Expect = 8.797e-72
Identity = 112/151 (74.17%), Postives = 123/151 (81.46%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            C W+ C   +    +LV HIEK+HVDQR  +D +TCFW GC+RK KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY C + GC KAFSNSSDRAKHQRTH DTKPY C + GCGKRYTDPSSLRKH KSH
Sbjct:  402 CCWLHCGAIYSHRDALVKHIEKIHVDQRKGED-FTCFWAGCARKHKPFNARYKLLIHMRVHSGEKPNKCSFEGCQKAFSRLENLKIHLRSHTGEKPYVCPHPGCLKAFSNSSDRAKHQRTHVDTKPYACQIQGCGKRYTDPSSLRKHVKSH 551          
BLAST of GLI-3 vs. Ensembl Xenopus
Match: GLIS3 (GLIS family zinc finger 3 [Source:NCBI gene;Acc:100496527])

HSP 1 Score: 252.292 bits (643), Expect = 1.361e-73
Identity = 123/213 (57.75%), Postives = 146/213 (68.54%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSRRR 1323
            K  C WIDC   +   + LV HIEK+H+DQR  +D + CFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H +   Q    +        +S +  D +I++D   + PL+  +     PQ P+  S  R
Sbjct:  342 KHCCRWIDCSSMYEQQEELVRHIEKVHIDQRKGED-FACFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCKKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSSKDQQARKKL--------RSRTDLDQEILSDCLTIQPLQPAT----SPQDPSESSMGR 541          
BLAST of GLI-3 vs. Ensembl Xenopus
Match: GLIS3 (GLIS family zinc finger 3 [Source:NCBI gene;Acc:100496527])

HSP 1 Score: 252.292 bits (643), Expect = 2.262e-73
Identity = 123/213 (57.75%), Postives = 146/213 (68.54%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSRRR 1323
            K  C WIDC   +   + LV HIEK+H+DQR  +D + CFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H +   Q    +        +S +  D +I++D   + PL+  +     PQ P+  S  R
Sbjct:  342 KHCCRWIDCSSMYEQQEELVRHIEKVHIDQRKGED-FACFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCKKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSSKDQQARKKL--------RSRTDLDQEILSDCLTIQPLQPAT----SPQDPSESSMGR 541          
BLAST of GLI-3 vs. Ensembl Xenopus
Match: GLIS3 (GLIS family zinc finger 3 [Source:NCBI gene;Acc:100496527])

HSP 1 Score: 252.677 bits (644), Expect = 1.193e-72
Identity = 123/213 (57.75%), Postives = 146/213 (68.54%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSRRR 1323
            K  C WIDC   +   + LV HIEK+H+DQR  +D + CFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H +   Q    +        +S +  D +I++D   + PL+  +     PQ P+  S  R
Sbjct:  490 KHCCRWIDCSSMYEQQEELVRHIEKVHIDQRKGED-FACFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCKKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSSKDQQARKKL--------RSRTDLDQEILSDCLTIQPLQPAT----SPQDPSESSMGR 689          
BLAST of GLI-3 vs. Ensembl Xenopus
Match: GLI1 (GLI family zinc finger 1 [Source:NCBI gene;Acc:100494064])

HSP 1 Score: 203.371 bits (516), Expect = 8.530e-55
Identity = 92/164 (56.10%), Postives = 117/164 (71.34%), Query Frame = 1
Query:  667 DSRPHPKLI----CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            D +  P+ +    C W  C + F   + LV+HI   H+     K E+ C WQ CSR+L+PF A+Y L++HMR H+GEKP+KC + GC+KA+SRLENLK H RSHTGE+PY C++ GC KAFSN+SDRAKHQ RTH + KPY C + GC KRYTDPSSLRKH K+
Sbjct:  143 DGKHEPETVYETNCHWESCTKEFDTQEHLVHHINNEHIHGE--KKEFVCHWQDCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKT 304          
BLAST of GLI-3 vs. Ensembl Xenopus
Match: GLI1 (GLI family zinc finger 1 [Source:NCBI gene;Acc:100494064])

HSP 1 Score: 202.986 bits (515), Expect = 1.313e-54
Identity = 92/164 (56.10%), Postives = 117/164 (71.34%), Query Frame = 1
Query:  667 DSRPHPKLI----CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            D +  P+ +    C W  C + F   + LV+HI   H+     K E+ C WQ CSR+L+PF A+Y L++HMR H+GEKP+KC + GC+KA+SRLENLK H RSHTGE+PY C++ GC KAFSN+SDRAKHQ RTH + KPY C + GC KRYTDPSSLRKH K+
Sbjct:  239 DGKHEPETVYETNCHWESCTKEFDTQEHLVHHINNEHIHGE--KKEFVCHWQDCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKT 400          
BLAST of GLI-3 vs. Ensembl Mouse
Match: Glis1 (GLIS family zinc finger 1 [Source:MGI Symbol;Acc:MGI:2386723])

HSP 1 Score: 249.21 bits (635), Expect = 8.228e-74
Identity = 114/169 (67.46%), Postives = 130/169 (76.92%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH----QNFQSQLNASIDPN 1188
            C W+DC  ++   + LV HIEK H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H    Q  + +L+   DP 
Sbjct:  180 CRWVDCCAAYEQQEELVRHIEKSHIDQRKGED-FTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKEQQVRKKLHTGADPE 347          
BLAST of GLI-3 vs. Ensembl Mouse
Match: Glis3 (GLIS family zinc finger 3 [Source:MGI Symbol;Acc:MGI:2444289])

HSP 1 Score: 250.751 bits (639), Expect = 1.032e-73
Identity = 113/160 (70.62%), Postives = 127/160 (79.38%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQ 1164
            K  C WIDC   +   + LV HIEK+H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H + + Q
Sbjct:  499 KHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGED-FTCFWTGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCKKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSREQQ 657          
BLAST of GLI-3 vs. Ensembl Mouse
Match: Glis1 (GLIS family zinc finger 1 [Source:MGI Symbol;Acc:MGI:2386723])

HSP 1 Score: 249.98 bits (637), Expect = 1.501e-72
Identity = 114/169 (67.46%), Postives = 130/169 (76.92%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH----QNFQSQLNASIDPN 1188
            C W+DC  ++   + LV HIEK H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H    Q  + +L+   DP 
Sbjct:  368 CRWVDCCAAYEQQEELVRHIEKSHIDQRKGED-FTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKEQQVRKKLHTGADPE 535          
BLAST of GLI-3 vs. Ensembl Mouse
Match: Glis3 (GLIS family zinc finger 3 [Source:MGI Symbol;Acc:MGI:2444289])

HSP 1 Score: 251.521 bits (641), Expect = 2.698e-72
Identity = 113/160 (70.62%), Postives = 127/160 (79.38%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQ 1164
            K  C WIDC   +   + LV HIEK+H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H + + Q
Sbjct:  499 KHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGED-FTCFWTGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCKKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSREQQ 657          
BLAST of GLI-3 vs. Ensembl Mouse
Match: Gli2 (GLI-Kruppel family member GLI2 [Source:MGI Symbol;Acc:MGI:95728])

HSP 1 Score: 202.986 bits (515), Expect = 1.202e-54
Identity = 89/151 (58.94%), Postives = 111/151 (73.51%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            C W DC + +   + LV+HI   H+     K E+ C WQ C+R+ KPF A+Y L++HMR H+GEKP+KC + GC KA+SRLENLK H RSHTGE+PY C++ GC KAFSN+SDRAKHQ RTH + KPY C + GC KRYTDPSSLRKH K+
Sbjct:  419 CHWADCTKEYDTQEQLVHHINNEHI--HGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKT 567          
BLAST of GLI-3 vs. UniProt/SwissProt
Match: sp|Q8NEA6|GLIS3_HUMAN (Zinc finger protein GLIS3 OS=Homo sapiens OX=9606 GN=GLIS3 PE=1 SV=5)

HSP 1 Score: 251.906 bits (642), Expect = 1.741e-72
Identity = 113/160 (70.62%), Postives = 128/160 (80.00%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQ 1164
            K  C WIDC   +   + LV HIEK+H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC+KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H + + Q
Sbjct:  344 KHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGED-FTCFWAGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCEKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSKEQQ 502          
BLAST of GLI-3 vs. UniProt/SwissProt
Match: sp|Q8NBF1|GLIS1_HUMAN (Zinc finger protein GLIS1 OS=Homo sapiens OX=9606 GN=GLIS1 PE=1 SV=2)

HSP 1 Score: 248.054 bits (632), Expect = 2.378e-72
Identity = 114/167 (68.26%), Postives = 130/167 (77.84%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH----QNFQSQLNASID 1182
            C W+DC  ++   + LV HIEK H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H    Q  + +L+A  D
Sbjct:  197 CRWVDCCAAYEQQEELVRHIEKSHIDQRKGED-FTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKEQQVRKKLHAGPD 362          
BLAST of GLI-3 vs. UniProt/SwissProt
Match: sp|Q6XP49|GLIS3_MOUSE (Zinc finger protein GLIS3 OS=Mus musculus OX=10090 GN=Glis3 PE=1 SV=2)

HSP 1 Score: 251.136 bits (640), Expect = 3.631e-72
Identity = 113/160 (70.62%), Postives = 127/160 (79.38%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQ 1164
            K  C WIDC   +   + LV HIEK+H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H + + Q
Sbjct:  344 KHCCRWIDCSALYDQQEELVRHIEKVHIDQRKGED-FTCFWTGCPRRYKPFNARYKLLIHMRVHSGEKPNKCTFEGCKKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCTKRYTDPSSLRKHVKAHSSREQQ 502          
BLAST of GLI-3 vs. UniProt/SwissProt
Match: sp|Q8K1M4|GLIS1_MOUSE (Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2)

HSP 1 Score: 249.98 bits (637), Expect = 1.050e-71
Identity = 114/169 (67.46%), Postives = 130/169 (76.92%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH----QNFQSQLNASIDPN 1188
            C W+DC  ++   + LV HIEK H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH K+H    Q  + +L+   DP 
Sbjct:  368 CRWVDCCAAYEQQEELVRHIEKSHIDQRKGED-FTCFWAGCVRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQIPGCSKRYTDPSSLRKHVKAHSAKEQQVRKKLHTGADPE 535          
BLAST of GLI-3 vs. UniProt/SwissProt
Match: sp|Q91690|GLI1_XENLA (Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis OX=8355 GN=gli1 PE=2 SV=2)

HSP 1 Score: 202.986 bits (515), Expect = 7.735e-54
Identity = 92/164 (56.10%), Postives = 117/164 (71.34%), Query Frame = 1
Query:  667 DSRPHPKLI----CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            D +  P+ +    C W  C + F   + LV+HI   H+     K E+ C WQ CSR+L+PF A+Y L++HMR H+GEKP+KC + GC+KA+SRLENLK H RSHTGE+PY C++ GC KAFSN+SDRAKHQ RTH + KPY C + GC KRYTDPSSLRKH K+
Sbjct:  239 DGKHEPETVYETNCHWESCTKEFDTQEHLVHHINNEHIHGE--KKEFVCHWQDCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKT 400          
BLAST of GLI-3 vs. TrEMBL
Match: D2ILS5 (GLI-3 OS=Schmidtea mediterranea OX=79327 GN=gli-3 PE=2 SV=1)

HSP 1 Score: 1031.17 bits (2665), Expect = 0.000e+0
Identity = 496/499 (99.40%), Postives = 497/499 (99.60%), Query Frame = 1
Query:  283 MASILLNSSTSNRSVDPDYFAKSSISTSPPAKIPRQSLGHCFTGEQQKLKSSALANNLYVTQIKDGNKISPLSINSTYSNDSGIHLNRCKDALTNDFVHSYSGDYYSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSRRRQNKLTKPADFPLLNIQNNITNKVNGCVNFHNQYHMDQNGHYPQLESFNVYNVIPENRNVFKQTSMQTSPINPACQYKQTISSNPYYLPQNQTSISIPFQNPQPVQIQNDKTYSCNYAIDNNQLYAVSLSGNSIMENGYDNQTSQISSWMQNL 1779
            MASILLNSSTSNRSVDPDYFAKSS+STSPP KIPRQSLGHCFTGEQQKLKSSALANNLYVTQIKDGNKISPLSINSTYSNDSGIHLNRCKDALTNDFVHSYSGDYYSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVS RRQNKLTKPADFPLLNIQNNITNKVNGCVNFHNQYHMDQNGHYPQLESFNVYNVIPENRNVFKQTSMQTSPINPACQYKQTISSNPYYLPQNQTSISIPFQNPQPVQIQNDKTYSCNYAIDNNQLYAVSLSGNSIMENGYDNQTSQISSWMQNL
Sbjct:    1 MASILLNSSTSNRSVDPDYFAKSSVSTSPPGKIPRQSLGHCFTGEQQKLKSSALANNLYVTQIKDGNKISPLSINSTYSNDSGIHLNRCKDALTNDFVHSYSGDYYSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSGRRQNKLTKPADFPLLNIQNNITNKVNGCVNFHNQYHMDQNGHYPQLESFNVYNVIPENRNVFKQTSMQTSPINPACQYKQTISSNPYYLPQNQTSISIPFQNPQPVQIQNDKTYSCNYAIDNNQLYAVSLSGNSIMENGYDNQTSQISSWMQNL 499          
BLAST of GLI-3 vs. TrEMBL
Match: X1YV67 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 7.449e-77
Identity = 115/152 (75.66%), Postives = 129/152 (84.87%), Query Frame = 1
Query:  691 ICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            +C W+DC + F +   LV H+EK+H+DQR   DE+TCFWQGC R+ KPFNARYKLLIHMRVHSGEKPNKC ++GC+KAFSRLENLKIH RSHTGERPYQCQ+ GC KAFSNSSDRAKHQRTH DTKPY C V GC KRYTDPSSLRKH K+H
Sbjct:   12 VCKWVDCQEVFAEQDELVRHLEKLHIDQRR-GDEFTCFWQGCQRRHKPFNARYKLLIHMRVHSGEKPNKCTFAGCNKAFSRLENLKIHMRSHTGERPYQCQHPGCLKAFSNSSDRAKHQRTHIDTKPYACTVPGCIKRYTDPSSLRKHQKNH 162          
BLAST of GLI-3 vs. TrEMBL
Match: A0A2J7PWE6 (Uncharacterized protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G04055 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 6.600e-76
Identity = 117/153 (76.47%), Postives = 128/153 (83.66%), Query Frame = 1
Query:  688 LICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            L C WIDCY  F D +SLV+HIEK HV+ R  +D ++CFWQGC R+ +PFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH+RSHTGERPY CQY GC KAFSNSSDRAKHQRTH DTKPY C V GC KRYTDPSSLRKH K+H
Sbjct:  109 LECRWIDCYAVFPDQESLVHHIEKSHVELRKAED-FSCFWQGCPRRSRPFNARYKLLIHMRVHSGEKPNKCPFEGCTKAFSRLENLKIHQRSHTGERPYSCQYSGCTKAFSNSSDRAKHQRTHVDTKPYACQVEGCSKRYTDPSSLRKHVKNH 260          
BLAST of GLI-3 vs. TrEMBL
Match: A0A4W5Q2D9 (GLIS family zinc finger 3 OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.883e-75
Identity = 117/166 (70.48%), Postives = 132/166 (79.52%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNL 1191
            C W+DC   +   + LV HIEK+HVDQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH+RSHTGE+PYQCQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GCGKRYTDPSSLRKH KSH + + QL   +   L
Sbjct:  252 CRWVDCSAVYDQKEELVRHIEKLHVDQRKGED-FTCFWAGCPRRFKPFNARYKLLIHMRVHSGEKPNKCTFEGCQKAFSRLENLKIHQRSHTGEKPYQCQHPGCHKAFSNSSDRAKHQRTHLDTKPYACQIPGCGKRYTDPSSLRKHVKSHSSKERQLRKKVSMEL 416          
BLAST of GLI-3 vs. TrEMBL
Match: A0A4Y2HFV3 (Zinc finger protein GLIS3 OS=Araneus ventricosus OX=182803 GN=Glis3 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 7.313e-75
Identity = 118/161 (73.29%), Postives = 130/161 (80.75%), Query Frame = 1
Query:  688 LICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLN 1170
             +C+W+DC   F    SLV HIEK HVDQR  +++++C W GC RKL+PFNARYKLLIHMRVHSGEKPNKC + GCDKAFSRLENLKIH RSHTGERPY CQYIGCPKAFSNSSDRAKHQRTH D+KPY C   GC KRYTDPSSLRKH K+H     QLN
Sbjct:  345 FVCYWVDCKTVFQSQSSLVRHIEKFHVDQRK-REDFSCLWVGCPRKLRPFNARYKLLIHMRVHSGEKPNKCMFLGCDKAFSRLENLKIHFRSHTGERPYHCQYIGCPKAFSNSSDRAKHQRTHQDSKPYYCQEPGCNKRYTDPSSLRKHVKNHVLRMEQLN 504          
BLAST of GLI-3 vs. Ensembl Cavefish
Match: glis3 (GLIS family zinc finger 3 [Source:ZFIN;Acc:ZDB-GENE-070112-2232])

HSP 1 Score: 244.588 bits (623), Expect = 5.031e-73
Identity = 111/157 (70.70%), Postives = 126/157 (80.25%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQ 1164
            C W+DC  ++   + LV HIEK+H+DQR  +D +TC+W GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH KSH   + Q
Sbjct:  306 CRWLDCNATYSHKEELVKHIEKLHMDQRKGED-FTCYWAGCPRRHKPFNARYKLLIHMRVHSGEKPNKCTFEGCQKAFSRLENLKIHLRSHTGEKPYTCQHPGCQKAFSNSSDRAKHQRTHIDTKPYACQIQGCLKRYTDPSSLRKHVKSHSTKEQQ 461          
BLAST of GLI-3 vs. Ensembl Cavefish
Match: glis3 (GLIS family zinc finger 3 [Source:ZFIN;Acc:ZDB-GENE-070112-2232])

HSP 1 Score: 246.514 bits (628), Expect = 2.760e-72
Identity = 111/157 (70.70%), Postives = 126/157 (80.25%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQ 1164
            C W+DC  ++   + LV HIEK+H+DQR  +D +TC+W GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C + GC KRYTDPSSLRKH KSH   + Q
Sbjct:  451 CRWLDCNATYSHKEELVKHIEKLHMDQRKGED-FTCYWAGCPRRHKPFNARYKLLIHMRVHSGEKPNKCTFEGCQKAFSRLENLKIHLRSHTGEKPYTCQHPGCQKAFSNSSDRAKHQRTHIDTKPYACQIQGCLKRYTDPSSLRKHVKSHSTKEQQ 606          
BLAST of GLI-3 vs. Ensembl Cavefish
Match: glis2a (GLIS family zinc finger 2a [Source:ZFIN;Acc:ZDB-GENE-130102-1])

HSP 1 Score: 197.593 bits (501), Expect = 2.885e-56
Identity = 92/166 (55.42%), Postives = 118/166 (71.08%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASID 1182
            +L C W+ C+  F   + LV+H+ + HV        Y C W+GC+RK + FNARYK+LIH+R H+ EKP++C    C K+FSRLENLKIH RSHTGE+PY C Y GC K +SNSSDR KH RTHY+ KPYCC + GC KRYTDPSSLRKH K+H +  +Q + S++
Sbjct:  152 QLACRWLKCHLLFECLQDLVDHVTEFHVKPER-STGYCCHWEGCARKGRGFNARYKMLIHIRTHTNEKPHQCAI--CSKSFSRLENLKIHTRSHTGEKPYVCPYEGCGKRYSNSSDRFKHTRTHYEDKPYCCKMVGCHKRYTDPSSLRKHIKAHGHSVAQESRSME 314          
BLAST of GLI-3 vs. Ensembl Cavefish
Match: glis2b (GLIS family zinc finger 2 [Source:NCBI gene;Acc:103031738])

HSP 1 Score: 195.282 bits (495), Expect = 6.357e-55
Identity = 99/193 (51.30%), Postives = 125/193 (64.77%), Query Frame = 1
Query:  610 INIHQFSNCNLSNQIYT--SIDSRPHP------KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQ 1164
            + I   S  +L + +++  S D R  P      +L C W  C+  F   + LV+H+   HV        Y C W+GC+RK + FNARYK+LIH+R H+ EKP++C    C+K+FSRLENLKIH RSHTGE+PY C Y GC K +SNSSDR KH RTHY  KPY C + GC KRYTDPSSLRKH K+H +F SQ
Sbjct:  124 VPIGGGSGLHLPSSMFSGQSKDKRASPDLSADEQLYCRWRKCHLLFDSLQDLVDHVNDFHVKPEK-DSGYCCHWEGCARKGRGFNARYKMLIHIRTHTNEKPHRCPT--CNKSFSRLENLKIHNRSHTGEKPYICPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMVGCLKRYTDPSSLRKHIKAHGHFVSQ 313          
BLAST of GLI-3 vs. Ensembl Cavefish
Match: gli1 (GLI family zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE-030321-1])

HSP 1 Score: 201.06 bits (510), Expect = 3.447e-54
Identity = 91/164 (55.49%), Postives = 117/164 (71.34%), Query Frame = 1
Query:  667 DSRPHPKLI----CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            + +P P+ I    C W  C + F   + LV+HI   H+     K E+ C W+ CSR+ +PF A+Y L++HMR H+GEKP+KC + GC+KA+SRLENLK H RSHTGE+PY C++ GC KAFSN+SDRAKHQ RTH + KPY C + GC KRYTDPSSLRKH K+
Sbjct:  312 EEKPEPEAIYETNCHWESCSKEFDTQEQLVHHINNEHI--HGEKKEFVCHWKDCSREQRPFKAQYMLVVHMRRHTGEKPHKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKT 473          
BLAST of GLI-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008614.1 (pep scaffold:Pmarinus_7.0:GL479003:10005:19084:-1 gene:ENSPMAG00000007806.1 transcript:ENSPMAT00000008614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.481 bits (441), Expect = 3.434e-52
Identity = 81/130 (62.31%), Postives = 102/130 (78.46%), Query Frame = 1
Query:  763 HVDQRNI---KDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTK 1140
            H++  +I   + E+ C W+ CSR+ KPF A+Y L++HMR H+GEKP+KC + GC KA+SRLENLK H RSHTGE+PY C++ GC KAFSN+SDRAKHQ RTH + KPY C ++GC KRYTDPSSLRKH K
Sbjct:    1 HINNEHIHGERKEFVCRWRDCSREKKPFKAQYMLVVHMRRHTGEKPHKCTFEGCAKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKISGCTKRYTDPSSLRKHVK 130          
BLAST of GLI-3 vs. Ensembl Sea Lamprey
Match: glis2b (GLIS family zinc finger 2b [Source:ZFIN;Acc:ZDB-GENE-091204-120])

HSP 1 Score: 174.481 bits (441), Expect = 3.122e-51
Identity = 86/146 (58.90%), Postives = 104/146 (71.23%), Query Frame = 1
Query:  709 CYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            C Q F   + LV H+   HV + + +  Y C W+GC+R  + FNARYK+LIH+R H+ EKP++C    C+K+FSRLENLKIH RSHTGE+PY C Y GC K +SNSSDR KH RTHY  KPY C   GC KRYTDPSSLRKH K+H
Sbjct:    3 CQQVFDSQQELVEHVHDAHV-RADREVGYCCHWEGCARMGRGFNARYKMLIHVRTHTNEKPHQCPI--CNKSFSRLENLKIHGRSHTGEKPYACPYQGCSKRYSNSSDRFKHTRTHYVDKPYACKTPGCLKRYTDPSSLRKHVKAH 145          
BLAST of GLI-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003451.1 (pep scaffold:Pmarinus_7.0:GL477543:42884:56609:1 gene:ENSPMAG00000003158.1 transcript:ENSPMAT00000003451.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 2.333e-50
Identity = 88/152 (57.89%), Postives = 103/152 (67.76%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYI-GCPKAFS--NSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTK 1140
            C W +C  +F   + L  HIEK HV+ +   +E+ C W+ C R+ +PFNARYKLLIHMRVHSGEKPN+C  SG  K    L N +   +S T  R   C++  GCPKAFS  NSSDRAKHQRTH DTKPY C V GC KRYTDPSSLRKH K
Sbjct:    1 CRWEECRAAFGRREQLCRHIEKSHVEPQR-GEEFACQWEACGRRRRPFNARYKLLIHMRVHSGEKPNRCMVSGGSKYHLDLPNWRTRRKSITPSRSAVCRHFEGCPKAFSRLNSSDRAKHQRTHQDTKPYVCQVPGCSKRYTDPSSLRKHVK 151          
BLAST of GLI-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003448.1 (pep scaffold:Pmarinus_7.0:GL477543:42863:56609:1 gene:ENSPMAG00000003158.1 transcript:ENSPMAT00000003448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.474 bits (428), Expect = 6.487e-50
Identity = 87/151 (57.62%), Postives = 102/151 (67.55%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFS--NSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTK 1140
            C W +C  +F   + L  HIEK HV+ +   +E+ C W+ C R+ +PFNARYKLLIHMRVHSGEKPN+C    C + FS  +  K   R H   +  QC + GCPKAFS  NSSDRAKHQRTH DTKPY C V GC KRYTDPSSLRKH K
Sbjct:    8 CRWEECRAAFGRREQLCRHIEKSHVEPQR-GEEFACQWEACGRRRRPFNARYKLLIHMRVHSGEKPNRCML--CCETFSHSDTHKHSTRPHQDIKRLQCTFEGCPKAFSRLNSSDRAKHQRTHQDTKPYVCQVPGCSKRYTDPSSLRKHVK 155          
BLAST of GLI-3 vs. Ensembl Sea Lamprey
Match: mtf1 (metal-regulatory transcription factor 1 [Source:ZFIN;Acc:ZDB-GENE-020424-1])

HSP 1 Score: 110.538 bits (275), Expect = 7.981e-26
Identity = 65/178 (36.52%), Postives = 92/178 (51.69%), Query Frame = 1
Query:  688 LICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMF 1221
             +C    C ++F     L ++  K+HV     +  + C   GC    K FN  Y+L  H R+H+G   N C   GC K F+ L +L+ H R+HTGERP+QC++ GC KAFS S     H RTH   +P+ C   GC + ++   SL+ H K H +  S L + I PN   S  S + F
Sbjct:   36 FVCEQTGCGKAF-----LTSYSRKIHVRVHTREKPFECGVSGCE---KSFNTLYRLKAHQRIHTGNTFN-CDSEGCTKFFTTLSDLRKHVRTHTGERPFQCKHSGCGKAFSVSHHLRTHVRTHTGERPFPCPSGGCERAFSSQHSLKSHMKGHPSGAS-LKSEI-PNKNTSRDSQNAF 202          

HSP 2 Score: 81.6481 bits (200), Expect = 1.532e-16
Identity = 44/118 (37.29%), Postives = 61/118 (51.69%), Query Frame = 1
Query:  793 YTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            Y C ++GC R    ++    L  H + H GE    C+ +GC KAF    + KIH R HT E+P++C   GC K+F+       HQR H     + C   GC K +T  S LRKH ++H
Sbjct:    6 YQCAYEGCERT---YSTAGNLKTHEKTHRGEYTFVCEQTGCGKAFLTSYSRKIHVRVHTREKPFECGVSGCEKSFNTLYRLKAHQRIHTGNT-FNCDSEGCTKFFTTLSDLRKHVRTH 119          
BLAST of GLI-3 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 95.1301 bits (235), Expect = 8.471e-21
Identity = 63/172 (36.63%), Postives = 87/172 (50.58%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSR----------------KLKP---------FNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSL 1125
            ++IC W  C +SF   + L +H+E +H+ +   K EY C W  C R                K KP         F++   L+ H R HSGEKP KC    C+K F+   +LKIH R+HTGE+P QC+  G  K F+ SS+ +KH +TH   K Y C  + C K + D   L
Sbjct:  704 QVICQWDGCNKSFSSAQELNDHLEAVHLTRG--KSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTGEKPLQCKICG--KRFNESSNLSKHIKTH--QKKYKC--SDCSKSFDDLGKL 865          

HSP 2 Score: 84.7297 bits (208), Expect = 1.821e-17
Identity = 53/151 (35.10%), Postives = 72/151 (47.68%), Query Frame = 1
Query:  787 DEYTCFWQGCSRKL------------------------------KPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQ 1149
            ++  C W GC++                                + F  R KL+ H++VHS  KP KCK   C + FS  E L  H R+H+GE+PY+C    C K F+ SS    H RTH   KP  C +  CGKR+ + S+L KH K+HQ
Sbjct:  703 EQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCK--TCKRCFSSEETLVQHTRTHSGEKPYKCHI--CNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQ 847          
BLAST of GLI-3 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 81.2629 bits (199), Expect = 2.189e-16
Identity = 50/134 (37.31%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  739 LVNHIEKMHVDQ--RNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKH 1134
            LV  +EK    Q  R +K ++ C +  C R    F+    L +H+R H G KP  C Y  C K F++  NL+ HER HTGE+PY C    C K FS   + A H  TH   KP+ C +  C K +T   +++ H
Sbjct:  574 LVGGVEKPKGTQNTRAVK-KHECPY--CHRL---FSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697          

HSP 2 Score: 62.7734 bits (151), Expect = 1.047e-10
Identity = 31/91 (34.07%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  886 KPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQ 1158
            K ++C Y  C + FS+  +L++H RSH G +P+ C Y  C K F+   +   H+R H   KPY C +  C K+++   +L  H  +HQ  +
Sbjct:  591 KKHECPY--CHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQKLK 675          
BLAST of GLI-3 vs. Ensembl Yeast
Match: FZF1 (Transcription factor involved in sulfite metabolism; sole identified regulatory target is SSU1; overexpression suppresses sulfite-sensitivity of many unrelated mutants due to hyperactivation of SSU1, contains five zinc fingers; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003223])

HSP 1 Score: 66.6254 bits (161), Expect = 1.529e-12
Identity = 36/96 (37.50%), Postives = 52/96 (54.17%), Query Frame = 1
Query:  895 KCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASID 1182
            KC + GC+K ++R   L+ H+ SHT ++PY C   GC K F        H+ TH   KP  C +  C KR+     LR+H  SH+  +S+L + ID
Sbjct:   13 KCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHER-KSKLASRID 105          

HSP 2 Score: 53.9138 bits (128), Expect = 2.358e-8
Identity = 39/144 (27.08%), Postives = 63/144 (43.75%), Query Frame = 1
Query:  967 TGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSRRRQNKLTKPADFPLLNIQNNITNKVNG 1398
            T  R Y+C + GC K ++  S   +HQ +H + KPY C   GCGK++  P  LR H  +H        + I P      K+ ++   + VT++Q+               R    S  R++KL    D     +  N+  ++NG
Sbjct:    7 TKSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTH--------SQIKP------KACTLCQKRFVTNQQL---------------RRHLNSHERKSKLASRIDRKHEGVNANVKAELNG 121          
BLAST of GLI-3 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 67.3958 bits (163), Expect = 3.840e-12
Identity = 34/85 (40.00%), Postives = 45/85 (52.94%), Query Frame = 1
Query:  913 CDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVA-------GCGKRYTDPSSLRKHTKSH 1146
            C K F+R  NLK H R+HT ERP+ C    C KAF+   DR +H+  H   K Y CG         GCGK++    +L +H K+ 
Sbjct:  574 CGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTE 656          

HSP 2 Score: 52.7582 bits (125), Expect = 1.256e-7
Identity = 36/111 (32.43%), Postives = 53/111 (47.75%), Query Frame = 1
Query:  745 NHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQC-------QYIGCPKAFSNSSDRAKHQRTH 1056
            +++EK+     N K+        C +K   F   Y L  H+R H+ E+P  C  S C KAF+R  + K HE  HTG++ Y C       +  GC K F+ S    +H +T 
Sbjct:  551 DNLEKLDSVTNNRKNPANFACDVCGKK---FTRPYNLKSHLRTHTNERPFIC--SICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTE 656          
BLAST of GLI-3 vs. Ensembl Yeast
Match: MIG3 (Transcriptional regulator; partially nonfunctional in S288C strains but has a major role in catabolite repression and ethanol response in some other strains; involved in response to toxic agents; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genesenvironment [Source:SGD;Acc:S000000830])

HSP 1 Score: 63.5438 bits (153), Expect = 3.184e-11
Identity = 27/58 (46.55%), Postives = 40/58 (68.97%), Query Frame = 1
Query:  883 EKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTH 1056
            ++P +C+   C + F RLE+ K H R+HTGE+P++C   GCPK+FS S +  +H RTH
Sbjct:   14 QRPFRCEI--CSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTH 69          

HSP 2 Score: 50.447 bits (119), Expect = 4.242e-7
Identity = 26/60 (43.33%), Postives = 36/60 (60.00%), Query Frame = 1
Query:  862 HMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHT-GERPYQCQYIGCPKAFSNSSDRA 1038
            H R H+GEKP+KC   GC K+FSR + LK H R+HT G +  + +  G  K   N++  A
Sbjct:   35 HGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRRRIKSKGSRKTVVNTATAA 94          

HSP 3 Score: 47.3654 bits (111), Expect = 4.733e-6
Identity = 19/58 (32.76%), Postives = 33/58 (56.90%), Query Frame = 1
Query:  973 ERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            +RP++C+   C + F     + +H RTH   KP+ C V GC K ++    L++H ++H
Sbjct:   14 QRPFRCEI--CSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTH 69          
BLAST of GLI-3 vs. Ensembl Nematostella
Match: EDO45177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU02])

HSP 1 Score: 234.187 bits (596), Expect = 2.799e-74
Identity = 109/149 (73.15%), Postives = 121/149 (81.21%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTK 1140
            C W+ C   + +   LV HIEK+H+DQR   D Y C+WQ CSR+ KPFNARYKL+IHMRVHSGEKPNKC + GC+KAFSRLENLKIH RSHTGE+PY CQ+ GCPKAFSNSSDRAKHQRTH DTKPY C V GC KRYTDPSSLRKH K
Sbjct:    2 CRWLGCDAVYSEQDDLVRHIEKVHIDQRKADDLYICYWQDCSRQTKPFNARYKLVIHMRVHSGEKPNKCTHPGCNKAFSRLENLKIHMRSHTGEKPYLCQFPGCPKAFSNSSDRAKHQRTHLDTKPYACQVPGCPKRYTDPSSLRKHFK 150          
BLAST of GLI-3 vs. Ensembl Nematostella
Match: EDO44435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVR5])

HSP 1 Score: 194.897 bits (494), Expect = 6.637e-59
Identity = 92/163 (56.44%), Postives = 113/163 (69.33%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASID 1182
            C W  C   F     LVNH+ + H+   +   EY C WQGC+R  K FNARYK+LIHMR H+GE+P+KC +  C+K+FSRLENLKIH+RSHTGE+PY C   GC K +SNSSDR KH RTHY+ KPY C + GC KRYTDPSSLRKH K++   +S +    D
Sbjct:   19 CKWESCCHHFLTLDDLVNHVNEYHI-TFDKDSEYRCRWQGCNRNGKGFNARYKMLIHMRTHTGERPHKCTFDSCEKSFSRLENLKIHQRSHTGEKPYSCPIEGCDKRYSNSSDRFKHTRTHYERKPYHCRIEGCEKRYTDPSSLRKHLKTYHGQESSIEMDTD 180          
BLAST of GLI-3 vs. Ensembl Nematostella
Match: EDO37573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG3])

HSP 1 Score: 190.274 bits (482), Expect = 2.321e-57
Identity = 92/149 (61.74%), Postives = 110/149 (73.83%), Query Frame = 1
Query:  700 WIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            W DC   F    SLV H+   H+ +   K ++TC+WQ CSR+ +PF A+Y L++HMR H+GEKP+KC + GC KA+SRLENLK H RSHTGERPY C+  GC KAFSN+SDRAKHQ RTH   KPY C V GC KRYTDPSSLRKHTK+
Sbjct:    3 WKDCTIVFDSQDSLVKHVNGDHIKKE--KRDFTCYWQDCSREQRPFKAQYMLVVHMRRHTGEKPHKCYHEGCTKAYSRLENLKTHLRSHTGERPYVCEVEGCTKAFSNASDRAKHQNRTHSSVKPYVCKVPGCPKRYTDPSSLRKHTKT 149          
BLAST of GLI-3 vs. Ensembl Nematostella
Match: NV-ZICD (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK35])

HSP 1 Score: 166.392 bits (420), Expect = 2.887e-48
Identity = 81/165 (49.09%), Postives = 104/165 (63.03%), Query Frame = 1
Query:  688 LICFWID----------CYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQN 1152
            L C WID          C + +     +V+HI   HV   N    + C+WQ CSR  +PF A+YKL+ H+RVH+GEKP  C + GC K F+R ENLKIH+R+HTGE+P+ C++ GC + F+NSSDR KH   H   KPY C V GC K YT PSSLRKH K H++
Sbjct:   17 LTCMWIDQGPIPGKRKPCGKQYTHMPDIVSHISDEHVSA-NDSSLHVCYWQECSRNGQPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKLFARSENLKIHKRTHTGEKPFMCEFPGCDRRFANSSDRKKHSHVHTSDKPYICKVDGCNKSYTHPSSLRKHMKLHES 180          
BLAST of GLI-3 vs. Ensembl Nematostella
Match: NV-ZICA (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8M8])

HSP 1 Score: 162.925 bits (411), Expect = 5.242e-47
Identity = 80/159 (50.31%), Postives = 104/159 (65.41%), Query Frame = 1
Query:  694 CFWIDCYQS--------FHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            C WIDC +         F     LV HI   HV+ R+   ++ C W+ C R  KPF A+YKL+ H+RVH+GEKP  C +S C+K F+R ENLKIH+R+HTGE+P++C++ GC + F+NSSDR KH   H   KPY C  +GC K YT PSSLRKH K+H
Sbjct:   17 CKWIDCTEKVSLLCDKVFSCMDELVKHITIEHVNGRD-STQHVCCWESCDRAGKPFKAKYKLVNHIRVHTGEKPFVCPFSSCNKLFARSENLKIHKRTHTGEKPFECEFKGCNRRFANSSDRKKHSHVHTSDKPYNCRYSGCEKSYTHPSSLRKHLKAH 174          
BLAST of GLI-3 vs. Ensembl Medaka
Match: glis3 (GLIS family zinc finger 3 [Source:NCBI gene;Acc:100302581])

HSP 1 Score: 252.292 bits (643), Expect = 1.717e-73
Identity = 115/162 (70.99%), Postives = 127/162 (78.40%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASI 1179
            C W+DC   +   + LV HIEK+HVDQR  +D +TC+W GC R LKPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C V GC KRYTDPSSLRKH KSH   + QL   +
Sbjct:  476 CRWMDCSAVYDHKEELVRHIEKLHVDQRKTED-FTCYWVGCPRNLKPFNARYKLLIHMRVHSGEKPNKCSFEGCKKAFSRLENLKIHLRSHTGEKPYLCQHPGCHKAFSNSSDRAKHQRTHLDTKPYACQVPGCAKRYTDPSSLRKHLKSHSTRERQLRKKM 636          
BLAST of GLI-3 vs. Ensembl Medaka
Match: s2012 (GLIS family zinc finger 1-like [Source:NCBI gene;Acc:100302580])

HSP 1 Score: 253.832 bits (647), Expect = 3.427e-73
Identity = 115/170 (67.65%), Postives = 134/170 (78.82%), Query Frame = 1
Query:  676 PHPKLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDP 1185
            P  K +C WIDC  ++   + LV HIEK+H+DQR  +D +TCFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC+KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DTKPY C ++GC KRYTDPSSLRKH K H   + Q++  + P
Sbjct:  523 PAEKQVCRWIDCSAAYEQQEELVRHIEKVHIDQRKGED-FTCFWAGCIRRYKPFNARYKLLIHMRVHSGEKPNKCMFEGCNKAFSRLENLKIHLRSHTGEKPYLCQHPGCQKAFSNSSDRAKHQRTHLDTKPYACQISGCTKRYTDPSSLRKHVKIHSAKEQQVHRKLRP 691          
BLAST of GLI-3 vs. Ensembl Medaka
Match: s935 (glis1a [Source:NCBI gene;Acc:100304462])

HSP 1 Score: 200.29 bits (508), Expect = 3.483e-57
Identity = 90/124 (72.58%), Postives = 101/124 (81.45%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDT 1065
            C WIDC  ++   + LV HIEK+H+DQR   +E+ CFW GC R+ KPFNARYKLLIHMRVHSGEKPNKC + GC KAFSRLENLKIH RSHTGE+PY CQ+ GC KAFSNSSDRAKHQRTH DT
Sbjct:  226 CHWIDCSAAYSSQEELVRHIEKVHIDQRK-GEEFACFWAGCVRRHKPFNARYKLLIHMRVHSGEKPNKCMFEGCSKAFSRLENLKIHLRSHTGEKPYICQHPGCLKAFSNSSDRAKHQRTHLDT 348          
BLAST of GLI-3 vs. Ensembl Medaka
Match: glis2b (GLIS family zinc finger 2 [Source:NCBI gene;Acc:100304463])

HSP 1 Score: 195.667 bits (496), Expect = 3.199e-55
Identity = 94/165 (56.97%), Postives = 116/165 (70.30%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDE-YTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNAS 1176
            +L C W  C+  F   + LV+H+   HV     KD  Y C W+GC+RK + FNARYK+LIH+R H+ EKP++C    C+K+FSRLENLKIH RSHTGE+PY C Y GC K +SNSSDR KH RTHY  KPY C + GC KRYTDPSSLRKH K+H +F +Q  A+
Sbjct:  142 QLACRWKKCHLLFDSLQDLVDHVNDFHVKPE--KDSGYCCHWEGCARKGRGFNARYKMLIHIRTHTNEKPHRCPT--CNKSFSRLENLKIHNRSHTGEKPYICPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMVGCLKRYTDPSSLRKHIKAHGHFVAQEQAA 302          
BLAST of GLI-3 vs. Ensembl Medaka
Match: glis2b (GLIS family zinc finger 2 [Source:NCBI gene;Acc:100304463])

HSP 1 Score: 195.667 bits (496), Expect = 3.199e-55
Identity = 94/165 (56.97%), Postives = 116/165 (70.30%), Query Frame = 1
Query:  685 KLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDE-YTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNAS 1176
            +L C W  C+  F   + LV+H+   HV     KD  Y C W+GC+RK + FNARYK+LIH+R H+ EKP++C    C+K+FSRLENLKIH RSHTGE+PY C Y GC K +SNSSDR KH RTHY  KPY C + GC KRYTDPSSLRKH K+H +F +Q  A+
Sbjct:  142 QLACRWKKCHLLFDSLQDLVDHVNDFHVKPE--KDSGYCCHWEGCARKGRGFNARYKMLIHIRTHTNEKPHRCPT--CNKSFSRLENLKIHNRSHTGEKPYICPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMVGCLKRYTDPSSLRKHIKAHGHFVAQEQAA 302          
BLAST of GLI-3 vs. Planmine SMEST
Match: SMESG000078300.1 (SMESG000078300.1)

HSP 1 Score: 1135.17 bits (2935), Expect = 0.000e+0
Identity = 573/574 (99.83%), Postives = 574/574 (100.00%), Query Frame = 1
Query:   58 KSKADKRIERLSTWSSIQFGTXXXXXXXXXXXXXXXXXXXXXXXXIDGIDLASLIRVSPNSLNTLYQEFFNYSPDMASILLNSSTSNRSVDPDYFAKSSISTSPPAKIPRQSLGHCFTGEQQKLKSSALANNLYVTQIKDGNKISPLSINSTYSNDSGIHLNRCKDALTNDFVHSYSGDYYSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSRRRQNKLTKPADFPLLNIQNNITNKVNGCVNFHNQYHMDQNGHYPQLESFNVYNVIPENRNVFKQTSMQTSPINPACQYKQTISSNPYYLPQNQTSISIPFQNPQPVQIQNDKTYSCNYAIDNNQLYAVSLSGNSIMENGYDNQTSQISSWMQNL 1779
            KSKADKRIERLSTWSSIQFGTLSVSSKTSSKKSSTYKSLSISPISIDGIDLASLIRVSPNSLNTLYQEFFNYSPDMASILLNSSTSNRSVDPDYFAKSSISTSPPAKIPRQSLGHCFTGEQQKLKSSALANNLYVTQIKDGNKISPLSINSTYSNDSGIHLNRCKDALTNDFVHSYSGDYYSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSRRRQNKLTKPADFPLLNIQNNITNKVNGCVNFHNQYHMDQNGHYPQLESFNVYNVIPENRNVFKQTS+QTSPINPACQYKQTISSNPYYLPQNQTSISIPFQNPQPVQIQNDKTYSCNYAIDNNQLYAVSLSGNSIMENGYDNQTSQISSWMQNL
Sbjct:  177 KSKADKRIERLSTWSSIQFGTLSVSSKTSSKKSSTYKSLSISPISIDGIDLASLIRVSPNSLNTLYQEFFNYSPDMASILLNSSTSNRSVDPDYFAKSSISTSPPAKIPRQSLGHCFTGEQQKLKSSALANNLYVTQIKDGNKISPLSINSTYSNDSGIHLNRCKDALTNDFVHSYSGDYYSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSRRRQNKLTKPADFPLLNIQNNITNKVNGCVNFHNQYHMDQNGHYPQLESFNVYNVIPENRNVFKQTSIQTSPINPACQYKQTISSNPYYLPQNQTSISIPFQNPQPVQIQNDKTYSCNYAIDNNQLYAVSLSGNSIMENGYDNQTSQISSWMQNL 750          
BLAST of GLI-3 vs. Planmine SMEST
Match: SMESG000060276.1 (SMESG000060276.1)

HSP 1 Score: 189.504 bits (480), Expect = 3.284e-54
Identity = 89/151 (58.94%), Postives = 109/151 (72.19%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKS 1143
            C W  C +   DC++LVNHI   H+ +   K  Y C W  C R  KPF A+Y L++HMR H+GEKP+KC+YS CDK +SRLENLK H R+HTGE+PY C+++ C K FSN+SDRAKHQ RTH + KPY C V GC KRYTDPSSLRKH K+
Sbjct:   17 CHWESCTKQCFDCETLVNHIFTKHISECK-KPYYICQWNNCGRNKKPFKAQYMLVVHMRRHTGEKPHKCEYSNCDKCYSRLENLKTHIRTHTGEKPYNCEFLSCNKRFSNASDRAKHQNRTHSNQKPYFCKVDGCLKRYTDPSSLRKHVKT 166          
BLAST of GLI-3 vs. Planmine SMEST
Match: SMESG000073727.1 (SMESG000073727.1)

HSP 1 Score: 194.126 bits (492), Expect = 1.919e-52
Identity = 88/168 (52.38%), Postives = 114/168 (67.86%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLW 1194
            C W DC ++F     LV HI  +H+     K  + C W+ C R  +PF A+Y L++HMR H+GEKP++C +  C+K +SRLENLK H RSHTGE+PY+C++ GC KAFSN+SDRAKHQ RTH +TKPY C V GC KRYTDPSSLRKH K++   Q   +  +    W
Sbjct:  303 CHWNDCVKTFDTQAELVKHISTIHISGSG-KQTFVCQWKDCVRSGRPFKAQYMLVVHMRRHTGEKPHQCTFPNCNKRYSRLENLKTHIRSHTGEKPYECEFPGCHKAFSNASDRAKHQNRTHSNTKPYVCKVEGCAKRYTDPSSLRKHVKTNHGPQVYADKKMKGESW 469          
BLAST of GLI-3 vs. Planmine SMEST
Match: SMESG000073727.1 (SMESG000073727.1)

HSP 1 Score: 193.741 bits (491), Expect = 2.700e-52
Identity = 88/168 (52.38%), Postives = 114/168 (67.86%), Query Frame = 1
Query:  694 CFWIDCYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQ-RTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASIDPNLW 1194
            C W DC ++F     LV HI  +H+     K  + C W+ C R  +PF A+Y L++HMR H+GEKP++C +  C+K +SRLENLK H RSHTGE+PY+C++ GC KAFSN+SDRAKHQ RTH +TKPY C V GC KRYTDPSSLRKH K++   Q   +  +    W
Sbjct:  325 CHWNDCVKTFDTQAELVKHISTIHISGSG-KQTFVCQWKDCVRSGRPFKAQYMLVVHMRRHTGEKPHQCTFPNCNKRYSRLENLKTHIRSHTGEKPYECEFPGCHKAFSNASDRAKHQNRTHSNTKPYVCKVEGCAKRYTDPSSLRKHVKTNHGPQVYADKKMKGESW 491          
BLAST of GLI-3 vs. Planmine SMEST
Match: SMESG000052644.1 (SMESG000052644.1)

HSP 1 Score: 170.244 bits (430), Expect = 3.635e-46
Identity = 84/192 (43.75%), Postives = 113/192 (58.85%), Query Frame = 1
Query:  598 YSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWID---------CYQSFHDCKSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSGEKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSDRAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSH 1146
            YS Q   +QF + N  +   T           C W+D         C + F+    +VNH+   HV      D +TC+W+ C+R  KPF A+YKL+ H+RVH+GEKP +C +  C K F+R ENLKIH+R+HTGE+P++C + GC + F+NSSDR KH   H + KPY C   GC K YT PSSLRKH + H
Sbjct:  157 YSHQAAFYQFFHRNAVSGFRTEFQ--------CLWLDKHMKEERRTCGKLFYTINEIVNHLTLDHVGGPEQLD-HTCYWKNCTRDFKPFKAKYKLVNHLRVHTGEKPFQCPFLSCGKLFARSENLKIHKRTHTGEKPFKCDFEGCDRRFANSSDRKKHMHVHMNDKPYFCKQEGCDKSYTHPSSLRKHMRIH 339          
The following BLAST results are available for this feature:
BLAST of GLI-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIS33.626e-7370.63GLIS family zinc finger 3 [Source:HGNC Symbol;Acc:... [more]
GLIS14.951e-7368.26GLIS family zinc finger 1 [Source:HGNC Symbol;Acc:... [more]
GLIS31.769e-7270.63GLIS family zinc finger 3 [Source:HGNC Symbol;Acc:... [more]
GLIS17.063e-7268.26GLIS family zinc finger 1 [Source:HGNC Symbol;Acc:... [more]
GLI23.494e-5458.94GLI family zinc finger 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of GLI-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra-14.903e-5048.66Sex-determining transformer protein 1 [Source:Uni... [more]
ref-24.635e-4342.58REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-26.619e-4342.58REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ref-26.619e-4342.58REgulator of Fusion [Source:UniProtKB/TrEMBL;Acc:... [more]
ztf-143.229e-3244.37Zinc finger putative Transcription Factor family ... [more]
back to top
BLAST of GLI-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmd2.430e-7070.99gene:FBgn0039039 transcript:FBtr0084364[more]
ci8.264e-5259.60gene:FBgn0004859 transcript:FBtr0306168[more]
ci1.016e-5159.60gene:FBgn0004859 transcript:FBtr0089178[more]
sug1.410e-5054.61gene:FBgn0033782 transcript:FBtr0331985[more]
sug3.899e-5053.55gene:FBgn0033782 transcript:FBtr0087789[more]
back to top
BLAST of GLI-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glis1b5.956e-7769.75GLIS family zinc finger 1b [Source:ZFIN;Acc:ZDB-GE... [more]
glis1b2.935e-7368.48GLIS family zinc finger 1b [Source:ZFIN;Acc:ZDB-GE... [more]
glis1a4.605e-7272.85GLIS family zinc finger 1a [Source:ZFIN;Acc:ZDB-GE... [more]
glis37.750e-7274.17GLIS family zinc finger 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glis38.797e-7274.17GLIS family zinc finger 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of GLI-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIS31.361e-7357.75GLIS family zinc finger 3 [Source:NCBI gene;Acc:10... [more]
GLIS32.262e-7357.75GLIS family zinc finger 3 [Source:NCBI gene;Acc:10... [more]
GLIS31.193e-7257.75GLIS family zinc finger 3 [Source:NCBI gene;Acc:10... [more]
GLI18.530e-5556.10GLI family zinc finger 1 [Source:NCBI gene;Acc:100... [more]
GLI11.313e-5456.10GLI family zinc finger 1 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of GLI-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glis18.228e-7467.46GLIS family zinc finger 1 [Source:MGI Symbol;Acc:M... [more]
Glis31.032e-7370.63GLIS family zinc finger 3 [Source:MGI Symbol;Acc:M... [more]
Glis11.501e-7267.46GLIS family zinc finger 1 [Source:MGI Symbol;Acc:M... [more]
Glis32.698e-7270.63GLIS family zinc finger 3 [Source:MGI Symbol;Acc:M... [more]
Gli21.202e-5458.94GLI-Kruppel family member GLI2 [Source:MGI Symbol;... [more]
back to top
BLAST of GLI-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NEA6|GLIS3_HUMAN1.741e-7270.63Zinc finger protein GLIS3 OS=Homo sapiens OX=9606 ... [more]
sp|Q8NBF1|GLIS1_HUMAN2.378e-7268.26Zinc finger protein GLIS1 OS=Homo sapiens OX=9606 ... [more]
sp|Q6XP49|GLIS3_MOUSE3.631e-7270.63Zinc finger protein GLIS3 OS=Mus musculus OX=10090... [more]
sp|Q8K1M4|GLIS1_MOUSE1.050e-7167.46Zinc finger protein GLIS1 OS=Mus musculus OX=10090... [more]
sp|Q91690|GLI1_XENLA7.735e-5456.10Zinc finger protein GLI1 (Fragment) OS=Xenopus lae... [more]
back to top
BLAST of GLI-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2ILS50.000e+099.40GLI-3 OS=Schmidtea mediterranea OX=79327 GN=gli-3 ... [more]
X1YV677.449e-7775.66Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2J7PWE66.600e-7676.47Uncharacterized protein OS=Cryptotermes secundus O... [more]
A0A4W5Q2D91.883e-7570.48GLIS family zinc finger 3 OS=Hucho hucho OX=62062 ... [more]
A0A4Y2HFV37.313e-7573.29Zinc finger protein GLIS3 OS=Araneus ventricosus O... [more]
back to top
BLAST of GLI-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glis35.031e-7370.70GLIS family zinc finger 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glis32.760e-7270.70GLIS family zinc finger 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
glis2a2.885e-5655.42GLIS family zinc finger 2a [Source:ZFIN;Acc:ZDB-GE... [more]
glis2b6.357e-5551.30GLIS family zinc finger 2 [Source:NCBI gene;Acc:10... [more]
gli13.447e-5455.49GLI family zinc finger 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of GLI-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008614.13.434e-5262.31pep scaffold:Pmarinus_7.0:GL479003:10005:19084:-1 ... [more]
glis2b3.122e-5158.90GLIS family zinc finger 2b [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000003451.12.333e-5057.89pep scaffold:Pmarinus_7.0:GL477543:42884:56609:1 g... [more]
ENSPMAT00000003448.16.487e-5057.62pep scaffold:Pmarinus_7.0:GL477543:42863:56609:1 g... [more]
mtf17.981e-2636.52metal-regulatory transcription factor 1 [Source:ZF... [more]
back to top
BLAST of GLI-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP18.471e-2136.63Zinc-regulated transcription factor; binds to zinc... [more]
AZF12.189e-1637.31Zinc-finger transcription factor; involved in diau... [more]
FZF11.529e-1237.50Transcription factor involved in sulfite metabolis... [more]
CRZ13.840e-1240.00Transcription factor, activates transcription of s... [more]
MIG33.184e-1146.55Transcriptional regulator; partially nonfunctional... [more]
back to top
BLAST of GLI-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451772.799e-7473.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444356.637e-5956.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375732.321e-5761.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICD2.887e-4849.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NV-ZICA5.242e-4750.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GLI-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glis31.717e-7370.99GLIS family zinc finger 3 [Source:NCBI gene;Acc:10... [more]
s20123.427e-7367.65GLIS family zinc finger 1-like [Source:NCBI gene;A... [more]
s9353.483e-5772.58glis1a [Source:NCBI gene;Acc:100304462][more]
glis2b3.199e-5556.97GLIS family zinc finger 2 [Source:NCBI gene;Acc:10... [more]
glis2b3.199e-5556.97GLIS family zinc finger 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of GLI-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078300.10.000e+099.83SMESG000078300.1[more]
SMESG000060276.13.284e-5458.94SMESG000060276.1[more]
SMESG000073727.11.919e-5252.38SMESG000073727.1[more]
SMESG000073727.12.700e-5252.38SMESG000073727.1[more]
SMESG000052644.13.635e-4643.75SMESG000052644.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000146
GenBankACZ64516.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000146 ID=SMED30000146|Name=GLI-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1892bp
AGGTGACTCCATATTTTCTGTGTTTTGTTTAGGAAAGACAATTATCATAA
TTTGTAGAAATCTAAAGCCGATAAAAGGATCGAAAGATTAAGCACTTGGT
CATCAATTCAATTTGGAACTTTATCTGTCAGTAGTAAAACTTCATCAAAA
AAAAGTTCAACATATAAATCTCTTTCGATAAGTCCGATTTCAATTGACGG
AATTGATCTGGCGAGTCTCATAAGAGTGTCTCCAAACTCATTAAATACTC
TTTATCAGGAATTTTTTAATTATTCTCCAGATATGGCTTCTATTTTATTA
AATTCTTCAACATCCAATAGATCGGTGGATCCAGATTATTTTGCTAAGAG
TTCAATTTCTACTTCTCCACCGGCAAAAATACCTCGTCAAAGTCTGGGTC
ATTGCTTTACTGGTGAACAGCAGAAACTAAAATCATCAGCTCTTGCAAAT
AATTTATATGTTACCCAAATAAAAGATGGTAACAAAATTTCACCATTATC
CATTAATAGCACCTACTCAAACGATTCGGGAATTCACTTGAATCGCTGTA
AAGATGCTTTGACTAATGACTTTGTTCATTCATATTCTGGTGATTATTAC
TCCCCACAAATTAATATCCACCAATTTTCCAATTGTAACTTGTCCAACCA
AATCTACACATCCATAGATTCAAGACCTCATCCAAAATTGATATGCTTTT
GGATAGATTGCTATCAATCTTTCCATGACTGTAAAAGCCTAGTAAATCAT
ATTGAAAAGATGCATGTTGACCAAAGAAATATTAAAGATGAGTACACGTG
TTTTTGGCAAGGTTGTAGTAGAAAACTGAAGCCATTTAATGCCCGCTATA
AACTTTTGATTCATATGCGAGTTCACAGTGGAGAGAAACCAAACAAGTGC
AAATATTCTGGTTGTGATAAAGCCTTTTCAAGATTAGAAAATTTAAAAAT
CCACGAGAGATCACACACTGGAGAACGTCCGTATCAGTGCCAATATATTG
GCTGTCCCAAAGCATTTTCAAATAGTTCTGACAGAGCGAAACATCAAAGA
ACTCATTATGATACGAAACCATATTGCTGCGGAGTTGCTGGTTGCGGCAA
ACGTTATACCGATCCAAGTTCTTTAAGAAAACATACAAAATCCCATCAAA
ATTTTCAGTCTCAACTTAATGCTTCAATAGATCCTAACTTATGGTATTCT
GAAAAATCCCCTTCTATGTTTGACCATAAGATTGTAACTGACAAGCAAAT
GTTACCTCCTCTCAAATGTGGTTCGATTATTAATGGTTTTCCTCAGAGAC
CGACTTATGTATCAAGAAGGAGACAAAATAAACTTACAAAGCCAGCAGAT
TTTCCATTATTAAATATTCAAAACAATATTACAAATAAAGTGAATGGATG
TGTAAATTTTCATAACCAATATCATATGGATCAAAATGGTCATTATCCGC
AATTAGAATCCTTCAATGTATATAATGTCATTCCTGAAAATAGAAATGTA
TTTAAACAAACTTCCATGCAAACTTCACCAATTAATCCAGCATGTCAATA
TAAGCAAACAATATCATCGAATCCGTATTATTTGCCCCAAAATCAAACTT
CCATTAGTATTCCATTTCAAAATCCCCAGCCAGTTCAGATTCAAAATGAT
AAAACTTACAGTTGTAATTATGCAATTGACAACAATCAACTATATGCTGT
TTCACTAAGTGGAAATTCAATTATGGAAAACGGTTATGATAATCAGACTT
CTCAAATCAGCTCTTGGATGCAAAACTTGTAAAGAAATTCATTCAGTATT
TTATGTTTTTGTGACATTTGGTAACTCCAGAACATATAATGTTTTTATTT
TTCCGTGAATCCTAATATCTCCTAATTTTAACTCATTTCAGG
back to top

protein sequence of SMED30000146-orf-1

>SMED30000146-orf-1 ID=SMED30000146-orf-1|Name=SMED30000146-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
MASILLNSSTSNRSVDPDYFAKSSISTSPPAKIPRQSLGHCFTGEQQKLK
SSALANNLYVTQIKDGNKISPLSINSTYSNDSGIHLNRCKDALTNDFVHS
YSGDYYSPQINIHQFSNCNLSNQIYTSIDSRPHPKLICFWIDCYQSFHDC
KSLVNHIEKMHVDQRNIKDEYTCFWQGCSRKLKPFNARYKLLIHMRVHSG
EKPNKCKYSGCDKAFSRLENLKIHERSHTGERPYQCQYIGCPKAFSNSSD
RAKHQRTHYDTKPYCCGVAGCGKRYTDPSSLRKHTKSHQNFQSQLNASID
PNLWYSEKSPSMFDHKIVTDKQMLPPLKCGSIINGFPQRPTYVSRRRQNK
LTKPADFPLLNIQNNITNKVNGCVNFHNQYHMDQNGHYPQLESFNVYNVI
PENRNVFKQTSMQTSPINPACQYKQTISSNPYYLPQNQTSISIPFQNPQP
VQIQNDKTYSCNYAIDNNQLYAVSLSGNSIMENGYDNQTSQISSWMQNL*
back to top
Aliases
The feature 'GLI-3' has the following synonyms
Synonym
GLI-3
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 204..228
e-value: 0.0054
score: 25.9
coord: 136..161
e-value: 5.9
score: 15.3
coord: 264..288
e-value: 0.0038
score: 26.5
coord: 171..198
e-value: 0.47
score: 19.5
coord: 234..258
e-value: 0.0021
score: 27.3
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 205..228
e-value: 7.2E-4
score: 19.9
coord: 234..258
e-value: 3.2E-4
score: 21.0
coord: 264..288
e-value: 3.6E-4
score: 20.8
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 236..258
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 138..161
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 206..228
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 266..288
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 204..233
score: 14.711
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 264..293
score: 10.803
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 176..203
score: 10.367
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 234..263
score: 13.256
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 262..289
e-value: 5.5E-10
score: 41.0
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 170..197
e-value: 4.9E-15
score: 57.2
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 198..227
e-value: 2.7E-13
score: 51.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 228..261
e-value: 2.4E-11
score: 45.2
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 137..166
e-value: 1.6E-6
score: 29.8
NoneNo IPR availablePANTHERPTHR45718:SF7GLIS FAMILY ZINC FINGER 3coord: 134..295
NoneNo IPR availablePANTHERPTHR45718FAMILY NOT NAMEDcoord: 134..295
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 136..165
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 228..284
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 185..241