CAP-Gly domain-containing protein

Overview
NameCAP-Gly domain-containing protein
Smed IDSMED30000144
Length (bp)798
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CAP-Gly domain-containing protein (SMED30000144) t-SNE clustered cells

Violin plots show distribution of expression levels for CAP-Gly domain-containing protein (SMED30000144) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CAP-Gly domain-containing protein (SMED30000144) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CAP-Gly domain-containing protein (SMED30000144) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000144

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30000144h1SMcG0005896 SmedASXL_009325SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000144h1SMcG0005896 dd_Smed_v4_16405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000144h1SMcG0005896 dd_Smed_v4_16405_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30000144h1SMcG0005896 dd_Smed_v6_16405_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CAP-Gly domain-containing protein vs. Ensembl Human
Match: CLIP1 (CAP-Gly domain containing linker protein 1 [Source:HGNC Symbol;Acc:HGNC:10461])

HSP 1 Score: 60.077 bits (144), Expect = 8.043e-10
Identity = 32/88 (36.36%), Postives = 45/88 (51.14%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKS 340
            + ++IG  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+    K+
Sbjct:  210 RELKIGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKA 293          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Human
Match: CLIP1 (CAP-Gly domain containing linker protein 1 [Source:HGNC Symbol;Acc:HGNC:10461])

HSP 1 Score: 55.4546 bits (132), Expect = 4.383e-8
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + ++IG  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  210 RELKIGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 287          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Human
Match: CLIP1 (CAP-Gly domain containing linker protein 1 [Source:HGNC Symbol;Acc:HGNC:10461])

HSP 1 Score: 55.0694 bits (131), Expect = 6.299e-8
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + ++IG  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  210 RELKIGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 287          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Human
Match: CLIP1 (CAP-Gly domain containing linker protein 1 [Source:HGNC Symbol;Acc:HGNC:10461])

HSP 1 Score: 55.0694 bits (131), Expect = 6.310e-8
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + ++IG  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  210 RELKIGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 287          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Human
Match: CLIP1 (CAP-Gly domain containing linker protein 1 [Source:HGNC Symbol;Acc:HGNC:10461])

HSP 1 Score: 55.0694 bits (131), Expect = 6.319e-8
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + ++IG  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  210 RELKIGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 287          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Celegans
Match: tbcb-1 (Tubulin-specific chaperone B [Source:UniProtKB/Swiss-Prot;Acc:Q20728])

HSP 1 Score: 47.3654 bits (111), Expect = 2.960e-6
Identity = 22/68 (32.35%), Postives = 35/68 (51.47%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFT 280
            +NI +G   EV         G+V + G+   ++G W+G++    +G +DG + G RYF   P YG F 
Sbjct:  144 KNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSVAGVRYFDCDPKYGGFV 211          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0329957)

HSP 1 Score: 55.0694 bits (131), Expect = 2.754e-8
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = 2
Query:   62 KMVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            ++VL + I +G+ V +   N +   G +RF G+   + G WIG+EL +  G +DG + G +YF  +P +G+F  SDK+
Sbjct: 1776 ELVLPEWIVVGESVLIRPYNTS---GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1850          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0346265)

HSP 1 Score: 55.0694 bits (131), Expect = 2.850e-8
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = 2
Query:   62 KMVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            ++VL + I +G+ V +   N +   G +RF G+   + G WIG+EL +  G +DG + G +YF  +P +G+F  SDK+
Sbjct: 1790 ELVLPEWIVVGESVLIRPYNTS---GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1864          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0329955)

HSP 1 Score: 55.0694 bits (131), Expect = 3.092e-8
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = 2
Query:   62 KMVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            ++VL + I +G+ V +   N +   G +RF G+   + G WIG+EL +  G +DG + G +YF  +P +G+F  SDK+
Sbjct: 1776 ELVLPEWIVVGESVLIRPYNTS---GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1850          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0087357)

HSP 1 Score: 55.0694 bits (131), Expect = 3.181e-8
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = 2
Query:   62 KMVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            ++VL + I +G+ V +   N +   G +RF G+   + G WIG+EL +  G +DG + G +YF  +P +G+F  SDK+
Sbjct: 1798 ELVLPEWIVVGESVLIRPYNTS---GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1872          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Fly
Match: Khc-73 (gene:FBgn0019968 transcript:FBtr0329956)

HSP 1 Score: 55.0694 bits (131), Expect = 3.208e-8
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = 2
Query:   62 KMVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            ++VL + I +G+ V +   N +   G +RF G+   + G WIG+EL +  G +DG + G +YF  +P +G+F  SDK+
Sbjct: 1785 ELVLPEWIVVGESVLIRPYNTS---GVIRFVGTTEFQPGAWIGVELDTPTGKNDGSVKGVQYFQCKPKHGMFVRSDKL 1859          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01072096.1 (pep chromosome:GRCz11:10:44408675:44411032:-1 gene:ENSDARG00000079483.4 transcript:ENSDART00000111509.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01072096.1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.405e-9
Identity = 28/73 (38.36%), Postives = 38/73 (52.05%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKS 340
            G    G VRF G  +  KG+W G+EL   +G +DG + G RYF   P YGLF  + K+  I    T+    K+
Sbjct:  185 GGSKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGGRYFQCLPKYGLFAPTHKVTRIGFPSTTPAKSKA 257          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: clip1a (CAP-GLY domain containing linker protein 1a [Source:ZFIN;Acc:ZDB-GENE-060526-282])

HSP 1 Score: 54.299 bits (129), Expect = 7.479e-8
Identity = 26/62 (41.94%), Postives = 35/62 (56.45%), Query Frame = 2
Query:  137 GKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  204 GVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTRIGFPSTT 265          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: kif13bb (kinesin family member 13Bb [Source:ZFIN;Acc:ZDB-GENE-090908-5])

HSP 1 Score: 53.1434 bits (126), Expect = 1.725e-7
Identity = 23/58 (39.66%), Postives = 33/58 (56.90%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            GT   G VR+ G  +  KG W+G+EL    G +DG + GR YF   PGYG+    +++
Sbjct: 1985 GTNKTGTVRYVGQTDFAKGVWVGVELDVPAGKNDGSVGGRHYFHCNPGYGVLVRPNRV 2042          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-47f9.4 (si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9])

HSP 1 Score: 52.7582 bits (125), Expect = 1.842e-7
Identity = 24/77 (31.17%), Postives = 42/77 (54.55%), Query Frame = 2
Query:   83 IQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISIN 313
            + +G  V ++ +N    +  +R+ G+     G W+G+EL S  G +DG +  RRYF  RPG+G+     ++ +  IN
Sbjct:  399 LHLGMQVLLISAN---EMATIRYIGTAEFAPGLWLGLELRSPKGKNDGSVGSRRYFSCRPGHGVLVRPSRVTYRGIN 472          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: si:dkeyp-47f9.4 (si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9])

HSP 1 Score: 50.447 bits (119), Expect = 2.337e-7
Identity = 27/91 (29.67%), Postives = 44/91 (48.35%), Query Frame = 2
Query:   83 IQIGQDVEVLRSNGTISL--------------GKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISIN 313
            I++G +     S+GT+ L                +R+ G+     G W+G+EL S  G +DG +  RRYF  RPG+G+     ++ +  IN
Sbjct:   63 IRVGGNTSCPGSDGTVKLHLGMQVLLISANEMATIRYIGTAEFAPGLWLGLELRSPKGKNDGSVGSRRYFSCRPGHGVLVRPSRVTYRGIN 153          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016691.1 (uncharacterized LOC100495307 [Source:NCBI gene;Acc:100495307])

HSP 1 Score: 60.077 bits (144), Expect = 8.242e-10
Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 2
Query:   80 NIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIEL-ASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            ++++G  V+  R  G IS G +++KG + GR   ++G+EL  S++G  DG+  G RYF+ +P  G+F    KI
Sbjct:  401 DLKVGDLVKFSRPAGKISKGTIQYKGCLPGRVEVYLGVELEGSEVGKHDGIFQGTRYFLCKPNKGVFVNFSKI 473          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016706.1 (uncharacterized LOC100495307 [Source:NCBI gene;Acc:100495307])

HSP 1 Score: 59.6918 bits (143), Expect = 1.226e-9
Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 2
Query:   80 NIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIEL-ASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            ++++G  V+  R  G IS G +++KG + GR   ++G+EL  S++G  DG+  G RYF+ +P  G+F    KI
Sbjct:  655 DLKVGDLVKFSRPAGKISKGTIQYKGCLPGRVEVYLGVELEGSEVGKHDGIFQGTRYFLCKPNKGVFVNFSKI 727          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Match: clip1 (CAP-Gly domain containing linker protein 1 [Source:NCBI gene;Acc:100124823])

HSP 1 Score: 58.9214 bits (141), Expect = 2.304e-9
Identity = 26/71 (36.62%), Postives = 39/71 (54.93%), Query Frame = 2
Query:  137 GKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIK 349
            G +RF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+    K+ ++
Sbjct:  161 GVIRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTRIGFPSTTPAKAKTSVR 231          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Match: vstm5 (V-set and transmembrane domain containing 5 [Source:Xenbase;Acc:XB-GENE-940096])

HSP 1 Score: 56.6102 bits (135), Expect = 1.641e-8
Identity = 22/58 (37.93%), Postives = 36/58 (62.07%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            G    G VR+ G+++  +G W+GIEL +Q+G  DG + G+ YF  +P YG+F    ++
Sbjct: 1407 GENKTGTVRYIGTVDFSRGTWVGIELHAQLGKHDGTVKGKEYFRCKPKYGVFVRPSRL 1464          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Match: vstm5 (V-set and transmembrane domain containing 5 [Source:Xenbase;Acc:XB-GENE-940096])

HSP 1 Score: 56.6102 bits (135), Expect = 1.771e-8
Identity = 22/58 (37.93%), Postives = 36/58 (62.07%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            G    G VR+ G+++  +G W+GIEL +Q+G  DG + G+ YF  +P YG+F    ++
Sbjct: 1453 GENKTGTVRYIGTVDFSRGTWVGIELHAQLGKHDGTVKGKEYFRCKPKYGVFVRPSRL 1510          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Mouse
Match: Kif13b (kinesin family member 13B [Source:MGI Symbol;Acc:MGI:1098265])

HSP 1 Score: 55.0694 bits (131), Expect = 4.147e-8
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIR 298
            GT   G VR+ G  + ++G WIG+EL    G +DG + G++YF   PGYGL     ++R
Sbjct: 1730 GTNKTGIVRYIGPTDFQEGTWIGVELDLPAGKNDGSIGGKQYFRCNPGYGLLVRPSRVR 1788          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Mouse
Match: Clip1 (CAP-GLY domain containing linker protein 1 [Source:MGI Symbol;Acc:MGI:1928401])

HSP 1 Score: 55.0694 bits (131), Expect = 4.225e-8
Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + +++G  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  209 RELKVGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 286          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Mouse
Match: Kif13b (kinesin family member 13B [Source:MGI Symbol;Acc:MGI:1098265])

HSP 1 Score: 55.0694 bits (131), Expect = 4.261e-8
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIR 298
            GT   G VR+ G  + ++G WIG+EL    G +DG + G++YF   PGYGL     ++R
Sbjct: 1726 GTNKTGIVRYIGPTDFQEGTWIGVELDLPAGKNDGSIGGKQYFRCNPGYGLLVRPSRVR 1784          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Mouse
Match: Clip1 (CAP-GLY domain containing linker protein 1 [Source:MGI Symbol;Acc:MGI:1928401])

HSP 1 Score: 54.6842 bits (130), Expect = 5.539e-8
Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + +++G  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  209 RELKVGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 286          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Mouse
Match: Clip1 (CAP-GLY domain containing linker protein 1 [Source:MGI Symbol;Acc:MGI:1928401])

HSP 1 Score: 54.6842 bits (130), Expect = 5.683e-8
Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + +++G  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  209 RELKVGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 286          
BLAST of CAP-Gly domain-containing protein vs. UniProt/SwissProt
Match: sp|O42184|CLIP1_CHICK (CAP-Gly domain-containing linker protein 1 OS=Gallus gallus OX=9031 GN=CLIP1 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.907e-7
Identity = 32/91 (35.16%), Postives = 47/91 (51.65%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIK 349
            + ++IG  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+    K+ ++
Sbjct:  213 RELKIGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPRYGLFAPVHKVTKIGFPSTTPAKAKTTVR 299          
BLAST of CAP-Gly domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JK25|CLIP1_RAT (CAP-Gly domain-containing linker protein 1 OS=Rattus norvegicus OX=10116 GN=Clip1 PE=1 SV=2)

HSP 1 Score: 55.0694 bits (131), Expect = 2.527e-7
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + ++IG  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  209 RELKIGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 286          
BLAST of CAP-Gly domain-containing protein vs. UniProt/SwissProt
Match: sp|P30622|CLIP1_HUMAN (CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 3.745e-7
Identity = 31/82 (37.80%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + ++IG  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  210 RELKIGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 287          
BLAST of CAP-Gly domain-containing protein vs. UniProt/SwissProt
Match: sp|Q922J3|CLIP1_MOUSE (CAP-Gly domain-containing linker protein 1 OS=Mus musculus OX=10090 GN=Clip1 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 3.975e-7
Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + +++G  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+
Sbjct:  209 RELKVGDRVLV----GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT 286          
BLAST of CAP-Gly domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54Z01|TBCB_DICDI (Tubulin-specific chaperone B OS=Dictyostelium discoideum OX=44689 GN=tbcb PE=3 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 7.719e-7
Identity = 25/69 (36.23%), Postives = 40/69 (57.97%), Query Frame = 2
Query:   83 IQIGQDVEVLRSNGT---ISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFT 280
            I++G   +V+  + T     LGKV++ G++    G WIG+EL   +G +DG + G++YF   P YG F 
Sbjct:  187 IKVGDRCKVISDDPTNYDERLGKVQYVGTVEFSSGVWIGVELDLPLGKNDGSVKGKQYFQCSPKYGCFA 255          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A267EQM2 (CAP-Gly domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004166g1 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 9.885e-31
Identity = 82/242 (33.88%), Postives = 127/242 (52.48%), Query Frame = 2
Query:   65 MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYK-SLIKTEIGDNFLKNEISDRSLDTEKKIIISKDFLEKSFCLDKRINSSDTFTQNRYPLRHLIGKIEVEXXXXXXXXXXXSYQIPLQRNSYYLHHEDFITPSAIPDYYIPRQKLK---SLTHENLAKIHTPKTHNHYEMRDFLH-ENWWNDV 775
            MVLF NI IGQ+VEV   N  +   KVR+KG +N  KGDW+G+EL   +G +DG+  G RYF VR  YG+F T+D+IRF  + R  FN YK +  +    D  L N     + D    + +S ++   +     R+ S+   +    P  + + +  V+K P+P   +  +               +FI+P++IPDY +P   L+   +   +N   +  PK H+ + +RDFLH  N+WND+
Sbjct:    3 MVLFDNIAIGQNVEVKHLN-ELYPAKVRYKGGLNSMKGDWVGLELYEPVGYTDGLYRGHRYFFVRKDYGIFVTADQIRFPRMKRRLFNKYKVADPEQATTDASLFNTQRPATADPRDPVYLSDEYSRLAM---HRLPSAGACSLFEPPRNYHLKQSCVKKPPEPPEPEKPA--------------PEFISPASIPDYVVPPSVLRRHVARHRDNPEALRFPKHHSLHTIRDFLHSSNYWNDM 226          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A267DHE0 (CAP-Gly domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016323g2 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.013e-30
Identity = 82/242 (33.88%), Postives = 127/242 (52.48%), Query Frame = 2
Query:   65 MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYK-SLIKTEIGDNFLKNEISDRSLDTEKKIIISKDFLEKSFCLDKRINSSDTFTQNRYPLRHLIGKIEVEXXXXXXXXXXXSYQIPLQRNSYYLHHEDFITPSAIPDYYIPRQKLK---SLTHENLAKIHTPKTHNHYEMRDFLH-ENWWNDV 775
            MVLF NI IGQ+VEV   N  +   KVR+KG +N  KGDW+G+EL   +G +DG+  G RYF VR  YG+F T+D+IRF  + R  FN YK +  +    D  L N     + D    + +S ++   +     R+ S+   +    P  + + +  V+K P+P   +  +               +FI+P++IPDY +P   L+   +   +N   +  PK H+ + +RDFLH  N+WND+
Sbjct:    9 MVLFDNIAIGQNVEVKHLN-ELYPAKVRYKGGLNSMKGDWVGLELYEPVGYTDGLYRGHRYFFVRKDYGIFVTADQIRFPRMKRRLFNKYKVADPEQATTDASLFNTQRPATADPRDPVYLSDEYSRLAM---HRLPSAGACSLFEPPRNYHLKQSCVKKPPEPPEPEKPA--------------PEFISPASIPDYVVPPSVLRRHVARHRDNPEALRFPKHHSLHTIRDFLHSSNYWNDM 232          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: R7VFT5 (CAP-Gly domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228358 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 4.603e-27
Identity = 81/258 (31.40%), Postives = 122/258 (47.29%), Query Frame = 2
Query:   65 MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIKTEIGDNFLKNEISDRSLDTEKKIIISK-----------DFLEKSFCLDKRINSSDTFTQ-------NRYPLRHLIG---KIEVEXXXXXXXXXXXSYQIPLQRNSYYLHHEDFITPSAIPDYYIPRQKLKSLTHENLAKIHTPKTHNHYEMRDFLHENWWNDV 775
            MVLF NI IGQ VEVLR  G + LG VRFKG +N   G+W+G+EL  + G  DGM+NGRRYF    G+G+FT S KIRF+ + R  +N+Y+S              + D SL + K  + S              L       + +N+S +  Q         +PL H++    +    +K + + +K  +YQ       Y + +  FIT  +IP  ++P    K        + H P+       R+ ++ N WN +
Sbjct:    1 MVLFDNIAIGQRVEVLR-GGRVFLGNVRFKGFLNSIPGEWVGVELDLKAGKHDGMMNGRRYFKCPAGHGIFTPSAKIRFVKMKRCLYNSYRS-----------SPTVVDESLFSSKGYLTSTLPYQIYHGYVVLVLGNVSVTTQDVNASHSANQPDVLSDRPHFPLTHMVSNSIQAATLRKQQLQRSKCFAYQSSPIHVEYDVEYNQFITSPSIPKTHMPHAVQKKRVMSGWDRDHLPRDMTVNTARESVYYNTWNHL 246          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A1S3JG89 (CAP-Gly domain-containing linker protein 2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106172661 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.542e-26
Identity = 78/247 (31.58%), Postives = 118/247 (47.77%), Query Frame = 2
Query:   65 MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNY-----KSLIKTEIGDNFLKNEISDRSLDTEKKIIISKDFLEKSFCLDKRINSSDTFTQNR-YPLRHLIG---KIEVEXXXXXXXXXXXSYQIPLQRNSYYLHHEDFITPSAIPDYYIPRQKLKSLTHENLAKIHTPKTHNHYEMRDFLHENWWNDVS 778
            MVL  NI + Q VEV R NG+I  G VR+KG +  + GDW+G+ L   +G  DG+  GRRYF  + G+G+FT + +IRFI + R  +N Y     KS +   +  N  K E  DR  D    I IS D+  ++       +S D + + + Y L H +          +P   +++   Y  P+  + Y L  + FI+  +IP  ++P   LK          H  +  +    RD      WND+S
Sbjct:    1 MVLHSNINVNQRVEVKR-NGSIYTGMVRYKGPLVTQAGDWVGVALDEPVGTHDGLFKGRRYFSCKDGHGIFTRAQQIRFIPLTRCLYNKYYCVSRKSYVDETLFGNTSKPEPDDRPYD---PISISGDYTRRA--KSAFFDSEDMYARPKSYHLSHRVSNRIPAATMTRPYTSMSQYSYYSTPIS-SEYALDRDSFISSPSIPKIHMPHSALKRQVSRGWENSHYVREMSVASGRDSAKLLQWNDIS 240          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A1S3JES1 (dynactin, 150 kDa isoform isoform X1 OS=Lingula unguis OX=7574 GN=LOC106172661 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.330e-25
Identity = 78/247 (31.58%), Postives = 117/247 (47.37%), Query Frame = 2
Query:   65 MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNY-----KSLIKTEIGDNFLKNEISDRSLDTEKKIIISKDFLEKSFCLDKRINSSDTFTQNR-YPLRHLIG---KIEVEXXXXXXXXXXXSYQIPLQRNSYYLHHEDFITPSAIPDYYIPRQKLKSLTHENLAKIHTPKTHNHYEMRDFLHENWWNDVS 778
            MVL  NI + Q VEV R NG I  G VR+KG +  + GDW+G+ L   +G  DG+  GRRYF  + G+G+FT + +IRFI + R  +N Y     KS +   +  N  K E  DR  D    I IS D+  ++       N+ D + + + Y L H +          +P   +++   Y  P+  + Y L  + FI+  +IP  ++P   LK          H  +  +    RD      WND+S
Sbjct:    1 MVLHSNINVNQRVEVKR-NGGIYTGMVRYKGPLVTQAGDWVGVALDEPVGTHDGLFKGRRYFSCKDGHGIFTRAQQIRFIPMTRCLYNKYYCVNRKSYVDETLFGNTSKPEPDDRPYD---PISISGDYTRRA--KSAFFNNEDMYARPKSYHLSHRVSNRIPAATMTRPYTSMSQYSYYSTPIS-SEYALDRDSFISSPSIPKIHMPHSALKRQVSRGWENSHYVREMSVASGRDSAKLLQWNDIS 240          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Match: clip1a (CAP-Gly domain-containing linker protein 1-like [Source:NCBI gene;Acc:111191575])

HSP 1 Score: 55.4546 bits (132), Expect = 2.472e-8
Identity = 27/71 (38.03%), Postives = 39/71 (54.93%), Query Frame = 2
Query:  137 GKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIK 349
            G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+    K+ ++
Sbjct:  209 GVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTRIGFPSTTPAKAKTTVR 279          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Match: clip1a (CAP-Gly domain-containing linker protein 1-like [Source:NCBI gene;Acc:111191575])

HSP 1 Score: 55.4546 bits (132), Expect = 2.475e-8
Identity = 27/71 (38.03%), Postives = 39/71 (54.93%), Query Frame = 2
Query:  137 GKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIK 349
            G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+    K+ ++
Sbjct:  209 GVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTRIGFPSTTPAKAKTTVR 279          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Match: kif13ba (kinesin family member 13Ba [Source:ZFIN;Acc:ZDB-GENE-070521-1])

HSP 1 Score: 54.299 bits (129), Expect = 6.114e-8
Identity = 26/71 (36.62%), Postives = 40/71 (56.34%), Query Frame = 2
Query:   83 IQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            +++G+ V V  S      G VR+ G  +   G W+G+EL S  G +DG + GR+YF   PGYG+    D++
Sbjct: 1606 LKVGESVTVAGSK----CGTVRYIGLTDFSDGIWVGVELDSPAGKNDGSVGGRQYFRCNPGYGVLVRPDRV 1672          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037622.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:32938202:32940307:-1 gene:ENSAMXG00000034654.1 transcript:ENSAMXT00000037622.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 2.392e-7
Identity = 22/60 (36.67%), Postives = 35/60 (58.33%), Query Frame = 2
Query:  134 LGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISIN 313
            +G +R+ G+ +   G W+G+EL S  G +DG +  RRYF  R GYG+     ++ +  IN
Sbjct:   93 MGTIRYLGTADFAPGLWLGLELRSAKGKNDGSVGSRRYFSCRSGYGVLVRPSRVSYRGIN 152          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Match: clip2 (CAP-Gly domain containing linker protein 2 [Source:NCBI gene;Acc:103031388])

HSP 1 Score: 51.9878 bits (123), Expect = 2.702e-7
Identity = 29/82 (35.37%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            +++++G  V V    G    G VR+ G  +  KG+W G+EL   +G +DG + G RYF   P +GLF    K+  I    TS
Sbjct:  208 KDLRVGDRVLV----GGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGFPSTS 285          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkeyp-47f9.4 (si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9])

HSP 1 Score: 58.9214 bits (141), Expect = 3.124e-10
Identity = 25/64 (39.06%), Postives = 35/64 (54.69%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISIN 313
            GT  +G VRF G +    G W+G+EL +  G  DG + G RYF  RPG G+     ++ +  IN
Sbjct:  585 GTGEMGTVRFVGEVGFAAGTWLGLELRAPRGKHDGAVGGHRYFSCRPGCGVMVRPGRVSYRGIN 648          

HSP 2 Score: 45.8246 bits (107), Expect = 6.124e-6
Identity = 20/63 (31.75%), Postives = 35/63 (55.56%), Query Frame = 2
Query:  137 GKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSF 325
            G +RF+G+ +   G W GIEL    G +DG + G RYF     +G+F    +++ ++++  S 
Sbjct:  451 GVLRFQGTTHFAPGHWYGIELEQPSGRNDGSVAGVRYFQCPAKHGVFAPPSRVQRLTVSMESL 513          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006027.1 (pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 gene:ENSPMAG00000005440.1 transcript:ENSPMAT00000006027.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 1.497e-9
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + ++IG  V V   +GT + G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF  + K+  I    T+
Sbjct:  234 RELKIGDRVLV---SGTKA-GVVRFLGEADFAKGEWCGVELDEPLGKNDGSVAGTRYFQCQPKYGLFAPTHKVTRIGFPSTT 311          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006020.1 (pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 gene:ENSPMAG00000005440.1 transcript:ENSPMAT00000006020.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.832e-9
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            + ++IG  V V   +GT + G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF  + K+  I    T+
Sbjct:  230 RELKIGDRVLV---SGTKA-GVVRFLGEADFAKGEWCGVELDEPLGKNDGSVAGTRYFQCQPKYGLFAPTHKVTRIGFPSTT 307          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004647.1 (pep scaffold:Pmarinus_7.0:GL484285:5077:12891:1 gene:ENSPMAG00000004232.1 transcript:ENSPMAT00000004647.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.594e-8
Identity = 30/82 (36.59%), Postives = 43/82 (52.44%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTS 322
            +++++G  V V    G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +  YGLF    K+  I    TS
Sbjct:  189 RDLKMGDRVLV----GGTKAGVVRFVGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQQRYGLFAPIHKVAKIGFPSTS 266          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Match: tbcb (tubulin folding cofactor B [Source:ZFIN;Acc:ZDB-GENE-030131-9296])

HSP 1 Score: 48.1358 bits (113), Expect = 5.748e-7
Identity = 23/65 (35.38%), Postives = 33/65 (50.77%), Query Frame = 2
Query:   83 IQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLF 277
            I +GQ  +V         G V F G  + + G W+G++    +G +DG + GRRYF   P YG F
Sbjct:  162 ITVGQRCQVEVMGQPHKRGTVMFVGQTDFKPGFWVGVKYDEPLGKNDGSVGGRRYFECEPRYGAF 226          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Yeast
Match: NIP100 (Large subunit of the dynactin complex; dynactin is involved in partitioning the mitotic spindle between mother and daughter cells; putative ortholog of mammalian p150(glued) [Source:SGD;Acc:S000006095])

HSP 1 Score: 48.521 bits (114), Expect = 5.644e-7
Identity = 25/63 (39.68%), Postives = 32/63 (50.79%), Query Frame = 2
Query:  137 GKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPG--------YGLFTTSDKIRF 301
            G+V+F G     KG W GIEL   +G +DG  NG RYF +           YGLF   D ++F
Sbjct:   28 GRVKFIGETQFAKGIWYGIELDKPLGKNDGSANGIRYFDIDLKKANSNGGYYGLFCKKDTLQF 90          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Match: EDO32673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUE3])

HSP 1 Score: 99.7525 bits (247), Expect = 2.315e-25
Identity = 70/236 (29.66%), Postives = 111/236 (47.03%), Query Frame = 2
Query:   65 MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIKTEIGDNFLKNEISDRSLDTEK-------KIIISKDFLEKSFCLD----------KRINSSDTFTQNRYPLRHLIGKIEVEXXXXXXXXXXXSYQIPLQRNSY-YLHHEDFITPSAIPDYYIPRQKLKSLTHENLAKIHTPK 718
            MV F NI +G  VEVL   G +  G VR+ G +  + G+WIGIEL  ++G+  G+  G +YF  + G+G+FT +  IRF S  R+ FNNY+++      D  L  +++  +LD +          ++   +L+  F ++          +R   +      ++   HL+G          K    +  Q     N Y Y H E FITP +IP   +PR  LKS+  +N      P+
Sbjct:    1 MVQFHNINVGARVEVL-WRGEVCKGAVRYTGMLVAKPGEWIGIELDDRVGSHSGLHKGVQYFKCKDGHGIFTRARNIRFNSNKRSVFNNYRTISPNSSVDEVLFKKMNGMTLDVDHPDSIERGPPVVRSSYLKTLFKVNVFNSIFYQILERKEDNLWSRSRQFHKSHLVG-------AHIKPATMQRPQTAQPSNPYGYKHREPFITPPSIPLCGVPRPVLKSMVKQNYFGTSIPR 228          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Match: EDO30311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T153])

HSP 1 Score: 60.077 bits (144), Expect = 2.852e-10
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 2
Query:   77 QNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            Q+IQ+G  V V R+ G +  G V++ GS+  R   +IG+EL S  G  DG   G+R+F  +P  G+F + +K+
Sbjct: 1186 QDIQLGMRVLVTRTRGNVGRGVVKYVGSLPDRTDTYIGVELDSGEGKHDGSFGGKRFFRCKPNRGIFVSYNKV 1258          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Match: EDO30218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1F2])

HSP 1 Score: 50.8322 bits (120), Expect = 5.163e-9
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  137 GKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIR 298
            G +RF G+     G W+G+EL    G +DG ++G RYF  +P +G F   DK++
Sbjct:    3 GVIRFIGATEFSPGPWVGVELDKAGGKNDGSVSGVRYFACKPRFGSFVRPDKVK 56          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Match: EDO33600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRR5])

HSP 1 Score: 53.1434 bits (126), Expect = 3.444e-8
Identity = 22/54 (40.74%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  134 LGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            +G +R+ G+    KG+W G+EL   +G +DG + G RYF    GYGLF    K+
Sbjct:  106 IGTLRYVGTTEFAKGEWAGVELDEPLGKNDGAVAGTRYFQCIQGYGLFAPVHKV 159          

HSP 2 Score: 48.9062 bits (115), Expect = 8.580e-7
Identity = 26/80 (32.50%), Postives = 42/80 (52.50%), Query Frame = 2
Query:  137 GKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFIS-INRTSFNNYKSLIKTEIGDNFL 373
            G + F G     KGDW GI L    G +DG + G +YF  +P +G+FT  +KI  ++ +  +  +  ++    EIGD  +
Sbjct:   21 GVIAFLGETKFAKGDWAGIILDDPTGKNDGSVAGEKYFECKPLHGVFTKLEKITKVNQVTESPGSPVENSSSLEIGDRVV 100          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Match: EDO43343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ45])

HSP 1 Score: 51.6026 bits (122), Expect = 1.265e-7
Identity = 26/75 (34.67%), Postives = 41/75 (54.67%), Query Frame = 2
Query:   71 LFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            + ++ QIG+ V V         G V+F G      G W+GIEL++ +G +DG + G RYF  +P +G+F    K+
Sbjct:  355 IARDFQIGEHVLVAGQKP----GIVQFIGQTQFASGWWLGIELSNPVGKNDGSVGGVRYFTCKPRFGVFAPVAKV 425          

HSP 2 Score: 51.6026 bits (122), Expect = 1.300e-7
Identity = 20/58 (34.48%), Postives = 33/58 (56.90%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            G    G +RF G      G+W+G+EL   +G +DG ++G +YF   P +G+F  + K+
Sbjct:  237 GGTKSGVLRFCGRTEFASGEWVGVELDQPVGKNDGSVDGVQYFQCEPNHGIFAPASKV 294          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: clip1a (CAP-Gly domain containing linker protein 1 [Source:NCBI gene;Acc:101171418])

HSP 1 Score: 56.6102 bits (135), Expect = 1.088e-8
Identity = 28/76 (36.84%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIK 349
            G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+    K+ ++
Sbjct:  212 GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTRIGFPSTTPAKAKTTVR 287          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: si:dkeyp-47f9.4 (CAP-Gly domain containing linker protein family member 4 [Source:NCBI gene;Acc:101171960])

HSP 1 Score: 56.225 bits (134), Expect = 1.120e-8
Identity = 24/63 (38.10%), Postives = 37/63 (58.73%), Query Frame = 2
Query:  143 VRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNN 331
            +R+ G+ +   G W+G+EL S  G +DG + GRRYF  RPGYG+     ++ +  IN +   N
Sbjct:  635 IRYFGTADFAPGLWLGLELRSPKGKNDGSVGGRRYFTCRPGYGVLVRPSRVTYRGINGSRLVN 697          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: clip1a (CAP-Gly domain containing linker protein 1 [Source:NCBI gene;Acc:101171418])

HSP 1 Score: 55.8398 bits (133), Expect = 1.767e-8
Identity = 28/76 (36.84%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIK 349
            G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+    K+ ++
Sbjct:  212 GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTRIGFPSTTPAKAKTTVR 287          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: clip1a (CAP-Gly domain containing linker protein 1 [Source:NCBI gene;Acc:101171418])

HSP 1 Score: 55.8398 bits (133), Expect = 1.938e-8
Identity = 28/76 (36.84%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIK 349
            G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+    K+ ++
Sbjct:  212 GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTRIGFPSTTPAKAKTTVR 287          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Match: clip1a (CAP-Gly domain containing linker protein 1 [Source:NCBI gene;Acc:101171418])

HSP 1 Score: 55.8398 bits (133), Expect = 1.938e-8
Identity = 28/76 (36.84%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  122 GTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIK 349
            G    G VRF G  +  KG+W G+EL   +G +DG + G RYF  +P YGLF    K+  I    T+    K+ ++
Sbjct:  212 GGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTRIGFPSTTPAKAKTTVR 287          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000000637.1 (SMESG000000637.1)

HSP 1 Score: 457.603 bits (1176), Expect = 2.489e-165
Identity = 235/239 (98.33%), Postives = 237/239 (99.16%), Query Frame = 2
Query:   65 MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIKTEIGDNFLKNEISDRSLDTEKKIIISKDFLEKSFCLDKRINSSDTFTQNRYPLRHLIGKIEVEXXXXXXXXXXXSYQIPLQRNSYYLHHEDFITPSAIPDYYIPRQKLKSLTHENLAKIHTPKTHNHYEMRDFLHENWWNDVSL 781
            MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSL KTEIGDNFLKNEISDRSLDTEKKIIISKDFLEKSFCLD+ INSSDTFTQNRYPLRHLIGK+EVEKKPKPKLTKTKSYQIPLQRNSYYLHHEDFITPSAIPDYYIPRQKLKSLTHENLAKIHTPKTHNHYEMRDFLHENWWNDVSL
Sbjct:    1 MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLPKTEIGDNFLKNEISDRSLDTEKKIIISKDFLEKSFCLDEGINSSDTFTQNRYPLRHLIGKVEVEKKPKPKLTKTKSYQIPLQRNSYYLHHEDFITPSAIPDYYIPRQKLKSLTHENLAKIHTPKTHNHYEMRDFLHENWWNDVSL 239          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000015698.1 (SMESG000015698.1)

HSP 1 Score: 58.151 bits (139), Expect = 2.324e-9
Identity = 25/61 (40.98%), Postives = 39/61 (63.93%), Query Frame = 2
Query:  116 SNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIR 298
            S+ T  +G +RF G+    +G W+GIEL + IG +DG ++G RYF  +  YGLF   +K++
Sbjct:  151 SSSTQKIGTLRFIGNTKFAEGIWVGIELDNPIGRNDGSVDGVRYFSCKSQYGLFALENKVQ 211          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000006189.1 (SMESG000006189.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.418e-7
Identity = 25/79 (31.65%), Postives = 40/79 (50.63%), Query Frame = 2
Query:   59 FKMVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKI 295
            F   +  ++ +   V+ +R  G ++ G V F G + GR    +G+EL  + G  DG+  G RYF  R   G+F +  KI
Sbjct:  677 FTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKI 755          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000015470.1 (SMESG000015470.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.759e-7
Identity = 24/73 (32.88%), Postives = 42/73 (57.53%), Query Frame = 2
Query:   95 QDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISIN 313
            + ++VL +N    LG +R+ G++N   G W+G+EL  + G  DG++  +RYF+  P +G+     +I    IN
Sbjct:  453 EGLQVLCNN---ELGIIRYVGAVNFSDGIWVGVELRHKTGKHDGIVLNKRYFLCPPDHGIMVRPSRISVKGIN 522          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000015465.1 (SMESG000015465.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.802e-7
Identity = 24/73 (32.88%), Postives = 42/73 (57.53%), Query Frame = 2
Query:   95 QDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIGNSDGMLNGRRYFIVRPGYGLFTTSDKIRFISIN 313
            + ++VL +N    LG +R+ G++N   G W+G+EL  + G  DG++  +RYF+  P +G+     +I    IN
Sbjct:  597 EGLQVLCNN---ELGIIRYVGAVNFSDGIWVGVELRHKTGKHDGIVLNKRYFLCPPDHGIMVRPSRISVKGIN 666          
The following BLAST results are available for this feature:
BLAST of CAP-Gly domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLIP18.043e-1036.36CAP-Gly domain containing linker protein 1 [Source... [more]
CLIP14.383e-837.80CAP-Gly domain containing linker protein 1 [Source... [more]
CLIP16.299e-837.80CAP-Gly domain containing linker protein 1 [Source... [more]
CLIP16.310e-837.80CAP-Gly domain containing linker protein 1 [Source... [more]
CLIP16.319e-837.80CAP-Gly domain containing linker protein 1 [Source... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tbcb-12.960e-632.35Tubulin-specific chaperone B [Source:UniProtKB/Sw... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Khc-732.754e-835.90gene:FBgn0019968 transcript:FBtr0329957[more]
Khc-732.850e-835.90gene:FBgn0019968 transcript:FBtr0346265[more]
Khc-733.092e-835.90gene:FBgn0019968 transcript:FBtr0329955[more]
Khc-733.181e-835.90gene:FBgn0019968 transcript:FBtr0087357[more]
Khc-733.208e-835.90gene:FBgn0019968 transcript:FBtr0329956[more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01072096.19.405e-938.36pep chromosome:GRCz11:10:44408675:44411032:-1 gene... [more]
clip1a7.479e-841.94CAP-GLY domain containing linker protein 1a [Sourc... [more]
kif13bb1.725e-739.66kinesin family member 13Bb [Source:ZFIN;Acc:ZDB-GE... [more]
si:dkeyp-47f9.41.842e-731.17si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9... [more]
si:dkeyp-47f9.42.337e-729.67si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000016691.18.242e-1036.99uncharacterized LOC100495307 [Source:NCBI gene;Acc... [more]
ENSXETT00000016706.11.226e-936.99uncharacterized LOC100495307 [Source:NCBI gene;Acc... [more]
clip12.304e-936.62CAP-Gly domain containing linker protein 1 [Source... [more]
vstm51.641e-837.93V-set and transmembrane domain containing 5 [Sourc... [more]
vstm51.771e-837.93V-set and transmembrane domain containing 5 [Sourc... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif13b4.147e-840.68kinesin family member 13B [Source:MGI Symbol;Acc:M... [more]
Clip14.225e-836.59CAP-GLY domain containing linker protein 1 [Source... [more]
Kif13b4.261e-840.68kinesin family member 13B [Source:MGI Symbol;Acc:M... [more]
Clip15.539e-836.59CAP-GLY domain containing linker protein 1 [Source... [more]
Clip15.683e-836.59CAP-GLY domain containing linker protein 1 [Source... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O42184|CLIP1_CHICK1.907e-735.16CAP-Gly domain-containing linker protein 1 OS=Gall... [more]
sp|Q9JK25|CLIP1_RAT2.527e-737.80CAP-Gly domain-containing linker protein 1 OS=Ratt... [more]
sp|P30622|CLIP1_HUMAN3.745e-737.80CAP-Gly domain-containing linker protein 1 OS=Homo... [more]
sp|Q922J3|CLIP1_MOUSE3.975e-736.59CAP-Gly domain-containing linker protein 1 OS=Mus ... [more]
sp|Q54Z01|TBCB_DICDI7.719e-736.23Tubulin-specific chaperone B OS=Dictyostelium disc... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EQM29.885e-3133.88CAP-Gly domain-containing protein (Fragment) OS=Ma... [more]
A0A267DHE01.013e-3033.88CAP-Gly domain-containing protein (Fragment) OS=Ma... [more]
R7VFT54.603e-2731.40CAP-Gly domain-containing protein OS=Capitella tel... [more]
A0A1S3JG894.542e-2631.58CAP-Gly domain-containing linker protein 2 isoform... [more]
A0A1S3JES11.330e-2531.58dynactin, 150 kDa isoform isoform X1 OS=Lingula un... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clip1a2.472e-838.03CAP-Gly domain-containing linker protein 1-like [S... [more]
clip1a2.475e-838.03CAP-Gly domain-containing linker protein 1-like [S... [more]
kif13ba6.114e-836.62kinesin family member 13Ba [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000037622.12.392e-736.67pep primary_assembly:Astyanax_mexicanus-2.0:9:3293... [more]
clip22.702e-735.37CAP-Gly domain containing linker protein 2 [Source... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-47f9.43.124e-1039.06si:dkeyp-47f9.4 [Source:ZFIN;Acc:ZDB-GENE-131126-9... [more]
ENSPMAT00000006027.11.497e-939.02pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 g... [more]
ENSPMAT00000006020.11.832e-939.02pep scaffold:Pmarinus_7.0:GL478150:21952:49796:1 g... [more]
ENSPMAT00000004647.11.594e-836.59pep scaffold:Pmarinus_7.0:GL484285:5077:12891:1 ge... [more]
tbcb5.748e-735.38tubulin folding cofactor B [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NIP1005.644e-739.68Large subunit of the dynactin complex; dynactin is... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO326732.315e-2529.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303112.852e-1038.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302185.163e-938.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336003.444e-840.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433431.265e-734.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clip1a1.088e-836.84CAP-Gly domain containing linker protein 1 [Source... [more]
si:dkeyp-47f9.41.120e-838.10CAP-Gly domain containing linker protein family me... [more]
clip1a1.767e-836.84CAP-Gly domain containing linker protein 1 [Source... [more]
clip1a1.938e-836.84CAP-Gly domain containing linker protein 1 [Source... [more]
clip1a1.938e-836.84CAP-Gly domain containing linker protein 1 [Source... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000637.12.489e-16598.33SMESG000000637.1[more]
SMESG000015698.12.324e-940.98SMESG000015698.1[more]
SMESG000006189.11.418e-731.65SMESG000006189.1[more]
SMESG000015470.11.759e-732.88SMESG000015470.1[more]
SMESG000015465.11.802e-732.88SMESG000015465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000144 ID=SMED30000144|Name=CAP-Gly domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=798bp
ATTTTAAATAAAAATTAATTTTAGATTACTTGTTAACTTATTTTATAAGT
GTTAAATTTTTAAAATGGTTTTATTTCAAAATATACAAATTGGTCAAGAC
GTTGAAGTACTGAGATCAAACGGAACTATTAGTTTAGGAAAAGTAAGATT
TAAAGGCAGTATAAATGGGCGGAAAGGTGATTGGATTGGAATTGAATTGG
CATCACAGATTGGTAATTCAGACGGCATGTTAAATGGGCGTCGTTATTTT
ATTGTCCGACCCGGTTATGGACTTTTCACTACATCTGATAAAATAAGATT
TATATCAATTAATCGGACTTCTTTTAATAACTATAAAAGTCTTATTAAAA
CAGAAATAGGAGACAATTTTTTAAAAAATGAAATTTCAGACAGAAGCTTA
GACACAGAAAAGAAAATAATAATATCAAAAGATTTTTTGGAAAAATCATT
TTGCTTAGATAAAAGAATCAACAGTTCTGATACTTTCACTCAAAATCGCT
ATCCCTTGAGACATTTAATTGGTAAAATTGAAGTGGAGAAGAAACCGAAA
CCAAAACTTACCAAAACCAAAAGTTATCAAATTCCCCTCCAAAGAAATTC
CTATTATTTACATCACGAAGACTTCATTACCCCATCTGCTATTCCAGACT
ATTATATTCCTAGGCAGAAACTAAAGTCATTAACTCACGAAAATCTAGCG
AAAATTCACACGCCCAAAACTCATAACCATTACGAAATGAGAGATTTCCT
TCATGAAAATTGGTGGAATGACGTTTCTTTATAGAGATGACGAATTTT
back to top

protein sequence of SMED30000144-orf-1

>SMED30000144-orf-1 ID=SMED30000144-orf-1|Name=SMED30000144-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MVLFQNIQIGQDVEVLRSNGTISLGKVRFKGSINGRKGDWIGIELASQIG
NSDGMLNGRRYFIVRPGYGLFTTSDKIRFISINRTSFNNYKSLIKTEIGD
NFLKNEISDRSLDTEKKIIISKDFLEKSFCLDKRINSSDTFTQNRYPLRH
LIGKIEVEKKPKPKLTKTKSYQIPLQRNSYYLHHEDFITPSAIPDYYIPR
QKLKSLTHENLAKIHTPKTHNHYEMRDFLHENWWNDVSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036859CAP-Gly_dom_sf
IPR000938CAP-Gly_domain
Vocabulary: cellular component
TermDefinition
GO:0001726ruffle
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0016020membrane
GO:0030659cytoplasmic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0035371microtubule plus-end
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0006810transport
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000938CAP Gly-rich domainSMARTSM01052CAP_GLY_2coord: 9..78
e-value: 8.0E-18
score: 75.2
IPR000938CAP Gly-rich domainPFAMPF01302CAP_GLYcoord: 19..77
e-value: 4.4E-15
score: 55.5
IPR000938CAP Gly-rich domainPROSITEPS50245CAP_GLY_2coord: 31..73
score: 13.92
IPR036859CAP Gly-rich domain superfamilyGENE3DG3DSA:2.30.30.190coord: 2..92
e-value: 2.1E-18
score: 67.6
IPR036859CAP Gly-rich domain superfamilySUPERFAMILYSSF74924Cap-Gly domaincoord: 5..93
NoneNo IPR availablePANTHERPTHR18916:SF74coord: 1..210
NoneNo IPR availablePANTHERPTHR18916DYNACTIN 1-RELATED MICROTUBULE-BINDINGcoord: 1..210