Macrophage-expressed gene 1 protein

Overview
NameMacrophage-expressed gene 1 protein
Smed IDSMED30000139
Uniprot Best hitMacrophage-expressed gene 1 protein OS=Pongo abelii GN=MPEG1 PE=2 SV=1 (E=2.33374e-119)
Length (bp)2115
Neoblast Clusters

Zeng et. al., 2018


 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Macrophage-expressed gene 1 protein ( MPEG1-like-1 ) is expressed during Stage 3 and Stage 4 in the embryonic digestive system and temporary embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 375.941 bits (964), Expect = 3.310e-118
Identity = 203/561 (36.19%), Postives = 321/561 (57.22%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPF 1812
              VLPG GWDNL N ++G+V+++ YS C+++ DG ++IPD+       +S ++M+S+I+  ++ Y S TS S+N E+S  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P  EL+  FR+ +LD+   +EN + +  A YLA+L+V ++GTHV  SVDAGA L + D L+  +L   + S+ +VT +A ++ + T+  K   NY + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVAIDR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+      D  LC+ + QKN  TGD+SCP+G++PV L S  ++ EG N       C +                  +  FWCV++ +  +   + FGG++++   NP   A SCP  +FP  +  N KVC+S D ELG + ++PFGGF+SC++GNPL       S   G+   K C  G+S H AL+   CQ+SYCV +   T G   P   PPF
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLENNQ-TRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHE-EGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPA--ISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 334.724 bits (857), Expect = 6.676e-103
Identity = 204/594 (34.34%), Postives = 310/594 (52.19%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL---DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSF-------KYKCE-------------------GDNCPI----YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGK-VCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
            C   ++     VLPG GWDNL N ++G+V+ ++YS+C+++ DG +LIPD+  +     S V+ +S+I+  + +  S TS SVN +VS  +    ++  FS E + +K +Q+KE S  ++ Q+R  LY V   PD  L+ RF ++  ++   IEN + + HA+YL++ +V D+GTHVI SVDAGA L + D LK  Y+S  +  + SV+ +A  +  + +   I GN   G S+   Y  N   + I + GG  F    TL KW+++   NLVAIDR G PL++ +     P+     V ++ + +++A  RYY  NT  GC+++ S NF+  AN D   C        FGG+YQ+C+    D + +C+   QKN ATG YSCP  +    L+S         Y+C                    GD+  +     ET WC S  K+ +     FGG++   IQNP  ++ SCP  +F      NG  +C+S D E+G + S+PF GF+SC  GNPL+         NG      C   +S H A +   CQ+ YCV +   + G+  P+  PPF    T   VV + A  T A
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAIENNQ-TRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLS---------NGQ---SRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPF----TRPPVVGMIATNTVA 606          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.3 (macrophage expressed 1, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-081105-5])

HSP 1 Score: 320.087 bits (819), Expect = 7.496e-98
Identity = 191/576 (33.16%), Postives = 301/576 (52.26%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCS---LDDDSLCENIIQKNAATGDYSCPNGFTPVKLYS-------FKYKCEGDNC------------------------PIYETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGING-KVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPF 1812
            CH  +N     VLPG GWDNL N ++G+V+ ++YS+C+++ DG +LIPD+  +    ++ V+ +S+++  +    S TS S+N +VS  +    ++G FS E + IK +Q+KE S  S+ Q+R  LY V   P+  L+ RF +++ ++   I N + +  A YL++ ++ D+GTHVI SV+AGA L + D LK  Y+ K++    SV+ +A  +  + + +  S N     S    Y  N   + I + GG  F    TL KW+++   NLVAIDR G PL++ +     P+  + +V ++   + +A  +YY  NT  GC+++ SKNF+  AN D   C        FGG+YQ+C+   +D  ++C+ + QKN ATG YSC   +    L S        +Y+C+ DNC                           +T WC S  K  +     FGG+Y  ++QNPF R+ +CP  FF   +      VC+S D     K+++PFGGF+SC  GNPL+         NG      C   +S H A +   CQ+ YCV +   + G   P+  PP+
Sbjct:   33 CHKNSNLVALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKENTVETNSEMIMSWLDQKSSTSSSINADVSFFS---WLNGKFSREHQRIKTHQVKESSVTSRVQVRNRLYTVKAYPNFPLDSRFAQQVEEIADAITNDQ-TRLATYLSEKLILDYGTHVITSVEAGASLVQEDYLKMSYILKNQLDLSSVSASAGFNFFDKVKLDPSYNGGQKTSLNSSYQGNITYSLIQSHGGALFYPGMTLQKWQESTLNNLVAIDRSGLPLHYFLNPSTFPDISEALVRKLALSVSQAAEQYYKVNTIPGCVNVDSKNFNFQANVDDVSCEGPITNLSFGGMYQQCTPLTIDGSTICDEMAQKNPATGGYSCSQKYNTTLLRSEIIERGYTRYECQ-DNCRSCGFLGWSTCCSQTCNNVNYIRRAKVDTLWCYSTQKIPEYSGYIFGGLYGPSMQNPFTRSYTCPPNFFVQPILSRAIMVCLSNDYVKATKSAVPFGGFFSCQSGNPLS---------NGE---SRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGQLKPVLLPPY 591          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.2 (macrophage expressed 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050522-305])

HSP 1 Score: 308.531 bits (789), Expect = 4.530e-93
Identity = 182/592 (30.74%), Postives = 300/592 (50.68%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKC---SLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSF-------KYKC--EGDNCPI-------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGING-KVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
            C   +N     VLPG GWDNL N ++G+V+ + YS+C+++ DG +LIPD+  +     S V+  S+ +  +    S TS S+N + S  T    ++G FS E   +K +Q++  S  ++ Q+R  LY V+  PD  L+ RF ++I +L   IEN + +  A YL++ ++ ++GTHVI S+DAGA L + D +K  Y+S     + SV+ +A ++    +            SE   Y +N   + + + GG  F    T+ KW+++   +LVAIDR G P+++ +     P+     ++++   +++A  RYY+ NT  GC D  S+NF+  AN +   C        FGG+YQ C   S D + +C+   Q+N  TGD++C   ++  +L+S         Y+C  E  +C +                    +T+WC ++    +     FGG++  ++QNP  ++  CP  +F      NG ++C+S D E G  +S+PFGG +SC  GNP A  +              C   YS H A +   CQ+ YCV +   T G   P++ PPF    T+  ++N+ A  T A
Sbjct:   30 CRQNSNLTALEVLPGGGWDNLRNLDVGRVMNLTYSQCQTTEDGLYLIPDEVFVIPRKTSGVETHSETIMSWLDQRSSTSGSINADASYLTV---LNGKFSEENTRMKIHQVRGNSVTTRVQVRNHLYTVNAYPDFTLDSRFSQQISELADAIENNQ-TRQAMYLSEKVILEYGTHVITSIDAGATLVQEDYIKRSYVSDTNSERSSVSASAGINFFNMVNFNFGSKETEQTSETLTYQQNITYSLVQSHGGALFYQGITMQKWQESTQNHLVAIDRSGLPIHYFLNPAVFPDLPVPTLHKLAFSVQKAAERYYNINTTPGCTDQSSQNFNFQANVNDTSCEGPVTNLTFGGVYQTCTPESPDGNVICDEFAQRNPDTGDFTCRQPYSATRLHSENVQQGYNNYECHEECHSCWLILDCCHQVCGNVYYVRQAQIDTYWCSTSQTVPENTGYLFGGLFGPSLQNPQTKSHDCPANYFEQVFLTNGMRICLSNDYEAGTISSVPFGGLFSCQSGNPQAGNQ------------YRCPPQYSQHLATISDGCQVLYCVQSGVFTGGQLKPVHLPPF----TKPPLINMMATNTVA 601          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 60.8474 bits (146), Expect = 1.732e-10
Identity = 22/50 (44.00%), Postives = 36/50 (72.00%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDK 339
            C   ++     VLPG GWDNL N ++G+V+ ++YS+C+++ DG +LIPD+
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDE 82          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Mpeg1 (macrophage expressed gene 1 [Source:MGI Symbol;Acc:MGI:1333743])

HSP 1 Score: 377.867 bits (969), Expect = 3.617e-119
Identity = 203/577 (35.18%), Postives = 323/577 (55.98%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCS-LDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEG-------DNCPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
              VLPG GWDNL N ++G+V+ + Y+ CK++ DG ++IPD+       +S ++M+S+++  +  Y S TS S+N E++  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P SEL+  F + ++D+   +E K  +  A YLA+L++ ++GTHVI SVDAGA L + D ++  +L  ++ SQ++VT +A ++    +  K+  +Y +  S  ++Y  N  ++R+ + GG PF    TL  W+K ++ +LVAIDR G PL+  I    +P     +V ++   ++ A+  YY+ NT  GC ++ S NF+  AN D   C+       FGG+YQ+C+ L  D LC+N+ QKN  TGD+SCP G+TPV L S  ++ EG         C +                  +  +WCV+ G+      + FGG++T    NP   A SCP  + P N+  + KVC+S+D ELGFK S+PFGGF+SC MGNPL            S   K C  G+S H A++   CQ+SYCV     T G  LP+  PP+      S+V     + T++
Sbjct:   50 LEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLE-KNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYTPVHLLSQTHE-EGYSRLECKKKCTLKIFCKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMSQVATNTVIVTNS 619          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Pfpl (pore forming protein-like [Source:MGI Symbol;Acc:MGI:1860266])

HSP 1 Score: 356.295 bits (913), Expect = 4.230e-111
Identity = 206/618 (33.33%), Postives = 324/618 (52.43%), Query Frame = 1
Query:   67 ILFLSIGSILAVLAEEKELNITHPHKNIATSNLPSAKFVHGCHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKY-------KCEGDNCPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNG----SYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDI 1821
            I+ + I + +A   EEK L   H +                C    N     VLPG GWDNL N ++GQV+ + Y+ CK++ DG ++IPD        +S ++M+S+I+  +  Y S TS S+NL +       +++G FS E + IK  Q+++++  ++ Q+R  +Y V   P++ELN  F++ ++++   +E K  +  A YLA+L++ ++GTH+I SVDAGA L + D +K  YL  ++G++ +V  +A  +  + +  KI   ++  ++    Y +N   +R+ +IGG PF    T+  W+K +  +LVA+DR G PL+  I    +P F   +V ++   ++ A   YY+ NT  GC +I S NFD  AN D G C+       FGG+YQ C      D D +C +  QKN  TGD+SCP  +TPV L S  +       +C  D C +                    ++WC ++ +  +   I FGG++T    NP     SCP  +FP  +  N KVC+S+D ELG K S+PFGGF+SC+ GNPL     + S  +G    S+ PK C  G+S   A +   CQ+SYCV     T+    P   PP+  +
Sbjct:    5 IVTVLIWTTVAYAEEEKALKEIHEYG------------FQKCQNALNLPVLEVLPGGGWDNLRNMDMGQVMDLTYNNCKTTEDGQYIIPDDVFTIPQKESNLEMNSEILDSWENYRSTTSFSINLNLDYRP---RVNGKFSSEFQRIKTTQVRDQAVTTRAQVRNLVYTVKANPNAELNLGFKKELMEICDRLE-KNQTKMATYLAELLILNYGTHIITSVDAGATLVQEDHVKSSYLKNNKGNRAAVAASAGFTFAKVVNFKIETGFEYQNNLATGYLQNRTGSRVQSIGGIPFYPGMTIETWQKGIINHLVAVDRAGLPLHFFIKPEKLPAFPRHLVEQLAKTVETAAESYYNFNTYPGCTNINSPNFDFQANTDDGSCDGKLVNAPFGGVYQLCRQLSGHDYDDMCLDFHQKNPLTGDFSCPPDYTPVHLLSQTHEKGYTGMECR-DKCILKIFCRTSCKDEFRVAKAEVSSYWCAASSQVPENSGILFGGVFTDKSINPMTNEPSCPTSYFPLKLFENVKVCVSLDHELGPKYSVPFGGFFSCTKGNPL-----YGSFTSGDLEKSFLPK-CPGGFSQQLAAIIDGCQVSYCVKAGVFTRASLAPARLPPYTQL 599          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q5RBP9|MPEG1_PONAB (Macrophage-expressed gene 1 protein OS=Pongo abelii GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 2.334e-119
Identity = 204/561 (36.36%), Postives = 323/561 (57.58%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPF 1812
              VLPG GWDNL N ++G+V+++ YS C+++ DG ++IPD+       +S ++M+S+I+  ++ Y S TS S+N E+S  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P  ELN  FR+ +LD+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S+ +VT +A ++ + T+  K   NY + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVAIDR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+      D  LC+ + QKN  TGD+SCP+G++PV+L S  ++ EG N       C +                  +  FWCV++ +  +   + FGG++++   NP   A SCP  +FP ++  N KVC+S D ELG + ++PFGGF+SC++GNPL       S   G    K C  G+S H AL+   CQ+SYCV +   T G   P   PPF
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQLKDQAITTRVQVRNLIYTVKINPALELNWSFRKELLDISDRLENNQ-TRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVRLLSQIHE-EGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLSLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPA--ISRDLGVPSLKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2KJC3|MPEG1_BOVIN (Macrophage-expressed gene 1 protein OS=Bos taurus GN=MPEG1 PE=2 SV=2)

HSP 1 Score: 378.637 bits (971), Expect = 1.369e-118
Identity = 204/576 (35.42%), Postives = 324/576 (56.25%), Query Frame = 1
Query:  223 VLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPIY------------------ETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKT 1863
            VLPG GWDNL N + G+V+++AYS C+++ DG +++PD+       +S ++M+S I+  +  Y S TS S+N+E+S  +   +++G FS E + IK  Q+K+++  +Q Q+R  +Y V   PD+EL+  F++ ++D+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S+ +VT +A ++    +  K   NY + ++  + Y  N  ++R+ + GG PF    TL  W++ +S +LVA+DR G PL   I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+     +   LC+N+ QKN  TG  SCP+G++PV+L +  ++ EG N       C +Y                    FWC ++G+ S+   + FGG+++    NP   A SCP  +F   +  N KVC S+D ELG++ S+PFGGF+SC+ GNPL       S   G+   + C  G+S H AL+   CQ+SYCV     T G   P+  PP+      S+V     L T
Sbjct:   45 VLPGGGWDNLRNVDTGRVMELAYSHCRTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSSTSNSINMELSLFS---KVNGKFSLEFQRIKTLQVKDQAVTTQVQVRNLVYTVKINPDAELSLGFKKALMDISEQLENNQ-TRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLQDSQSSRSAVTASAGITFLNIVNFKFEENYTSQNTFTKSYLSNRTNSRVQSFGGLPFYPGITLQAWQQGVSNHLVAMDRAGLPLYFFINPERLPDLPGPLVRKLSKTVEAAVRRYYAVNTYPGCTDLSSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQFSGNEVVQLCQNLEQKNPLTGSVSCPSGYSPVQLLTQTHE-EGYNHLECSRKCTLYIFCKTVCEDVFRVARAEFRAFWCAASGQVSENSGLLFGGLFSGKSINPLTNAQSCPAGYFQLKLFENLKVCASLDYELGYRFSIPFGGFFSCAAGNPLVDSA--TSKDLGAPSLRKCPGGFSQHLALISDGCQVSYCVKAGLFTGGSLPPVRLPPYTRPPLMSQVATNTVLVT 613          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|A1L314|MPEG1_MOUSE (Macrophage-expressed gene 1 protein OS=Mus musculus GN=Mpeg1 PE=1 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 7.359e-118
Identity = 202/577 (35.01%), Postives = 323/577 (55.98%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCS-LDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEG-------DNCPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
              VLPG GWDNL N ++G+V+ + Y+ CK++ DG ++IPD+       +S ++M+S+++  +  Y S TS S+N E++  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P SEL+  F + ++D+   +E K  +  A YLA+L++ ++GTHVI SVDAGA L + D ++  +L  ++ SQ++VT +A ++    +  K+  +Y +  S  ++Y  N  ++R+ + GG PF    TL  W+K ++ +LVAIDR G PL+  I    +P     +V ++   ++ A+  YY+ NT  GC ++ S NF+  AN D   C+       FGG+YQ+C+ L  D LC+N+ QKN  TGD+SCP G++PV L S  ++ EG         C +                  +  +WCV+ G+      + FGG++T    NP   A SCP  + P N+  + KVC+S+D ELGFK S+PFGGF+SC MGNPL            S   K C  G+S H A++   CQ+SYCV     T G  LP+  PP+      S+V     + T++
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLE-KNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYSPVHLLSQTHE-EGYSRLECKKKCTLKIFCKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMSQVATNTVIVTNS 612          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2M385|MPEG1_HUMAN (Macrophage-expressed gene 1 protein OS=Homo sapiens GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 1.700e-117
Identity = 203/561 (36.19%), Postives = 321/561 (57.22%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPF 1812
              VLPG GWDNL N ++G+V+++ YS C+++ DG ++IPD+       +S ++M+S+I+  ++ Y S TS S+N E+S  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P  EL+  FR+ +LD+   +EN + +  A YLA+L+V ++GTHV  SVDAGA L + D L+  +L   + S+ +VT +A ++ + T+  K   NY + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVAIDR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+      D  LC+ + QKN  TGD+SCP+G++PV L S  ++ EG N       C +                  +  FWCV++ +  +   + FGG++++   NP   A SCP  +FP  +  N KVC+S D ELG + ++PFGGF+SC++GNPL       S   G+   K C  G+S H AL+   CQ+SYCV +   T G   P   PPF
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLENNQ-TRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHE-EGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPA--ISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q9WV57|MPEG1_RAT (Macrophage-expressed gene 1 protein OS=Rattus norvegicus GN=Mpeg1 PE=2 SV=2)

HSP 1 Score: 370.933 bits (951), Expect = 1.316e-115
Identity = 203/577 (35.18%), Postives = 322/577 (55.81%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCS-LDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEG-------DNCPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
              VLPG GWDNL N ++G+V+ + Y+ CK++ DG ++IPD+       +S ++M+S+I   +  Y S TS S+N E+S  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P SEL+  F   ++D+   +E K  +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L  ++ S+++VT +A ++    +  K+  ++ +     + Y  N  ++R+ + GG PF    TL  W+K ++ +LVAIDR G PL+  I    +P     +V ++   ++ A+  YY+ NT  GC ++ S NF+  AN +   C+       FGGLYQ+C+ L  D+LC+N+ QKN  TGD+SCP+G+TPV L S  ++ EG         C +                  +  +WCV+ G+      + FGG++T    NP   A SCP  + P N+  + KVC+S+D ELG+K S+PFGGF+SC MGNPL           G+   K C  G+S H A++   CQ+SYCV     T G  LP+  PP+      S+V     + TS+
Sbjct:   43 LEVLPGGGWDNLRNIDMGRVIDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEIRDSWVNYQSTTSFSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKNSPTSELSFGFTNALMDICDQLE-KNQTKMATYLAELLVLNYGTHVITSVDAGAALVQEDHIRSSFLLDNQNSENTVTASAGIAFLNIVNFKVETDHTSQTLLTKSYLSNRTNSRVQSFGGIPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGGLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMEDDSCDAKVTNFTFGGLYQECTELSGDALCQNLEQKNLLTGDFSCPSGYTPVHLLSQTHE-EGYSRLECKKKCTLKIFCKTVCEDVFRVAKAQFRAYWCVATGQVPDNSGLLFGGLFTDKSINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGYKFSVPFGGFFSCIMGNPLVNSDTAKDI--GAPSLKKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMSQVATNTVIVTSS 612          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|F1RMG2|F1RMG2_PIG (Uncharacterized protein OS=Sus scrofa GN=MPEG1 PE=4 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 7.015e-119
Identity = 209/588 (35.54%), Postives = 335/588 (56.97%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGY----DLPLY-RPPFIDIKTESEVVNINALKTSAGIK 1878
              VLPG GWDNL N ++G+V+ + Y+ CK++ DG +++PD+       +S ++M+S I+  +  Y S TS S+N+E+S  +   +++G FS E + IK  Q+K+++  +Q QLR  +Y V   PD+EL+  F++ ++D+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S  +VT +A ++    +  K+  +Y + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVA+DR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+     +   LC+N+ QKN  TGD+SCP+G++P++L +  ++ EG N       C +                  +  FWCV++G+ S+   + FGG++++   NP   A SCP  +FP  +  N K+C S D ELGF+ S+PFGGF+SC +GNPL       S   G+   K C  G+S H AL+   CQ+SYCV +   T G+     LP Y RPP +     + V+  N    S+ IK
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMDLTYTHCKTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSTTSYSINMELSLFS---KVNGKFSPEFQRIKSLQVKDQAVTTQVQLRNLVYTVKINPDAELSWGFKKELMDISERLENNQ-TRMATYLAELLVLNYGTHVITSVDAGATLIQEDHIRSSFLQDSQSSHSAVTSSAGITFLNIVNFKLEESYISQNDFTKNYLSNRTNSRVQSIGGLPFYPGITLQAWQQGITNHLVAVDRAGLPLHFFINPDRLPDLPGPLVKKLSKTVETAVRRYYTFNTYPGCTDLNSPNFNFQANVDDGSCEGKMTNFSFGGVYQQCTQLSGNEFVQLCQNLEQKNPLTGDFSCPSGYSPIRLLTQTHE-EGYNRLECSQKCTLLIFCKTVCEDVFRVAKAEFRAFWCVASGQVSENSGLLFGGLFSSKSINPLTNAQSCPAGYFPLRLFENLKICASQDYELGFQFSVPFGGFFSCVVGNPLVDPA--ISGDLGAPSLKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGFLPPARLPPYTRPPLMSQAATNTVMVTNTETASSWIK 623          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|I3Y4E7|I3Y4E7_PIG (Macrophage-expressed 1 OS=Sus scrofa PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 8.760e-119
Identity = 209/588 (35.54%), Postives = 335/588 (56.97%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGY----DLPLY-RPPFIDIKTESEVVNINALKTSAGIK 1878
              VLPG GWDNL N ++G+V+ + Y+ CK++ DG +++PD+       +S ++M+S I+  +  Y S TS S+N+E+S  +   +++G FS E + IK  Q+K+++  +Q QLR  +Y V   PD+EL+  F++ ++D+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S  +VT +A ++    +  K+  +Y + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVA+DR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+     +   LC+N+ QKN  TGD+SCP+G++P++L +  ++ EG N       C +                  +  FWCV++G+ S+   + FGG++++   NP   A SCP  +FP  +  N K+C S D ELGF+ S+PFGGF+SC +GNPL       S   G+   K C  G+S H AL+   CQ+SYCV +   T G+     LP Y RPP +     + V+  N    S+ IK
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMDLTYTHCKTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSTTSYSINMELSLFS---KVNGKFSPEFQRIKSLQVKDQAVTTQVQLRNLVYTVKINPDAELSWGFKKELMDISERLENNQ-TRMATYLAELLVLNYGTHVITSVDAGATLIQGDHIRSSFLQDSQSSHSAVTSSAGITFLNIVNFKLEESYISQNDFTKNYLSNRTNSRVQSIGGLPFYPGITLQAWQQGITNHLVAVDRAGLPLHFFINPDRLPDLPGPLVKKLSKTVETAVRRYYTFNTYPGCTDLNSPNFNFQANVDDGSCEGKMTNFSFGGVYQQCTQLSGNEFVQLCQNLEQKNPLTGDFSCPSGYSPIRLLTQTHE-EGYNRLECSQKCTLLIFCKTVCEDVFRVAKAEFRAFWCVASGQVSENSGLLFGGLFSSKSINPLTNAQSCPAGYFPLRLFENLKICASQDYELGFQFSVPFGGFFSCVVGNPLVDPA--ISGDLGAPSLKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGFLPPARLPPYTRPPLMSQAATNTVMVTNTETASSWIK 623          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|S7P4R0|S7P4R0_MYOBR (Macrophage-expressed protein 1 protein OS=Myotis brandtii GN=D623_10002468 PE=4 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.029e-117
Identity = 212/588 (36.05%), Postives = 332/588 (56.46%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLDDDS----LCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKG----YDLPLY-RPPFIDIKTESEVVNINALKTSAGIK 1878
              VLPG GWDNL N ++G+V+ + Y+ C+++ DG ++IPD+       +S ++M+S+I+  +  Y S TS S+N+E+S  +   +++G FS E + +K  Q+K+++  +Q Q+R  +Y V   P SELN  F++ +LD+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S+ +VT +A    R  +  K   NY + +   + Y  N   +R+ +IGG PF    TL  W++ ++ +LVAIDR G PLN  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+    +    +C+N+ QKN  TGD+SCP+G++P+ L +  Y+ EG N       C +                  ++ FWCV++G+  +   + FGG+++    NP   A SCP  +FP  +  + KVC S D ELG+K S+PFGGF+SC++GNPL       S   G+   K C  G+S H AL+   CQ+SYCV +   T G      LP Y RPP +     + V+  N   +S+ IK
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMDLTYTSCRTTEDGQYIIPDEILTIPQKQSNLEMNSEILESWVNYQSSTSFSINMELSLFS---KVNGKFSPEFQRMKTLQVKDQAITTQVQVRNLIYTVKINPVSELNLEFKKLLLDICDRLENNQ-TRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLLDSQSSRSAVTASAGAVFRNIVNFKFEENYTSQNVFTKSYLSNRTHSRVQSIGGVPFYPGITLQTWQQGITNHLVAIDRAGLPLNFFINPDMLPDLPGPLVKKLSKTVESAVRRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNGAVQVCQNLEQKNPLTGDFSCPSGYSPIHLLTQIYE-EGYNGLECVRKCTLLIFCKTVCEDVFRVAKAEFKAFWCVASGEVPEDSGLLFGGLFSAKSINPLTNAQSCPAGYFPLRLFESLKVCASQDYELGYKFSVPFGGFFSCAVGNPLVDST--KSRDLGAPALKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPYTRPPLMSQAATNTVIVTNTETSSSWIK 623          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|S9XQK4|S9XQK4_CAMFR (Macrophage-expressed gene 1 protein OS=Camelus ferus GN=CB1_001255001 PE=4 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 2.436e-117
Identity = 210/591 (35.53%), Postives = 331/591 (56.01%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN---CPI----------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFP---KACGSGYSSHFALLDGVCQLSYCVSTNALTKG----YDLPLY-RPPFIDIKTESEVVNINALKTSAGIK 1878
              VLPG GWDNL N ++G+V+ + Y+ C+++ DG ++IPD+       +S ++M+S I+  +  Y S TS S+N E+S  +   ++SG FS E + +K  Q+K+++  +Q Q+R  +Y V   PD+EL+  F++ ++D+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S  +VT +A ++    +  K   NY + ++  + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVA+DR G PL   I    +P     +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+     +  SLC+N+ QKN  TGD+SCP+G++P++L S  ++ EG N   CP                       +  FWCV+ G+ ++   + FGG+Y+    NP   A SCP  +FP  +  N KVC S D E+G++ S+PFGGF+SC++GNPL      +S V G       K C  G+S H AL+   CQ+SYC+     T G      LP Y RPP +     + V+  N+    + IK
Sbjct:   25 LGVLPGGGWDNLRNVDMGRVMGLTYTHCRTTEDGQYIIPDEIFTIPQKQSNLEMNSKILESWVNYQSSTSYSINSELSLFS---KVSGKFSPEFQRMKTLQVKDQAVTTQVQVRNLVYTVKINPDAELSLGFKKELMDISDCLENNQ-TRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLQDSQSSHSAVTASAGITFLNIVNFKFEENYTSQNAFTKNYLSNRTNSRVQSIGGLPFYPGITLQTWQQGITNHLVAVDRAGLPLYFFINPDMLPHLPGPLVRKLSKTVETAVRRYYAFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNEVVSLCQNLEQKNPLTGDFSCPSGYSPIQLLSQIHE-EGYNHLECPRKCTFLIFCKTVCEDVFQVAKAEFRAFWCVARGQVAENSGLLFGGLYSGKSINPLTNAQSCPAGYFPLRLFENLKVCASQDYEIGYRFSVPFGGFFSCTVGNPLV-----DSAVTGDLRAPSLKKCPGGFSQHLALISDGCQVSYCIKAGLFTGGSLPPARLPPYCRPPLMSQVATNTVIVTNSETARSWIK 605          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: tr|H2NDC7|H2NDC7_PONAB (Macrophage-expressed gene 1 protein OS=Pongo abelii GN=MPEG1 PE=4 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 2.855e-117
Identity = 204/561 (36.36%), Postives = 323/561 (57.58%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPF 1812
              VLPG GWDNL N ++G+V+++ YS C+++ DG ++IPD+       +S ++M+S+I+  ++ Y S TS S+N E+S  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P  ELN  FR+ +LD+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S+ +VT +A ++ + T+  K   NY + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVAIDR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+      D  LC+ + QKN  TGD+SCP+G++PV+L S  ++ EG N       C +                  +  FWCV++ +  +   + FGG++++   NP   A SCP  +FP ++  N KVC+S D ELG + ++PFGGF+SC++GNPL       S   G    K C  G+S H AL+   CQ+SYCV +   T G   P   PPF
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQLKDQAITTRVQVRNLIYTVKINPALELNWSFRKELLDISDRLENNQ-TRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVRLLSQIHE-EGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLSLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPA--ISRDLGVPSLKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          
The following BLAST results are available for this feature:
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 1
Match NameE-valueIdentityDescription
MPEG13.310e-11836.19macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 4
Match NameE-valueIdentityDescription
mpeg1.16.676e-10334.34macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.37.496e-9833.16macrophage expressed 1, tandem duplicate 3 [Source... [more]
mpeg1.24.530e-9330.74macrophage expressed 1, tandem duplicate 2 [Source... [more]
mpeg1.11.732e-1044.00macrophage expressed 1, tandem duplicate 1 [Source... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 2
Match NameE-valueIdentityDescription
Mpeg13.617e-11935.18macrophage expressed gene 1 [Source:MGI Symbol;Acc... [more]
Pfpl4.230e-11133.33pore forming protein-like [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RBP9|MPEG1_PONAB2.334e-11936.36Macrophage-expressed gene 1 protein OS=Pongo abeli... [more]
sp|Q2KJC3|MPEG1_BOVIN1.369e-11835.42Macrophage-expressed gene 1 protein OS=Bos taurus ... [more]
sp|A1L314|MPEG1_MOUSE7.359e-11835.01Macrophage-expressed gene 1 protein OS=Mus musculu... [more]
sp|Q2M385|MPEG1_HUMAN1.700e-11736.19Macrophage-expressed gene 1 protein OS=Homo sapien... [more]
sp|Q9WV57|MPEG1_RAT1.316e-11535.18Macrophage-expressed gene 1 protein OS=Rattus norv... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|F1RMG2|F1RMG2_PIG7.015e-11935.54Uncharacterized protein OS=Sus scrofa GN=MPEG1 PE=... [more]
tr|I3Y4E7|I3Y4E7_PIG8.760e-11935.54Macrophage-expressed 1 OS=Sus scrofa PE=2 SV=1[more]
tr|S7P4R0|S7P4R0_MYOBR1.029e-11736.05Macrophage-expressed protein 1 protein OS=Myotis b... [more]
tr|S9XQK4|S9XQK4_CAMFR2.436e-11735.53Macrophage-expressed gene 1 protein OS=Camelus fer... [more]
tr|H2NDC7|H2NDC7_PONAB2.855e-11736.36Macrophage-expressed gene 1 protein OS=Pongo abeli... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.837
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableTMHMMTMhelixcoord: 638..660
NoneNo IPR availableCOILSCoilCoilcoord: 14..18
NoneNo IPR availableTMHMMTMhelixcoord: 16..38
NoneNo IPR availableCOILSCoilCoilcoord: 33..38
IPR020864Membrane attack complex component/perforin (MACPF) domainSMARTSM00457MACPF_8coord: 167..367
e-value: 0.0014
score: 24.1
IPR020864Membrane attack complex component/perforin (MACPF) domainPFAMPF01823MACPFcoord: 149..365
e-value: 1.7E-20
score: 73.9
IPR020864Membrane attack complex component/perforin (MACPF) domainPROSITEPS51412MACPF_2coord: 40..369
score: 15.386
IPR019774Aromatic amino acid hydroxylase, C-terminalPROSITEPS51410BH4_AAA_HYDROXYL_2coord: 1..29
score: 8.921

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR020864MACPF
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000058embryonic digestive system
PLANA:0000023temporary embryonic pharynx
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000004Stage 4
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000139 ID=SMED30000139|Name=Macrophage-expressed gene 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2115bp
GTTTGATAAAAGTTATAATTTTATTATTAAATAGTGAAAATGACAATTTT
TATGTTGGGTCGAGTAATTTTATTCCTCTCAATCGGATCCATTTTGGCTG
TGCTGGCTGAGGAGAAAGAGCTAAATATTACTCATCCCCACAAAAATATT
GCCACTTCGAATTTGCCATCAGCCAAATTTGTACATGGATGCCATTTGAC
CAACAATCAGTATCCATTCAATGTGCTTCCTGGATCTGGCTGGGATAATT
TGTCAAACCGCGAGTTGGGACAAGTTCTAAAAGTAGCCTATTCTCGTTGC
AAATCATCCAATGATGGAACCTTTCTCATTCCGGACAAAACAAAAATTAC
GGCGTTTATGAAATCTAGAGTTCAAATGGATTCAGATATTGTAACACACT
TTTCCAAATATTCCTCCTTGACTTCGAAATCAGTAAATCTTGAAGTCAGT
TCTGCAACTCCGAATGTTCAGATCAGCGGTTCATTTTCTTATGAAAAGAA
AGACATCAAGGACAATCAAATGAAAGAAAAATCCGCCTTTTCTCAAACTC
AGTTAAGATATGAATTGTATCGAGTATCCTTCGAACCGGATAGTGAATTG
AATGACAGATTTCGTGAAAGGATCCTTGATCTTGGAGTACTTATAGAGAA
TAAAAAGGGTTCAGCTCATGCTCACTATCTCGCTGATTTGATTGTCAGAG
ATTTCGGAACTCATGTTATTAAATCTGTTGATGCTGGAGCAATTCTTTCA
AAAATTGATGTCCTAAAAGGTGACTATCTTTCAAAACACGAGGGCTCTCA
ACATTCCGTGACATTAGCTGCGTCAGTTAGTATGAGAGAAACACTTGGAA
TTAAAATAAGTGGTAATTACAAAACCGGTCATTCGGAAATGGAAGAGTAC
AACAAAAATTGCGTAAGCACTCGAATCTCTACAATCGGTGGTGGACCTTT
CGGTTCGAATTTCACGCTAACAAAATGGGAAAAAACTCTTTCAACAAATC
TTGTGGCCATTGACCGTATTGGGGAACCGCTTAATCACATTATTACCAAA
CGTAACGTACCGGAGTTTGACGATAAAATTGTGTATGAAATCGGAAACCA
TATCAAGGAAGCAATAAGCCGATATTATTCTGCTAATACTCGAACTGGAT
GCATGGACATTATGTCAAAGAACTTTGATGAAAATGCAAATGCCGACAGT
GGATTATGTAATAACATTGAAAATGGAAATTTCTTTGGGGGTTTATACCA
AAAATGCAGTTTAGACGATGACTCTCTCTGTGAGAATATAATACAAAAAA
ATGCCGCTACTGGGGATTACTCGTGTCCAAATGGGTTCACTCCAGTCAAA
CTATATTCATTCAAGTATAAATGTGAAGGTGATAACTGTCCTATTTATGA
AACCTTCTGGTGTGTCTCTAACGGTAAATCGTCAAAAGGATATGAAATTT
TTTTCGGAGGAATCTACACAACAAATATTCAGAATCCGTTTTATAGGGCT
GACAGTTGTCCGCAATACTTCTTTCCTGCTAATGTTGGAATTAACGGTAA
AGTCTGCATTTCAATGGATAAAGAACTGGGATTTAAAAATAGTTTACCAT
TTGGAGGATTTTACAGCTGTTCTATGGGAAATCCATTAGCTCAAAAGAAA
GGATTTAATTCAACTGTAAATGGAAGTTATTTTCCAAAAGCTTGTGGAAG
TGGCTATTCTTCTCATTTTGCTCTCCTAGATGGTGTCTGTCAGTTGTCCT
ATTGTGTTAGTACTAATGCACTGACAAAGGGATATGACCTACCGTTGTAC
AGACCCCCATTTATTGATATTAAAACGGAATCAGAAGTTGTCAACATCAA
CGCATTGAAAACGTCGGCTGGAATAAAAATGATTCTTTCTGAAAATGGAT
CTTGGGAAACAATGATTCCTGAATTCTATTCCACGTACAAATATGCAATA
ATAACAGTGCTATTTCTCGTGCTATTATCCTTGCTTTTCCTGATGGCAGT
TTTAGCTTGGAAGGGTTTTAGACAATTTCTTGGAAGGATTTTCACTAAAA
TACCTTTAGTGAATAAAAAACAATCAAACCATAAACCGATTCGCGTACAA
ATAAAGGTGACCAGA
back to top

protein sequence of SMED30000139-orf-1

>SMED30000139-orf-1 ID=SMED30000139-orf-1|Name=SMED30000139-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=692bp
MTIFMLGRVILFLSIGSILAVLAEEKELNITHPHKNIATSNLPSAKFVHG
CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDK
TKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFS
YEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGV
LIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKH
EGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIG
GGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYE
IGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFG
GLYQKCSLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDNC
PIYETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVG
INGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPK
ACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEV
VNINALKTSAGIKMILSENGSWETMIPEFYSTYKYAIITVLFLVLLSLLF
LMAVLAWKGFRQFLGRIFTKIPLVNKKQSNHKPIRVQIKVTR
back to top
Aliases
The feature 'Macrophage-expressed gene 1 protein' has the following synonyms
Synonym
MPEG1-like-1