Macrophage-expressed gene 1 protein

Overview
NameMacrophage-expressed gene 1 protein
Smed IDSMED30000139
Uniprot Best hitMacrophage-expressed gene 1 protein OS=Pongo abelii OX=9601 GN=MPEG1 PE=2 SV=1 (E=7.69632e-121)
Length (bp)2115
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Macrophage-expressed gene 1 protein ( MPEG1-like-1 ) is expressed during Stage 3 and Stage 4 in the embryonic digestive system and embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30000139

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
embryonic pharynxSMED30000139 SMED30000139smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
embryonic pharynxSMED30000139 SMED30000139smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
Homology
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 375.941 bits (964), Expect = 1.202e-119
Identity = 203/561 (36.19%), Postives = 321/561 (57.22%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPF 1812
              VLPG GWDNL N ++G+V+++ YS C+++ DG ++IPD+       +S ++M+S+I+  ++ Y S TS S+N E+S  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P  EL+  FR+ +LD+   +EN + +  A YLA+L+V ++GTHV  SVDAGA L + D L+  +L   + S+ +VT +A ++ + T+  K   NY + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVAIDR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+      D  LC+ + QKN  TGD+SCP+G++PV L S  ++ EG N       C +                  +  FWCV++ +  +   + FGG++++   NP   A SCP  +FP  +  N KVC+S D ELG + ++PFGGF+SC++GNPL       S   G+   K C  G+S H AL+   CQ+SYCV +   T G   P   PPF
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLENNQ-TRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHE-EGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPA--ISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 334.724 bits (857), Expect = 3.476e-104
Identity = 204/594 (34.34%), Postives = 310/594 (52.19%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL---DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSF-------KYKCE-------------------GDNCPI----YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGK-VCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
            C   ++     VLPG GWDNL N ++G+V+ ++YS+C+++ DG +LIPD+  +     S V+ +S+I+  + +  S TS SVN +VS  +    ++  FS E + +K +Q+KE S  ++ Q+R  LY V   PD  L+ RF ++  ++   IEN + + HA+YL++ +V D+GTHVI SVDAGA L + D LK  Y+S  +  + SV+ +A  +  + +   I GN   G S+   Y  N   + I + GG  F    TL KW+++   NLVAIDR G PL++ +     P+     V ++ + +++A  RYY  NT  GC+++ S NF+  AN D   C        FGG+YQ+C+    D + +C+   QKN ATG YSCP  +    L+S         Y+C                    GD+  +     ET WC S  K+ +     FGG++   IQNP  ++ SCP  +F      NG  +C+S D E+G + S+PF GF+SC  GNPL+         NG      C   +S H A +   CQ+ YCV +   + G+  P+  PPF    T   VV + A  T A
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAIENNQ-TRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLS---------NGQ---SRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPF----TRPPVVGMIATNTVA 606          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 334.724 bits (857), Expect = 3.476e-104
Identity = 204/594 (34.34%), Postives = 310/594 (52.19%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL---DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSF-------KYKCE-------------------GDNCPI----YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGK-VCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
            C   ++     VLPG GWDNL N ++G+V+ ++YS+C+++ DG +LIPD+  +     S V+ +S+I+  + +  S TS SVN +VS  +    ++  FS E + +K +Q+KE S  ++ Q+R  LY V   PD  L+ RF ++  ++   IEN + + HA+YL++ +V D+GTHVI SVDAGA L + D LK  Y+S  +  + SV+ +A  +  + +   I GN   G S+   Y  N   + I + GG  F    TL KW+++   NLVAIDR G PL++ +     P+     V ++ + +++A  RYY  NT  GC+++ S NF+  AN D   C        FGG+YQ+C+    D + +C+   QKN ATG YSCP  +    L+S         Y+C                    GD+  +     ET WC S  K+ +     FGG++   IQNP  ++ SCP  +F      NG  +C+S D E+G + S+PF GF+SC  GNPL+         NG      C   +S H A +   CQ+ YCV +   + G+  P+  PPF    T   VV + A  T A
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKVSGVETNSEIIMSWLEQKSSTSSSVNADVSFFS---VLNAKFSTENQRMKTHQVKEGSVTARVQVRNHLYTVKAYPDFTLDSRFAKQAEEIADAIENNQ-TRHANYLSEKLVLDYGTHVITSVDAGATLVQEDYLKMSYISNSQSDKSSVSASAGANFFDKVKFDIGGNTSQGSSQSSSYQGNITYSLIQSHGGALFYPGITLQKWQQSTLNNLVAIDRSGLPLHYFLNPSTFPDLPTPTVNKLASTVRKAAERYYKVNTIPGCVNVDSPNFNFQANVDDASCEGPITNLSFGGIYQRCTPLTPDGNIICDETAQKNPATGGYSCPQHYNTTLLHSEIVEKGFNHYECHTHCHSCGFLGLSTCCDKTCGDSYHVRRAKLETLWCSSTHKTPENSGYLFGGLFGPGIQNPLTKSSSCPPSYFTQRFLSNGMMICMSNDYEIGTRFSVPFAGFFSCQSGNPLS---------NGQ---SRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGHLKPVRLPPF----TRPPVVGMIATNTVA 606          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.3 (macrophage expressed 1, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-081105-5])

HSP 1 Score: 320.087 bits (819), Expect = 4.142e-99
Identity = 191/576 (33.16%), Postives = 301/576 (52.26%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCS---LDDDSLCENIIQKNAATGDYSCPNGFTPVKLYS-------FKYKCEGDNC------------------------PIYETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGING-KVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPF 1812
            CH  +N     VLPG GWDNL N ++G+V+ ++YS+C+++ DG +LIPD+  +    ++ V+ +S+++  +    S TS S+N +VS  +    ++G FS E + IK +Q+KE S  S+ Q+R  LY V   P+  L+ RF +++ ++   I N + +  A YL++ ++ D+GTHVI SV+AGA L + D LK  Y+ K++    SV+ +A  +  + + +  S N     S    Y  N   + I + GG  F    TL KW+++   NLVAIDR G PL++ +     P+  + +V ++   + +A  +YY  NT  GC+++ SKNF+  AN D   C        FGG+YQ+C+   +D  ++C+ + QKN ATG YSC   +    L S        +Y+C+ DNC                           +T WC S  K  +     FGG+Y  ++QNPF R+ +CP  FF   +      VC+S D     K+++PFGGF+SC  GNPL+         NG      C   +S H A +   CQ+ YCV +   + G   P+  PP+
Sbjct:   33 CHKNSNLVALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDEVFVIPQKENTVETNSEMIMSWLDQKSSTSSSINADVSFFS---WLNGKFSREHQRIKTHQVKESSVTSRVQVRNRLYTVKAYPNFPLDSRFAQQVEEIADAITNDQ-TRLATYLSEKLILDYGTHVITSVEAGASLVQEDYLKMSYILKNQLDLSSVSASAGFNFFDKVKLDPSYNGGQKTSLNSSYQGNITYSLIQSHGGALFYPGMTLQKWQESTLNNLVAIDRSGLPLHYFLNPSTFPDISEALVRKLALSVSQAAEQYYKVNTIPGCVNVDSKNFNFQANVDDVSCEGPITNLSFGGMYQQCTPLTIDGSTICDEMAQKNPATGGYSCSQKYNTTLLRSEIIERGYTRYECQ-DNCRSCGFLGWSTCCSQTCNNVNYIRRAKVDTLWCYSTQKIPEYSGYIFGGLYGPSMQNPFTRSYTCPPNFFVQPILSRAIMVCLSNDYVKATKSAVPFGGFFSCQSGNPLS---------NGE---SRCPPQFSQHLAAISDGCQVLYCVQSGVFSGGQLKPVLLPPY 591          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.2 (macrophage expressed 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-050522-305])

HSP 1 Score: 308.531 bits (789), Expect = 2.919e-94
Identity = 182/592 (30.74%), Postives = 300/592 (50.68%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKC---SLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSF-------KYKC--EGDNCPI-------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGING-KVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
            C   +N     VLPG GWDNL N ++G+V+ + YS+C+++ DG +LIPD+  +     S V+  S+ +  +    S TS S+N + S  T    ++G FS E   +K +Q++  S  ++ Q+R  LY V+  PD  L+ RF ++I +L   IEN + +  A YL++ ++ ++GTHVI S+DAGA L + D +K  Y+S     + SV+ +A ++    +            SE   Y +N   + + + GG  F    T+ KW+++   +LVAIDR G P+++ +     P+     ++++   +++A  RYY+ NT  GC D  S+NF+  AN +   C        FGG+YQ C   S D + +C+   Q+N  TGD++C   ++  +L+S         Y+C  E  +C +                    +T+WC ++    +     FGG++  ++QNP  ++  CP  +F      NG ++C+S D E G  +S+PFGG +SC  GNP A  +              C   YS H A +   CQ+ YCV +   T G   P++ PPF    T+  ++N+ A  T A
Sbjct:   30 CRQNSNLTALEVLPGGGWDNLRNLDVGRVMNLTYSQCQTTEDGLYLIPDEVFVIPRKTSGVETHSETIMSWLDQRSSTSGSINADASYLTV---LNGKFSEENTRMKIHQVRGNSVTTRVQVRNHLYTVNAYPDFTLDSRFSQQISELADAIENNQ-TRQAMYLSEKVILEYGTHVITSIDAGATLVQEDYIKRSYVSDTNSERSSVSASAGINFFNMVNFNFGSKETEQTSETLTYQQNITYSLVQSHGGALFYQGITMQKWQESTQNHLVAIDRSGLPIHYFLNPAVFPDLPVPTLHKLAFSVQKAAERYYNINTTPGCTDQSSQNFNFQANVNDTSCEGPVTNLTFGGVYQTCTPESPDGNVICDEFAQRNPDTGDFTCRQPYSATRLHSENVQQGYNNYECHEECHSCWLILDCCHQVCGNVYYVRQAQIDTYWCSTSQTVPENTGYLFGGLFGPSLQNPQTKSHDCPANYFEQVFLTNGMRICLSNDYEAGTISSVPFGGLFSCQSGNPQAGNQ------------YRCPPQYSQHLATISDGCQVLYCVQSGVFTGGQLKPVHLPPF----TKPPLINMMATNTVA 601          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Match: mpeg1.1 (macrophage expressed 1, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7347])

HSP 1 Score: 60.8474 bits (146), Expect = 4.503e-11
Identity = 22/50 (44.00%), Postives = 36/50 (72.00%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDK 339
            C   ++     VLPG GWDNL N ++G+V+ ++YS+C+++ DG +LIPD+
Sbjct:   33 CRKNSSLTALEVLPGGGWDNLRNIDMGRVMNLSYSQCQTTEDGVYLIPDE 82          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Mpeg1 (macrophage expressed gene 1 [Source:MGI Symbol;Acc:MGI:1333743])

HSP 1 Score: 377.867 bits (969), Expect = 1.355e-120
Identity = 203/577 (35.18%), Postives = 323/577 (55.98%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCS-LDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEG-------DNCPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
              VLPG GWDNL N ++G+V+ + Y+ CK++ DG ++IPD+       +S ++M+S+++  +  Y S TS S+N E++  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P SEL+  F + ++D+   +E K  +  A YLA+L++ ++GTHVI SVDAGA L + D ++  +L  ++ SQ++VT +A ++    +  K+  +Y +  S  ++Y  N  ++R+ + GG PF    TL  W+K ++ +LVAIDR G PL+  I    +P     +V ++   ++ A+  YY+ NT  GC ++ S NF+  AN D   C+       FGG+YQ+C+ L  D LC+N+ QKN  TGD+SCP G+TPV L S  ++ EG         C +                  +  +WCV+ G+      + FGG++T    NP   A SCP  + P N+  + KVC+S+D ELGFK S+PFGGF+SC MGNPL            S   K C  G+S H A++   CQ+SYCV     T G  LP+  PP+      S+V     + T++
Sbjct:   50 LEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLE-KNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYTPVHLLSQTHE-EGYSRLECKKKCTLKIFCKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMSQVATNTVIVTNS 619          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Match: Pfpl (pore forming protein-like [Source:MGI Symbol;Acc:MGI:1860266])

HSP 1 Score: 356.295 bits (913), Expect = 1.788e-112
Identity = 206/618 (33.33%), Postives = 324/618 (52.43%), Query Frame = 1
Query:   67 ILFLSIGSILAVLAEEKELNITHPHKNIATSNLPSAKFVHGCHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKY-------KCEGDNCPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNG----SYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDI 1821
            I+ + I + +A   EEK L   H +                C    N     VLPG GWDNL N ++GQV+ + Y+ CK++ DG ++IPD        +S ++M+S+I+  +  Y S TS S+NL +       +++G FS E + IK  Q+++++  ++ Q+R  +Y V   P++ELN  F++ ++++   +E K  +  A YLA+L++ ++GTH+I SVDAGA L + D +K  YL  ++G++ +V  +A  +  + +  KI   ++  ++    Y +N   +R+ +IGG PF    T+  W+K +  +LVA+DR G PL+  I    +P F   +V ++   ++ A   YY+ NT  GC +I S NFD  AN D G C+       FGG+YQ C      D D +C +  QKN  TGD+SCP  +TPV L S  +       +C  D C +                    ++WC ++ +  +   I FGG++T    NP     SCP  +FP  +  N KVC+S+D ELG K S+PFGGF+SC+ GNPL     + S  +G    S+ PK C  G+S   A +   CQ+SYCV     T+    P   PP+  +
Sbjct:    5 IVTVLIWTTVAYAEEEKALKEIHEYG------------FQKCQNALNLPVLEVLPGGGWDNLRNMDMGQVMDLTYNNCKTTEDGQYIIPDDVFTIPQKESNLEMNSEILDSWENYRSTTSFSINLNLDYRP---RVNGKFSSEFQRIKTTQVRDQAVTTRAQVRNLVYTVKANPNAELNLGFKKELMEICDRLE-KNQTKMATYLAELLILNYGTHIITSVDAGATLVQEDHVKSSYLKNNKGNRAAVAASAGFTFAKVVNFKIETGFEYQNNLATGYLQNRTGSRVQSIGGIPFYPGMTIETWQKGIINHLVAVDRAGLPLHFFIKPEKLPAFPRHLVEQLAKTVETAAESYYNFNTYPGCTNINSPNFDFQANTDDGSCDGKLVNAPFGGVYQLCRQLSGHDYDDMCLDFHQKNPLTGDFSCPPDYTPVHLLSQTHEKGYTGMECR-DKCILKIFCRTSCKDEFRVAKAEVSSYWCAASSQVPENSGILFGGVFTDKSINPMTNEPSCPTSYFPLKLFENVKVCVSLDHELGPKYSVPFGGFFSCTKGNPL-----YGSFTSGDLEKSFLPK-CPGGFSQQLAAIIDGCQVSYCVKAGVFTRASLAPARLPPYTQL 599          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q5RBP9|MPEG1_PONAB (Macrophage-expressed gene 1 protein OS=Pongo abelii OX=9601 GN=MPEG1 PE=2 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 7.696e-121
Identity = 204/561 (36.36%), Postives = 323/561 (57.58%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPF 1812
              VLPG GWDNL N ++G+V+++ YS C+++ DG ++IPD+       +S ++M+S+I+  ++ Y S TS S+N E+S  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P  ELN  FR+ +LD+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S+ +VT +A ++ + T+  K   NY + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVAIDR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+      D  LC+ + QKN  TGD+SCP+G++PV+L S  ++ EG N       C +                  +  FWCV++ +  +   + FGG++++   NP   A SCP  +FP ++  N KVC+S D ELG + ++PFGGF+SC++GNPL       S   G    K C  G+S H AL+   CQ+SYCV +   T G   P   PPF
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQLKDQAITTRVQVRNLIYTVKINPALELNWSFRKELLDISDRLENNQ-TRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVRLLSQIHE-EGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLSLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPA--ISRDLGVPSLKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2KJC3|MPEG1_BOVIN (Macrophage-expressed gene 1 protein OS=Bos taurus OX=9913 GN=MPEG1 PE=2 SV=2)

HSP 1 Score: 378.637 bits (971), Expect = 4.573e-120
Identity = 204/576 (35.42%), Postives = 324/576 (56.25%), Query Frame = 1
Query:  223 VLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPIY------------------ETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKT 1863
            VLPG GWDNL N + G+V+++AYS C+++ DG +++PD+       +S ++M+S I+  +  Y S TS S+N+E+S  +   +++G FS E + IK  Q+K+++  +Q Q+R  +Y V   PD+EL+  F++ ++D+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S+ +VT +A ++    +  K   NY + ++  + Y  N  ++R+ + GG PF    TL  W++ +S +LVA+DR G PL   I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+     +   LC+N+ QKN  TG  SCP+G++PV+L +  ++ EG N       C +Y                    FWC ++G+ S+   + FGG+++    NP   A SCP  +F   +  N KVC S+D ELG++ S+PFGGF+SC+ GNPL       S   G+   + C  G+S H AL+   CQ+SYCV     T G   P+  PP+      S+V     L T
Sbjct:   45 VLPGGGWDNLRNVDTGRVMELAYSHCRTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSSTSNSINMELSLFS---KVNGKFSLEFQRIKTLQVKDQAVTTQVQVRNLVYTVKINPDAELSLGFKKALMDISEQLENNQ-TRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLQDSQSSRSAVTASAGITFLNIVNFKFEENYTSQNTFTKSYLSNRTNSRVQSFGGLPFYPGITLQAWQQGVSNHLVAMDRAGLPLYFFINPERLPDLPGPLVRKLSKTVEAAVRRYYAVNTYPGCTDLSSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQFSGNEVVQLCQNLEQKNPLTGSVSCPSGYSPVQLLTQTHE-EGYNHLECSRKCTLYIFCKTVCEDVFRVARAEFRAFWCAASGQVSENSGLLFGGLFSGKSINPLTNAQSCPAGYFQLKLFENLKVCASLDYELGYRFSIPFGGFFSCAAGNPLVDSA--TSKDLGAPSLRKCPGGFSQHLALISDGCQVSYCVKAGLFTGGSLPPVRLPPYTRPPLMSQVATNTVLVT 613          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|A1L314|MPEG1_MOUSE (Macrophage-expressed gene 1 protein OS=Mus musculus OX=10090 GN=Mpeg1 PE=1 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 2.479e-119
Identity = 202/577 (35.01%), Postives = 323/577 (55.98%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCS-LDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEG-------DNCPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
              VLPG GWDNL N ++G+V+ + Y+ CK++ DG ++IPD+       +S ++M+S+++  +  Y S TS S+N E++  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P SEL+  F + ++D+   +E K  +  A YLA+L++ ++GTHVI SVDAGA L + D ++  +L  ++ SQ++VT +A ++    +  K+  +Y +  S  ++Y  N  ++R+ + GG PF    TL  W+K ++ +LVAIDR G PL+  I    +P     +V ++   ++ A+  YY+ NT  GC ++ S NF+  AN D   C+       FGG+YQ+C+ L  D LC+N+ QKN  TGD+SCP G++PV L S  ++ EG         C +                  +  +WCV+ G+      + FGG++T    NP   A SCP  + P N+  + KVC+S+D ELGFK S+PFGGF+SC MGNPL            S   K C  G+S H A++   CQ+SYCV     T G  LP+  PP+      S+V     + T++
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEVLESWMNYQSTTSLSINTELALFS---RVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKTTPTSELSLGFTKALMDICDQLE-KNQTKMATYLAELLILNYGTHVITSVDAGAALVQEDHVRSSFLLDNQNSQNTVTASAGIAFLNIVNFKVETDYISQTSLTKDYLSNRTNSRVQSFGGVPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGPLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMDDDSCDAKVTNFTFGGVYQECTELSGDVLCQNLEQKNLLTGDFSCPPGYSPVHLLSQTHE-EGYSRLECKKKCTLKIFCKTVCEDVFRVAKAEFRAYWCVAAGQVPDNSGLLFGGVFTDKTINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGFKFSVPFGGFFSCIMGNPLVNSDTAKDVRAPSL--KKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMSQVATNTVIVTNS 612          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q2M385|MPEG1_HUMAN (Macrophage-expressed gene 1 protein OS=Homo sapiens OX=9606 GN=MPEG1 PE=1 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 5.774e-119
Identity = 203/561 (36.19%), Postives = 321/561 (57.22%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPF 1812
              VLPG GWDNL N ++G+V+++ YS C+++ DG ++IPD+       +S ++M+S+I+  ++ Y S TS S+N E+S  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P  EL+  FR+ +LD+   +EN + +  A YLA+L+V ++GTHV  SVDAGA L + D L+  +L   + S+ +VT +A ++ + T+  K   NY + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVAIDR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+      D  LC+ + QKN  TGD+SCP+G++PV L S  ++ EG N       C +                  +  FWCV++ +  +   + FGG++++   NP   A SCP  +FP  +  N KVC+S D ELG + ++PFGGF+SC++GNPL       S   G+   K C  G+S H AL+   CQ+SYCV +   T G   P   PPF
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMELTYSNCRTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLENNQ-TRMATYLAELLVLNYGTHVTTSVDAGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGGVPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHE-EGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPA--ISRDLGAPSLKKCPGGFSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPF 596          
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Match: sp|Q9WV57|MPEG1_RAT (Macrophage-expressed gene 1 protein OS=Rattus norvegicus OX=10116 GN=Mpeg1 PE=2 SV=2)

HSP 1 Score: 370.933 bits (951), Expect = 4.601e-117
Identity = 203/577 (35.18%), Postives = 322/577 (55.81%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCS-LDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEG-------DNCPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
              VLPG GWDNL N ++G+V+ + Y+ CK++ DG ++IPD+       +S ++M+S+I   +  Y S TS S+N E+S  +   +++G FS E + +K  Q+K+++  ++ Q+R  +Y V   P SEL+  F   ++D+   +E K  +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L  ++ S+++VT +A ++    +  K+  ++ +     + Y  N  ++R+ + GG PF    TL  W+K ++ +LVAIDR G PL+  I    +P     +V ++   ++ A+  YY+ NT  GC ++ S NF+  AN +   C+       FGGLYQ+C+ L  D+LC+N+ QKN  TGD+SCP+G+TPV L S  ++ EG         C +                  +  +WCV+ G+      + FGG++T    NP   A SCP  + P N+  + KVC+S+D ELG+K S+PFGGF+SC MGNPL           G+   K C  G+S H A++   CQ+SYCV     T G  LP+  PP+      S+V     + TS+
Sbjct:   43 LEVLPGGGWDNLRNIDMGRVIDLTYTNCKTTEDGQYIIPDEVYTIPQKESNLEMNSEIRDSWVNYQSTTSFSINTELSLFS---KVNGKFSTEFQRMKTLQVKDQAVTTRVQVRNRIYTVKNSPTSELSFGFTNALMDICDQLE-KNQTKMATYLAELLVLNYGTHVITSVDAGAALVQEDHIRSSFLLDNQNSENTVTASAGIAFLNIVNFKVETDHTSQTLLTKSYLSNRTNSRVQSFGGIPFYPGITLETWQKGITNHLVAIDRAGLPLHFFIKPDKLPGLPGGLVKKLSKTVETAVRHYYTFNTHPGCTNVDSPNFNFQANMEDDSCDAKVTNFTFGGLYQECTELSGDALCQNLEQKNLLTGDFSCPSGYTPVHLLSQTHE-EGYSRLECKKKCTLKIFCKTVCEDVFRVAKAQFRAYWCVATGQVPDNSGLLFGGLFTDKSINPMTNAQSCPAGYIPLNLFESLKVCVSLDYELGYKFSVPFGGFFSCIMGNPLVNSDTAKDI--GAPSLKKCPGGFSQHLAVISDGCQVSYCVKAGIFTGGSLLPVRLPPYTKPPLMSQVATNTVIVTSS 612          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23441982 (tr|A0A2B4RFA8|A0A2B4RFA8_STYPI Macrophage-expressed gene 1 protein OS=Stylophora pistillata OX=50429 GN=Mpeg1 PE=4 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 4.562e-125
Identity = 213/594 (35.86%), Postives = 335/594 (56.40%), Query Frame = 1
Query:  148 IATSNLPSAKFVHG----CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLD---DDSLCENIIQKNAATGDYSCPNGFTPVKLYSFK------YKCEG----DNCPI------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKG---------------FNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNAL-TKGYDLPLYRPPF 1812
            +++ N  S +F  G    C L +  Y F VLPG GWDNL N  +G V  + YS+CK+S+DG +LIPD   +    +S+V + +++  H++ YSS T+KS+N E S       +SGS+S E + +K +Q+++KS  ++ QLR++LY V  +PD+ L   F+ R+L++   +++   +A+A +LA ++VRDFGTH + SV AGA L+K+D L   +++  +  +  +T AAS S     G   S    T    +++Y KN   + + T GG PF  NFT+ +WE  ++  LVA+DR G+PL+  IT  +VPE  +++V+++ + +++AI +YY  NT  GC  + S +F   AN D G C +  N   FGG+YQ C  +     + C + +QKN  T DY+C NG+ PV ++  +       +C G     +C        Y T+WCV+ G         FGG+Y+  ++NP  +  SCP  F+    G    VC+S D ELGF+ S+PFGGF+SC+ GNPL  KK                F      S +PK C  GYS H   ++  C++++CV +N   +KG+ + + RPP+
Sbjct:   28 VSSENDSSPRFPVGDPRNCPLASGVYRFEVLPGGGWDNLRNLHMGAVSVMNYSKCKTSDDGKYLIPDDVFLYPVKESKVHVFAEMYDHWNNYSSTTTKSINAEASGTFGFGSVSGSYSSEFESVKKHQVEDKSVTTRAQLRHDLYTVKLQPDAPLQPAFKSRLLEIASHLQHNN-TAYASFLAQVLVRDFGTHYVTSVMAGAALAKVDHLTKKFVADFDEDKSKITAAASASFFGVFGASASYTQTTDKKVLDQYTKNTAYSTVYTFGGPPFRVNFTINEWEDQMADELVAVDRSGDPLHFAITHGSVPELSEELVFKLASVVEKAIKQYYEHNTIKGCTKMDSPDFSFQANLDDGSCESPTNNYTFGGVYQTCQCEGSPSSNPCGSFVQKNPLTADYTCSNGYEPVMVHQGRTPQTCHRECHGWWIFKSCDTYCGFANYYTYWCVAKGAVPPNTGYLFGGLYSNVLKNPVTQDHSCPLKFYALRFGATMHVCVSDDYELGFQQSVPFGGFFSCNTGNPLGVKKSSSRAKGSNGHSSLELFVKQSGSSVWPKTCPIGYSQHLGAIEENCEINFCVKSNVFNSKGFPI-IKRPPY 619          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23535608 (tr|A0A210Q242|A0A210Q242_MIZYE Macrophage-expressed gene 1 protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10885 PE=4 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.074e-122
Identity = 218/615 (35.45%), Postives = 327/615 (53.17%), Query Frame = 1
Query:  196 LTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFG-SNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLDDD---SLCENIIQKNAATGDYSCPNGFTPV--------------KLYSFKY----KCEGD----NCPIYETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQK-----------------KGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLP-LYRPPFIDIKTESEVVNINALKTSAGI---KMILSENG 1899
            L  N   + VLPG GWDNL N+  GQV+   YS C++++DG +L+PD        KS+++  +++ TH+  Y+S TS +VN E      +  I GSFS+E   ++  QM ++S  ++ Q+RY  Y    +PD+  N +F+ R+L +   I  K  +  A Y + L+VRDFGTHVI SVDAGA L + D +K  Y   +   +  V  +AS S     GIK   ++ T +  +++Y  N   +   TIGG  F   NF+L  W ++++ NLVA+DR G+PL+ +IT   +PE    +VYE+  H+K+AI+ YY  N   GC +  S NF   AN D G C ++ N   FGG+YQ CSL  +   + C ++ Q N  TGD SCP  +  V              + +S  +     C GD        Y  FWCV+ GK        FGG++T+ I NP     +CP YF+   V  + +VC+S D ELG++ S+PF GF+SC  GNPL                    + F  +   S++P+ C +GYS H A++   C++SYC+  NAL+ G  LP + RPPF++I       N + + +  G+    ++ S NG
Sbjct:   48 LNKNVIRYEVLPGGGWDNLRNKHGGQVIYYNYSLCQTTDDGQYLLPDGINTVPLKKSKLETFAELFTHWQNYTSTTSSTVNAEAGFHIEHFGIGGSFSHETGSVRSRQMMDESVTTRVQMRYVRYSAKLQPDTAFNPKFKARLLTIATQIA-KNQTNMARYESQLLVRDFGTHVITSVDAGAALVQQDQIKTTYARSYSMDKSKVMASASASFGSVFGIKTGYDHSTSNEMIDQYLGNRTHSETDTIGGSVFQPQNFSLNDWAESVAENLVAVDRAGDPLHFVITPMALPELPSSVVYELIMHVKDAINLYYKHNIYKGCTNADSPNFSFQANVDDGTCQSLSNNYTFGGVYQTCSLSGNIRSNTCADLRQMNPLTGDDSCPPNYEAVMIDKGIKRTPNTVRRCHSCGFLGFSTCCGDYAASQTASYTGFWCVTTGKVPADSGYLFGGLFTSTIGNPLTGGRTCPPYFYALKVSSSLRVCVSDDYELGYRYSVPFAGFFSCRTGNPLKLTSDEEDRHKRSNTDMFVLETFLKSAGPSHWPRGCPTGYSEHMAVVANGCEISYCIKANALS-GEGLPTIVRPPFMEIPITGFSDNSSVMISEDGLTWTDVVESRNG 660          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|21114645 (tr|A0A2T7NUR8|A0A2T7NUR8_POMCA MACPF domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_15422 PE=4 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 5.983e-120
Identity = 210/574 (36.59%), Postives = 316/574 (55.05%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPF-GSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYS-----------------FKYKCEGD---NCPIYETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANV--GINGKVCISMDKELGFKNSLPFGGFYSCSMGNPL--AQKKGFNSTVNGSY------------FPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFI 1815
            F VLPG GWDNL N + GQV+   YS+C++++D  FL+PD         S V + +++ TH+S ++S TSKS+N+E       V ISG FS   +D+K   + +KS  +++Q+RY  Y V  +PDS L+  FR R+LD+    +  + +  A YL+ L+VRDFGTHV+   +AGA L ++D LK D+++K+   + S+  AASV++     + +S    T +S    Y  N  S+ + T+GG  +  SNFT   W   +  +LVA+DR G+PL+ I+T   +PE     + ++   ++EA+  YYS NT  GCM+  S NF   AN + G C+ I +   FGG++Q C++    +D  LC+ + Q N  TG YSCP  + PV L+S                 F + C  D   +   Y  +WC ++G         FGG+YT+++ N   ++ SCP  FF   +  G++  VC+S D ELG +N++PF GF SC+ GNPL    K G   ++  S+            +PK C   YS H A +DG CQ+ YCV T AL      P+ RPPF+
Sbjct:   58 FEVLPGFGWDNLRNVDQGQVVNFNYSQCRTTDDMRFLLPDSVSTVPVKTSSVAIFAELFTHWSNWTSTTSKSINVEAGLDLSKVAISGKFSDSFQDMKSKAIGDKSMATRSQVRYTRYVVQLQPDSPLHPTFRGRLLDIAAAHQLNQ-TKMARYLSQLLVRDFGTHVVTRAEAGATLVQVDHLKEDWVTKYADQKSSILAAASVTLFSVFHMSVSYGTSTDNSFTTSYQTNRTSSVVKTMGGPSYRPSNFTPDAWAVLVDGDLVAVDRAGDPLHFIVTSTALPELPASTLAQVAGSVQEAVDAYYSFNTIPGCMNPSSPNFAPAANIEDGSCHPIVSNMTFGGVFQTCTMSPNSNDGDLCQGMSQVNPLTGTYSCPPNYQPVLLHSDTMQTSRSVHSCHSCWLFFHCCHDDYYHSEGTYSMYWCAASGPIPDHTGYLFGGLYTSHVANGVTQSMSCPPTFFALKLGSGLDLHVCVSDDFELGTENAVPFAGFISCAAGNPLVVGGKPGSEKSLQASHNLRSFFQDKPSSWPKRCPDNYSKHLATIDGGCQIDYCVQTGALAGPVLPPVKRPPFM 630          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|27630001 (tr|I3Y4E7|I3Y4E7_PIG Macrophage-expressed 1 OS=Sus scrofa OX=9823 PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 6.699e-120
Identity = 209/588 (35.54%), Postives = 335/588 (56.97%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSL----DDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGY----DLPLY-RPPFIDIKTESEVVNINALKTSAGIK 1878
              VLPG GWDNL N ++G+V+ + Y+ CK++ DG +++PD+       +S ++M+S I+  +  Y S TS S+N+E+S  +   +++G FS E + IK  Q+K+++  +Q QLR  +Y V   PD+EL+  F++ ++D+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S  +VT +A ++    +  K+  +Y + +   + Y  N  ++R+ +IGG PF    TL  W++ ++ +LVA+DR G PL+  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+     +   LC+N+ QKN  TGD+SCP+G++P++L +  ++ EG N       C +                  +  FWCV++G+ S+   + FGG++++   NP   A SCP  +FP  +  N K+C S D ELGF+ S+PFGGF+SC +GNPL       S   G+   K C  G+S H AL+   CQ+SYCV +   T G+     LP Y RPP +     + V+  N    S+ IK
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMDLTYTHCKTTEDGQYIVPDEIFTIPQKQSNLEMNSKILESWVNYQSTTSYSINMELSLFS---KVNGKFSPEFQRIKSLQVKDQAVTTQVQLRNLVYTVKINPDAELSWGFKKELMDISERLENNQ-TRMATYLAELLVLNYGTHVITSVDAGATLIQGDHIRSSFLQDSQSSHSAVTSSAGITFLNIVNFKLEESYISQNDFTKNYLSNRTNSRVQSIGGLPFYPGITLQAWQQGITNHLVAVDRAGLPLHFFINPDRLPDLPGPLVKKLSKTVETAVRRYYTFNTYPGCTDLNSPNFNFQANVDDGSCEGKMTNFSFGGVYQQCTQLSGNEFVQLCQNLEQKNPLTGDFSCPSGYSPIRLLTQTHE-EGYNRLECSQKCTLLIFCKTVCEDVFRVAKAEFRAFWCVASGQVSENSGLLFGGLFSSKSINPLTNAQSCPAGYFPLRLFENLKICASQDYELGFQFSVPFGGFFSCVVGNPLVDPA--ISGDLGAPSLKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGFLPPARLPPYTRPPLMSQAATNTVMVTNTETASSWIK 623          
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|28340381 (tr|S7P4R0|S7P4R0_MYOBR Macrophage-expressed protein 1 protein OS=Myotis brandtii OX=109478 GN=D623_10002468 PE=4 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 7.999e-119
Identity = 212/588 (36.05%), Postives = 332/588 (56.46%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLDDDS----LCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDN-------CPI------------------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKG----YDLPLY-RPPFIDIKTESEVVNINALKTSAGIK 1878
              VLPG GWDNL N ++G+V+ + Y+ C+++ DG ++IPD+       +S ++M+S+I+  +  Y S TS S+N+E+S  +   +++G FS E + +K  Q+K+++  +Q Q+R  +Y V   P SELN  F++ +LD+   +EN + +  A YLA+L+V ++GTHVI SVDAGA L + D ++  +L   + S+ +VT +A    R  +  K   NY + +   + Y  N   +R+ +IGG PF    TL  W++ ++ +LVAIDR G PLN  I    +P+    +V ++   ++ A+ RYY+ NT  GC D+ S NF+  AN D G C        FGG+YQ+C+    +    +C+N+ QKN  TGD+SCP+G++P+ L +  Y+ EG N       C +                  ++ FWCV++G+  +   + FGG+++    NP   A SCP  +FP  +  + KVC S D ELG+K S+PFGGF+SC++GNPL       S   G+   K C  G+S H AL+   CQ+SYCV +   T G      LP Y RPP +     + V+  N   +S+ IK
Sbjct:   43 LEVLPGGGWDNLRNVDMGRVMDLTYTSCRTTEDGQYIIPDEILTIPQKQSNLEMNSEILESWVNYQSSTSFSINMELSLFS---KVNGKFSPEFQRMKTLQVKDQAITTQVQVRNLIYTVKINPVSELNLEFKKLLLDICDRLENNQ-TRMATYLAELLVLNYGTHVITSVDAGAALIQEDHIRSSFLLDSQSSRSAVTASAGAVFRNIVNFKFEENYTSQNVFTKSYLSNRTHSRVQSIGGVPFYPGITLQTWQQGITNHLVAIDRAGLPLNFFINPDMLPDLPGPLVKKLSKTVESAVRRYYTFNTYPGCTDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNGAVQVCQNLEQKNPLTGDFSCPSGYSPIHLLTQIYE-EGYNGLECVRKCTLLIFCKTVCEDVFRVAKAEFKAFWCVASGEVPEDSGLLFGGLFSAKSINPLTNAQSCPAGYFPLRLFESLKVCASQDYELGYKFSVPFGGFFSCAVGNPLVDST--KSRDLGAPALKKCPGGFSQHLALISDGCQVSYCVKSGLFTGGSLPPARLPPYTRPPLMSQAATNTVIVTNTETSSSWIK 623          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: MPEG1 (macrophage expressed 1 [Source:HGNC Symbol;Acc:HGNC:29619])

HSP 1 Score: 291.967 bits (746), Expect = 1.593e-88
Identity = 187/569 (32.86%), Postives = 289/569 (50.79%), Query Frame = 1
Query:  265 LGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLDD---DSLCENIIQKNAATGDYSCPNGFT-----------PVKLYSFKYKCEG------DNC------PIY-------ETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGING-KVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
            +G+V+ ++YS+C+++ DG +LIPD+  +     S+V+M+S+I++ + +  S TS S+N +VS  +    ++  FS E + +K +Q+K  S  ++ Q+R  LY V   PD  L+ RF  +  ++   IEN + + HA YL++ +V D+GTHVI SVD GA L + D LK  Y+S  + SQ SV+ +A  +  + +   I      G SE   Y  N   +   + GG  F    TL KW+++   NLVAIDR G PL++ +     P+     V ++   + +AI RYY  NT  GC+   SKNF+  AN D   C        FGG+YQ+C+  +   D++C+ +  KN ATG YSC   +            P   Y     C G      D C       +Y       +T+WC +NG + +     FGG++  ++QNP  ++ SCP  FF      +G K+C+S D E   + S+PFGGF+SC   N LA  +              C   +S H   +   CQ+ +CV +   T G  LP+  PPF    T   V+++ A  T A
Sbjct:    1 MGRVMNISYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQKSSTSSSINADVSFFS---VVNAKFSTENQRMKTHQVKGNSVTARVQVRNHLYTVKAYPDFTLDSRFARQAEEIADAIENNQ-TRHAEYLSEKMVLDYGTHVITSVDTGATLVEEDYLKSSYVSDAQSSQSSVSASAGANFFDKVKFDIGTKDSQGTSETRNYQGNITYSITLSHGGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFLNPSVFPDLPLPTVNKLAVSVSQAIERYYKVNTHPGCVKPDSKNFNFQANVDDASCEGPNTNLSFGGVYQQCTPLNSYGDAICQELASKNPATGSYSCQQPYIATLLRSETQERPYDQYVCHRHCYGCGFLWLDTCCENICGNVYHVRRAQIKTYWCATNGATPEFSGYLFGGLFGPSLQNPLTKSRSCPPNFFTQTFLSSGFKICLSNDYEAATRFSVPFGGFFSCQSTNQLAGSQ------------SRCPPQFSQHLVAISDGCQILFCVQSGIFTGGELLPIRLPPF----TRPPVISMIATNTVA 549          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Match: ENSAMXT00000015822.2 (pep primary_assembly:Astyanax_mexicanus-2.0:6:8259512:8262317:1 gene:ENSAMXG00000015374.2 transcript:ENSAMXT00000015822.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 284.648 bits (727), Expect = 8.443e-86
Identity = 187/569 (32.86%), Postives = 284/569 (49.91%), Query Frame = 1
Query:  265 LGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKC---SLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFK----------------------YKCEGDNCP-IYE-------TFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGING-KVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSA 1869
            +G+V+ ++YS+C+++ DG +LIPD+  +     S+V+M+S+I++ + +  S TS S+N + S  +    ++  FS E + +K +Q+   S  ++ Q+R  LY V   PD  L+ RF +++ ++   IEN + + HA YL++ +V D+GTHVI SVDAGA L + D LK  Y+S  + SQ SV+ +A  +    +   I        SE   Y  N   +   + GG  F    TL KW+++   NLVAIDR G PL++ +      +     V ++   + +AI RYY  NTR GC+   S+NFD  AN D   C        FGG+YQ+C   + D D +C+ +   N ATG YSC   +    L S                        + C    C  +Y        T+WC +NG + +     FGGI+  + QNP  ++ SCP  FF      NG K+C+S D E   K S+PFGGF+SC   N LA  +              C   +S H A +   CQ+ +CV +   T G   P++ PPF    T   V++I A  T A
Sbjct:    1 MGRVMNMSYSQCQTTEDGVYLIPDEVFVIPQKVSKVEMNSEIISSWLEQRSSTSGSINADGSFFS---VLNCKFSAENQRMKTHQVNYNSVTARVQVRNHLYTVKAYPDFSLDSRFAQQVEEIADAIENNQ-TRHAEYLSEKLVLDYGTHVITSVDAGATLEEEDYLKSSYVSDTQSSQSSVSASAGANFFNKVQFDIGSKESQTTSETRNYLGNVTYSITLSHGGALFYPGITLQKWQESTLNNLVAIDRSGLPLHYFLNPSVFSDLPLPTVNKLALLVSQAIERYYKVNTRPGCVKPDSRNFDFQANVDDASCEGPSTNLSFGGVYQQCTPLTPDGDVICQELASTNPATGSYSCKQPYIATLLRSETQERPYDQYVCNTHCHDCGFLGLFTCCDQVCGNVYHVRRAQINTYWCATNGATPEFSGYLFGGIFGPSFQNPLTKSRSCPSNFFAQTFLSNGFKICLSSDYETATKFSVPFGGFFSCQSTNLLAGGQSH------------CPPQFSQHLATITDGCQILFCVQSGIFTGGELKPIHLPPF----TRPPVISILATNTVA 549          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO37879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEK6])

HSP 1 Score: 370.933 bits (951), Expect = 4.893e-120
Identity = 202/552 (36.59%), Postives = 306/552 (55.43%), Query Frame = 1
Query:  223 VLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLD---DDSLCENIIQKNAATGDYSCPNGFTPVKLYSFK--YKCEGD---------NCPI------YETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLY-RPPFI 1815
            VLPG GWDNL N  +G V  + YS C+SS+DG FL+PD   +    KS+V   ++   H++ YSS T+KS+N E  ++     +SGSFS E + +K +Q+++K+  ++ QLR+  Y    +PDS L   F++R+L++   +++   +A+A +LA ++VRDFGTH + SVDAGA+L+K+D L   +++     +  +T +AS S     G   S +  T    ++EY K  V +   T GG PF  NFT+ +WE  +   LVA+DR G+PL++ IT  ++PE  ++  +++   +K AI +YY  NT  GC  + S NF   AN D G C +  N   FGG+YQ C  D       C  + QKN  T DY+C  G+ PV ++  +    C  D          C +      + T+WCV+           FGG+Y+  ++NP  +  SCP  F+    G   KVC+S D ELG++ SLPFGGF+SC+ GNPLA KK            K C +G+S H   ++  C++ YCV +N       LP+  RPP++
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLVPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKTVTTRVQLRHVFYTAKLQPDSPLQPAFKDRLLEIASHLQHNN-TAYASFLAQVLVRDFGTHYVSSVDAGAVLAKVDHLTKKFVADSNEDKSKITASASASFFHFFGASGSYSKSTDTKTLDEYTKATVYSTTYTYGGPPFRVNFTINEWEDKMLDELVAVDRSGDPLHYTITPGSLPELCEQATFQLAAVVKNAIKQYYIHNTIKGCTKMDSPNFSFQANMDDGSCQSPTNNYTFGGVYQTCQTDGSPSSDPCAPLAQKNPLTADYTCTPGYEPVLVHQGRTPQSCHKDCHRVWLFFKRCSVQCGFGSFSTYWCVAKSAVPANSGYLFGGLYSDVLKNPLTQDHSCPLKFYALKFGATMKVCVSDDYELGYQQSLPFGGFFSCNAGNPLAFKKPPTGD-------KGCPTGFSQHLGAIEANCEIQYCVKSNVFNLQ-GLPIVRRPPYL 544          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Match: EDO28266 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6Y8])

HSP 1 Score: 82.0333 bits (201), Expect = 6.171e-19
Identity = 45/104 (43.27%), Postives = 67/104 (64.42%), Query Frame = 1
Query:  223 VLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKS 534
            VLPG GWDNL N  +G V  + YS C+SS+DG FLIPD   +    KS+V   ++   H++ YSS T+KS+N E  ++     +SGSFS E + +K +Q+++K+
Sbjct:    2 VLPGGGWDNLRNLHMGAVSAMNYSLCRSSDDGKFLIPDNVFLYPVKKSKVNTFAEFYDHWNNYSSTTTKSINAEAKASFGFGSVSGSFSSEYESVKKHQVEDKT 105          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: MPEG1 (macrophage-expressed gene 1 protein [Source:NCBI gene;Acc:101169041])

HSP 1 Score: 339.347 bits (869), Expect = 8.391e-106
Identity = 200/598 (33.44%), Postives = 313/598 (52.34%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKC---SLDDDSLCENIIQKNAATGDYSCPNGFTPVKL--------------YSFKYKCE------------GDNCPIYE----TFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGING-KVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSAGIKMILSE-NGSW 1905
              VLPG GWDNL N ++G+V+  +Y +C+++ DG +LIPD+  +  + ++ V+ +S+I++ +      T+ S+N +VS       ++  FS E   +K +Q+K+ S  ++ Q+R  +Y V   PD  L+ RF  ++ ++   IEN + +  A YL++ +V DFGTHVI SVDAGA LS+ D L+  Y+S       S+  +A ++  + L   IS +Y    S ++ Y  N   + I + GG PF    +L KW+++   NLVAIDR G PL+++I    + +     + ++   + +AI RYY  NTR GC+D+ +KN++  AN D   C        FGG+YQ C   S D   LCE + QKN  TGD+SC + +TP  L              Y  +Y C              DN  +      T+WC  NGK+ +     FGGIY+ +  NP   A SCP  +       +G ++C+S D EL  + S+PFGG +SC   NPLA  +            + C  GYS H   +   C++ YCV +   T G  LP++ PPF    T++ +V++ A  T     M+++E + SW
Sbjct:   70 LEVLPGGGWDNLRNMDMGRVMNFSYFQCQTTEDGLYLIPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASINDDVSFLP---VLNAKFSVEITRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIADAIENNQ-TRRADYLSEKMVVDFGTHVITSVDAGASLSQEDYLRSSYVSNSVSDSSSIKASAGLNFFDKLKFDISSDYTQKSSTLQNYQSNITYSIIQSHGGTPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINTNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCKGPATNLSFGGVYQACTELSSDAGPLCEELAQKNPNTGDFSCRSPYTPTLLRSEVRQKGYTTYDCYDIRYSCGFLGLFTCHRKQCQDNYHVRSARILTYWCSVNGKAPESSGYLFGGIYSPSSPNPITNAKSCPANYISLRFLSDGQRICVSQDYELATRFSVPFGGLFSCESVNPLANNQ------------RRCPPGYSQHLGTVSDGCEILYCVQSGLFTGGKLLPIHLPPF----TKAPLVSMQATNTV----MVMTEGDNSW 643          
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Match: ENSORLT00000006104.2 (pep primary_assembly:ASM223467v1:9:9652430:9669002:1 gene:ENSORLG00000027013.1 transcript:ENSORLT00000006104.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 336.265 bits (861), Expect = 1.726e-105
Identity = 195/583 (33.45%), Postives = 301/583 (51.63%), Query Frame = 1
Query:  217 FNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKC---SLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYS----------------------FKYKCEGDNC--------PIYETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGING-KVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKT 1863
              VLPG GWDNL N ++G+V+   Y +C+++ DG +L PD+  +  + ++ V+ +S+I++ +      T+ S+N +VS       ++  FS E   +K +Q+K+ S  ++ Q+R  +Y V   PD  L+ RF  ++ ++   IEN + +  A YL++ +V DFGTHVI SVDAGA LS+ D L   Y+S  + S   + L A ++  + L   IS NY    S ++ Y  N   + I + GG PF    +L KW+++   NLVAIDR G PL+++I    + +     + ++   + +AI RYY  NTR GC+D+ +KN++  AN D   C        FGG+YQ C   S D   LCE + QKN  TGD+SC   +TP+ L S                      + Y C+ + C            T+WC  NG + +     FGGIY+ +  NP   A SCP  +       +G ++C+S D EL    S+PFGG +SC   NPLA  +            + C  GYS H   +   C++ YCV +   T G  LP++ PPF    T++ +V++ A  T
Sbjct:   42 LEVLPGGGWDNLRNMDMGRVMNFGYFQCQTTKDGLYLNPDEVFVVPYKETGVETNSEIISSWLDQKGSTAASINDDVSDLP---VLNAKFSSEIIRMKTHQVKDSSTTARVQVRNFIYSVKSYPDFALDSRFAHQVKEIVDAIENNQ-TRRADYLSEKMVLDFGTHVITSVDAGASLSQEDYLHSSYVSVSDRSL--IKLQAGLNFYDKLKFDISSNYTQKSSTLQNYQSNITYSIIQSHGGAPFYPGISLQKWQESTKNNLVAIDRSGVPLHYLINSNTIQDLPQPTLNKVALTVSQAIERYYRINTRPGCVDVTAKNYNFQANVDDKSCEGPATNLSFGGVYQACTELSSDAGPLCEELAQKNPITGDFSCRYPYTPLLLRSEVRQEGYTTRDCYDIIYSCGFLYLYTCQREQCQDNYSVRSARILTYWCSVNGTAPENSGYLFGGIYSPSSPNPITNAKSCPANYISLKFLSDGQRICVSQDYELANNFSVPFGGLFSCESVNPLANNQ------------RRCPPGYSQHLGTVSNGCEILYCVQSGLFTGGELLPIHLPPF----TKAPLVSMQATNT 602          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000020344.1 (SMESG000020344.1)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 324/579 (55.96%), Postives = 406/579 (70.12%), Query Frame = 1
Query:  178 FVHGCHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDNCPIYETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSY--FPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSAGIKMILSENGSWE 1908
              HGC LTNN+YPFNVLPGSGWDNLSNRE  QVLK++Y +CK+SNDG FLIPD+TK+   MKS VQ+DS++++HFSKY S TSKS+N E S  T    ISGSFS E++D+K NQ+  KS+ SQ+QLRY+LY++S   D+EL+ +F +RIL++GVLIE KK S ++ YLADLIVR+FGTHVI SVDAGA+LSKID+LK  Y+   +     V++AAS S+ +  G K   N+K   +++EEYN NC STRI TIGGGPFGS+F+L +WEKTL TNLVAIDRIGEPL ++ITK N+PEF DK +YEI   +K AI +YYS NTR GCMD  S +FDENAN +SGLCN   N   FGG+YQ C   D   C+   QKN ATGDYSCP  F P+KL+      E DN P     WC     SS      FGG+YT    N      +CPQY+FP   GI+GK+CI+ DKELG KNSLPFGGFYSC  GNPLA      +  NG+   FP  CGSGYS+H A +   C  SYCV  NA+      PLYRPPF+D++ +S +  ++ L TSAG+K++L+E+G W+
Sbjct:    1 MAHGCQLTNNEYPFNVLPGSGWDNLSNREQAQVLKISYDKCKASNDGRFLIPDQTKLVPKMKSIVQLDSNLISHFSKYPSTTSKSINAEASGETKKYSISGSFSNEREDVKRNQLNSKSSISQSQLRYDLYKISHIVDAELDTKFHQRILNIGVLIETKKDSLYSAYLADLIVREFGTHVITSVDAGAVLSKIDILKQKYVLDSQVQNSDVSVAASFSLGQICGFKFGSNFKNDDTKIEEYNNNCASTRIKTIGGGPFGSDFSLEEWEKTLDTNLVAIDRIGEPLYNVITKHNIPEFSDKTIYEINLLVKTAIEKYYSTNTRLGCMDFNSHSFDENANVNSGLCNETGNTYPFGGVYQTCQNSDK--CDTYNQKNPATGDYSCPKAFNPIKLF------ELDN-PSITFVWCAPRSSSSAINGYLFGGMYTEQYPNLVTNNHNCPQYYFPVQYGISGKICITQDKELGGKNSLPFGGFYSCKTGNPLAL-----AIYNGTQTNFPLTCGSGYSTHLASIFNNCHYSYCVKNNAIKTKAATPLYRPPFVDLQMDSNIEVVSELTTSAGMKLVLAEDGIWK 565          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000071519.1 (SMESG000071519.1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 287/602 (47.67%), Postives = 401/602 (66.61%), Query Frame = 1
Query:  142 KNIATSNLPSAKFVHGCHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYS--------------FKYKCEGDNCPIYETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEVVNINALKTSAGIKMILSENGSW 1905
            K+ +  +LPS + VH C LTN QY F++LPGSGWDNL N+ELGQVL+++Y  C +SNDG+FLIPD + I    +S V++ SDI  HFS ++S TSKS+N + S ATP+ QISGSFS+EKKD+K++Q+KEKS  S+ QLR+E Y VSF+PDS+ + +F+ RILD+G L++  K + +  YLADLIVRDFGTHVI+SVDAGA L K DVLK  Y++K +G   ++  AAS SM + LG+ I GNY +  + ++EYN N  ST++ T+GG PFGSNF L  WEK+L +NLVAIDR G PL + IT R++PEFDDK V +I   IK A++RYY+ANTR GCM++ S+NF+++AN D G C   ++    GG +Q C    D  CEN+  KN  T  Y+CP  +  V+L S              F Y C  + C  Y  +WC +   ++K     FGG Y+    NP   A +CPQY++P+  G+ G +C++ ++    ++ LPFGGFYSC +GNPL+ K   N+T +  Y+ + C +GYSSH A+++  CQ+SYC+  NAL+K    PL+RPPF+D+          +L+T  G+K+ + ENG W
Sbjct:   20 KSESNRDLPSERQVHKCKLTNKQYAFDILPGSGWDNLENKELGQVLEISYKECLTSNDGSFLIPDNSVIIPIKRSTVELASDIFDHFSNFTSATSKSINADASYATPSYQISGSFSWEKKDVKNDQIKEKSLVSRVQLRHEFYTVSFQPDSKFDRQFKNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSKYVNKFKGDTTTIAAAASFSMTKVLGVTIKGNYFSDTASLDEYNNNSASTKVETVGGRPFGSNFKLEDWEKSLDSNLVAIDRRGNPLFYAITPRSLPEFDDKTVNKIVTLIKNAVNRYYAANTRVGCMNMESENFNDDANIDGGNCETPKSYYTLGGTFQTCK-GPDYQCENVAGKNPITNSYACPANYKTVELESGLSKCEKVCVRTFWFSYNCHYE-CSYYALYWCAATKATTKSEGSLFGGFYSNTYPNPITNAYNCPQYYYPSRFGMVGTICLAFNRAETMEHHLPFGGFYSCKVGNPLSDKFVDNTTQDPKYWSEGCATGYSSHVAIVNRGCQISYCIKNNALSKREQPPLFRPPFVDLGFGPNATITTSLETPTGLKLSVDENGKW 619          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000020345.1 (SMESG000020345.1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 285/498 (57.23%), Postives = 363/498 (72.89%), Query Frame = 1
Query:  160 NLPSAKFVHGCHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDNCPIY-------------ETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFY 1614
            NLPS++ VH CHLT  QYPFNVLPGSGWDNL+N+E GQV K++Y  C  SNDG FLIPD   IT +MKS+VQMDSD+V+HFSKY+S TSKS+NLEVS++TPN +ISGSFS+EKKDIK+NQMKEKS+ S+ QLRYELY V+F+PDS+L+  F+ RI+ LGVL+E +K   ++ YLADLIVRD+GTHVI+SVDAGAILSK+D+LK +YLSKH+GSQ +++LAAS S+   +G+KI G+ K   SE+ EYNKNC S++I+TIGGGP+GSNF L +WEKT+  NLV IDRIG+PL H+ITKR++PEFDD  VY+IGN IK+AI+RYY  NTR+GCMDI S NFD NAN ++G+C + +    FGG+YQ C   + + CEN+IQ N ATG  SCP G+    +Y   Y  E   C  Y              ++WC  + K +      FGG Y+    NP   + +CPQ F     G +  VC++ D  LG K SLPFGGFY
Sbjct:    2 NLPSSRIVHKCHLTKTQYPFNVLPGSGWDNLANKESGQVYKISYDNCSGSNDGRFLIPDSIIITPYMKSKVQMDSDMVSHFSKYTSTTSKSINLEVSASTPNYEISGSFSWEKKDIKENQMKEKSSISKVQLRYELYHVAFQPDSKLDPIFKNRIIQLGVLMETQKNYLYSQYLADLIVRDYGTHVIRSVDAGAILSKVDILKAEYLSKHKGSQTTISLAASGSLNSAIGLKIGGSNKNNESEVREYNKNCASSKINTIGGGPYGSNFQLAEWEKTIQKNLVPIDRIGDPLFHVITKRSLPEFDDITVYKIGNLIKDAITRYYKINTRSGCMDIKSDNFDVNANVNNGICQDSKISYVFGGVYQTC---EGNSCENLIQTNPATGSTSCPAGYNATLVYHGLYS-EQTICTYYVFSTVCNNFQTYISSYWCAPDPKKNPESVYLFGGFYSKVFPNPITNSFTCPQSFIALRFGHSSWVCVTSDSVLGRKFSLPFGGFY 495          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000067839.1 (SMESG000067839.1)

HSP 1 Score: 433.335 bits (1113), Expect = 1.866e-146
Identity = 214/416 (51.44%), Postives = 294/416 (70.67%), Query Frame = 1
Query:   55 LGRVILFLSIGSILAVLAEEKELNITHPHKNIATSNLPSAKFVHGCHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLDDDSLCENIIQKN 1302
            L  +ILF+ +  +L+V  E        P+++      PS++ VH C LT+NQYP NVLPGSGWDNL N+ELGQVL+++Y  C  SNDG+FLIPD   IT   KS V++ SDI  HFS  +S T+ S+N + S +TP+ +ISGSFS+EK  IK++Q+KEKS+ S++QLR+ELY V+F+P S+L+ +FR RILD+G L++  K + +  YLADLIVRDFGTHVI+SVDAGA L K DVLK +Y+   +G    +  AAS SM   L + + G Y    + + E+N N  ST++ T GG PFGSNF L +WEKTL TNLVAIDR GEPL++ IT +N+PEFD++ V++I   IKEA++RYY+ANTR GCM++ S+NF+++AN D G C + ++   FGG +Q CS + D  CE+I +KN
Sbjct:    6 LNSIILFIFVYGVLSVSCE------IEPYRD-----QPSSRRVHECKLTSNQYPVNVLPGSGWDNLENKELGQVLEISYKGCFGSNDGSFLIPDNVVITPIKKSIVELTSDIFDHFSNVTSTTAMSINADASYSTPSYKISGSFSFEKIRIKNDQIKEKSSISRSQLRHELYEVAFQPHSKLDAKFRNRILDIGALLKEGKDTIYPQYLADLIVRDFGTHVIRSVDAGATLIKTDVLKSNYVKGFKGDTTKIAAAASFSMTTMLSVNLKGTYVGDTTSINEFNNNSASTKVETFGGRPFGSNFRLEEWEKTLETNLVAIDRKGEPLSYAITPKNLPEFDEQAVFKIATLIKEAVNRYYAANTRVGCMNMESENFNDDANVDGGTCEHPKSYYNFGGTFQNCSGNVDQ-CESITEKN 409          
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Match: SMESG000044682.1 (SMESG000044682.1)

HSP 1 Score: 439.884 bits (1130), Expect = 3.032e-145
Identity = 243/599 (40.57%), Postives = 350/599 (58.43%), Query Frame = 1
Query:  190 CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDKTKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFSYEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGVLIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKHEGSQHSVTLAASVSMRETLGI-KISGNY--KTGHSEMEEYNKNCVSTRISTIGGGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYEIGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFGGLYQKCSLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCE------------GDNCPIYETFWC--VSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVGINGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQ-------KKGFNSTVNG-SYFPKACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPL-YRPPFIDIKTESEVVNINALKTSAGIKMILSENGSWE 1908
            CHL +NQ  F+VLPGSGWDNL+N  +G++L + +S+C  SND  +LIP++  I     S+V++ S+I  HFS Y+S++S+S+NL+      + +I GSFS E   IK +QM+ KS  ++ QLRY +++  FEPD+ L   F+ RI+D+  L+   K S +  YLAD+IVRD+GTHVI+++DAGAILSK D L   Y+ K+     +++++AS S    LG+ KISG Y  KT  + ++E+N N   T I T+GG  FG+N +L+ WE ++  NLV IDR GEPL + IT R +PE D   V+++   +K+AI RYY AN R GC+DI S NF+ +AN DSG C +      FGG YQ C       C    Q N  TG +SCP+GF  +KL+S   +C+               C  + TFWC  V+ G +  GY+  FGGI          R  SCP  + P  V ++ ++C+++D +     ++ FGGF+SCS GNPLA+       K   NS + G  Y+PK C  GY +H   ++  CQ+SYC  TN ++ G  LPL  +PPFI          +   K   G  +I  + G W+
Sbjct:   35 CHLRSNQLTFDVLPGSGWDNLANVGMGRILDLNFSKCSFSNDNKYLIPNQLAIYPQKTSQVEISSEIFRHFSNYTSMSSQSINLDAEGLFGHWKIGGSFSTENTKIKSDQMETKSILTRVQLRYLVFQSMFEPDTPLYPTFKNRIIDIAGLVIENKDSLYPEYLADMIVRDYGTHVIRAIDAGAILSKTDALNSRYVKKYASDSSTISVSASASF---LGMFKISGRYQTKTSQTNIDEFNHNADKTHIDTVGGAIFGANMSLSDWENSVMNNLVPIDRRGEPLYYAITPRALPELDQTTVHKVTELLKKAILRYYMANGRIGCLDIYSPNFNPDANIDSGNCEHPSVNFTFGGTYQVCG---GPACGPYAQVNPLTGGFSCPSGFISIKLHSGLVRCDESCHGWWFWRSCDTTCSYFTTFWCYPVNIGPNYNGYQ--FGGI----------RQGSCPIGYIPLKVALSTEICVTVDADPFNPYAIKFGGFFSCSAGNPLAKEYVNKKPKLPSNSKMEGLLYWPKTCAKGYVAHIVSIEQGCQISYCTETNKVSLG-PLPLIIKPPFISTNYNPNSTKVFLFKNKKGETIIKDDLGYWK 614          
The following BLAST results are available for this feature:
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MPEG11.202e-11936.19macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpeg1.13.476e-10434.34macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.13.476e-10434.34macrophage expressed 1, tandem duplicate 1 [Source... [more]
mpeg1.34.142e-9933.16macrophage expressed 1, tandem duplicate 3 [Source... [more]
mpeg1.22.919e-9430.74macrophage expressed 1, tandem duplicate 2 [Source... [more]
mpeg1.14.503e-1144.00macrophage expressed 1, tandem duplicate 1 [Source... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mpeg11.355e-12035.18macrophage expressed gene 1 [Source:MGI Symbol;Acc... [more]
Pfpl1.788e-11233.33pore forming protein-like [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RBP9|MPEG1_PONAB7.696e-12136.36Macrophage-expressed gene 1 protein OS=Pongo abeli... [more]
sp|Q2KJC3|MPEG1_BOVIN4.573e-12035.42Macrophage-expressed gene 1 protein OS=Bos taurus ... [more]
sp|A1L314|MPEG1_MOUSE2.479e-11935.01Macrophage-expressed gene 1 protein OS=Mus musculu... [more]
sp|Q2M385|MPEG1_HUMAN5.774e-11936.19Macrophage-expressed gene 1 protein OS=Homo sapien... [more]
sp|Q9WV57|MPEG1_RAT4.601e-11735.18Macrophage-expressed gene 1 protein OS=Rattus norv... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|234419824.562e-12535.86tr|A0A2B4RFA8|A0A2B4RFA8_STYPI Macrophage-expresse... [more]
gnl|BL_ORD_ID|235356081.074e-12235.45tr|A0A210Q242|A0A210Q242_MIZYE Macrophage-expresse... [more]
gnl|BL_ORD_ID|211146455.983e-12036.59tr|A0A2T7NUR8|A0A2T7NUR8_POMCA MACPF domain-contai... [more]
gnl|BL_ORD_ID|276300016.699e-12035.54tr|I3Y4E7|I3Y4E7_PIG Macrophage-expressed 1 OS=Sus... [more]
gnl|BL_ORD_ID|283403817.999e-11936.05tr|S7P4R0|S7P4R0_MYOBR Macrophage-expressed protei... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MPEG11.593e-8832.86macrophage expressed 1 [Source:HGNC Symbol;Acc:HGN... [more]
ENSAMXT00000015822.28.443e-8632.86pep primary_assembly:Astyanax_mexicanus-2.0:6:8259... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO378794.893e-12036.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282666.171e-1943.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MPEG18.391e-10633.44macrophage-expressed gene 1 protein [Source:NCBI g... [more]
ENSORLT00000006104.21.726e-10533.45pep primary_assembly:ASM223467v1:9:9652430:9669002... [more]
back to top
BLAST of Macrophage-expressed gene 1 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020344.10.000e+055.96SMESG000020344.1[more]
SMESG000071519.10.000e+047.67SMESG000071519.1[more]
SMESG000020345.10.000e+057.23SMESG000020345.1[more]
SMESG000067839.11.866e-14651.44SMESG000067839.1[more]
SMESG000044682.13.032e-14540.57SMESG000044682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000139 ID=SMED30000139|Name=Macrophage-expressed gene 1 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2115bp
GTTTGATAAAAGTTATAATTTTATTATTAAATAGTGAAAATGACAATTTT
TATGTTGGGTCGAGTAATTTTATTCCTCTCAATCGGATCCATTTTGGCTG
TGCTGGCTGAGGAGAAAGAGCTAAATATTACTCATCCCCACAAAAATATT
GCCACTTCGAATTTGCCATCAGCCAAATTTGTACATGGATGCCATTTGAC
CAACAATCAGTATCCATTCAATGTGCTTCCTGGATCTGGCTGGGATAATT
TGTCAAACCGCGAGTTGGGACAAGTTCTAAAAGTAGCCTATTCTCGTTGC
AAATCATCCAATGATGGAACCTTTCTCATTCCGGACAAAACAAAAATTAC
GGCGTTTATGAAATCTAGAGTTCAAATGGATTCAGATATTGTAACACACT
TTTCCAAATATTCCTCCTTGACTTCGAAATCAGTAAATCTTGAAGTCAGT
TCTGCAACTCCGAATGTTCAGATCAGCGGTTCATTTTCTTATGAAAAGAA
AGACATCAAGGACAATCAAATGAAAGAAAAATCCGCCTTTTCTCAAACTC
AGTTAAGATATGAATTGTATCGAGTATCCTTCGAACCGGATAGTGAATTG
AATGACAGATTTCGTGAAAGGATCCTTGATCTTGGAGTACTTATAGAGAA
TAAAAAGGGTTCAGCTCATGCTCACTATCTCGCTGATTTGATTGTCAGAG
ATTTCGGAACTCATGTTATTAAATCTGTTGATGCTGGAGCAATTCTTTCA
AAAATTGATGTCCTAAAAGGTGACTATCTTTCAAAACACGAGGGCTCTCA
ACATTCCGTGACATTAGCTGCGTCAGTTAGTATGAGAGAAACACTTGGAA
TTAAAATAAGTGGTAATTACAAAACCGGTCATTCGGAAATGGAAGAGTAC
AACAAAAATTGCGTAAGCACTCGAATCTCTACAATCGGTGGTGGACCTTT
CGGTTCGAATTTCACGCTAACAAAATGGGAAAAAACTCTTTCAACAAATC
TTGTGGCCATTGACCGTATTGGGGAACCGCTTAATCACATTATTACCAAA
CGTAACGTACCGGAGTTTGACGATAAAATTGTGTATGAAATCGGAAACCA
TATCAAGGAAGCAATAAGCCGATATTATTCTGCTAATACTCGAACTGGAT
GCATGGACATTATGTCAAAGAACTTTGATGAAAATGCAAATGCCGACAGT
GGATTATGTAATAACATTGAAAATGGAAATTTCTTTGGGGGTTTATACCA
AAAATGCAGTTTAGACGATGACTCTCTCTGTGAGAATATAATACAAAAAA
ATGCCGCTACTGGGGATTACTCGTGTCCAAATGGGTTCACTCCAGTCAAA
CTATATTCATTCAAGTATAAATGTGAAGGTGATAACTGTCCTATTTATGA
AACCTTCTGGTGTGTCTCTAACGGTAAATCGTCAAAAGGATATGAAATTT
TTTTCGGAGGAATCTACACAACAAATATTCAGAATCCGTTTTATAGGGCT
GACAGTTGTCCGCAATACTTCTTTCCTGCTAATGTTGGAATTAACGGTAA
AGTCTGCATTTCAATGGATAAAGAACTGGGATTTAAAAATAGTTTACCAT
TTGGAGGATTTTACAGCTGTTCTATGGGAAATCCATTAGCTCAAAAGAAA
GGATTTAATTCAACTGTAAATGGAAGTTATTTTCCAAAAGCTTGTGGAAG
TGGCTATTCTTCTCATTTTGCTCTCCTAGATGGTGTCTGTCAGTTGTCCT
ATTGTGTTAGTACTAATGCACTGACAAAGGGATATGACCTACCGTTGTAC
AGACCCCCATTTATTGATATTAAAACGGAATCAGAAGTTGTCAACATCAA
CGCATTGAAAACGTCGGCTGGAATAAAAATGATTCTTTCTGAAAATGGAT
CTTGGGAAACAATGATTCCTGAATTCTATTCCACGTACAAATATGCAATA
ATAACAGTGCTATTTCTCGTGCTATTATCCTTGCTTTTCCTGATGGCAGT
TTTAGCTTGGAAGGGTTTTAGACAATTTCTTGGAAGGATTTTCACTAAAA
TACCTTTAGTGAATAAAAAACAATCAAACCATAAACCGATTCGCGTACAA
ATAAAGGTGACCAGA
back to top

protein sequence of SMED30000139-orf-1

>SMED30000139-orf-1 ID=SMED30000139-orf-1|Name=SMED30000139-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=692bp
MTIFMLGRVILFLSIGSILAVLAEEKELNITHPHKNIATSNLPSAKFVHG
CHLTNNQYPFNVLPGSGWDNLSNRELGQVLKVAYSRCKSSNDGTFLIPDK
TKITAFMKSRVQMDSDIVTHFSKYSSLTSKSVNLEVSSATPNVQISGSFS
YEKKDIKDNQMKEKSAFSQTQLRYELYRVSFEPDSELNDRFRERILDLGV
LIENKKGSAHAHYLADLIVRDFGTHVIKSVDAGAILSKIDVLKGDYLSKH
EGSQHSVTLAASVSMRETLGIKISGNYKTGHSEMEEYNKNCVSTRISTIG
GGPFGSNFTLTKWEKTLSTNLVAIDRIGEPLNHIITKRNVPEFDDKIVYE
IGNHIKEAISRYYSANTRTGCMDIMSKNFDENANADSGLCNNIENGNFFG
GLYQKCSLDDDSLCENIIQKNAATGDYSCPNGFTPVKLYSFKYKCEGDNC
PIYETFWCVSNGKSSKGYEIFFGGIYTTNIQNPFYRADSCPQYFFPANVG
INGKVCISMDKELGFKNSLPFGGFYSCSMGNPLAQKKGFNSTVNGSYFPK
ACGSGYSSHFALLDGVCQLSYCVSTNALTKGYDLPLYRPPFIDIKTESEV
VNINALKTSAGIKMILSENGSWETMIPEFYSTYKYAIITVLFLVLLSLLF
LMAVLAWKGFRQFLGRIFTKIPLVNKKQSNHKPIRVQIKVTR
back to top
Aliases
The feature 'Macrophage-expressed gene 1 protein' has the following synonyms
Synonym
MPEG1-like-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000058embryonic digestive system
PLANA:0000023embryonic pharynx
Vocabulary: INTERPRO
TermDefinition
IPR039707MPEG1
IPR020864MACPF
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000004Stage 4
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020864Membrane attack complex component/perforin (MACPF) domainSMARTSM00457MACPF_8coord: 164..364
e-value: 0.0015
score: 24.0
IPR020864Membrane attack complex component/perforin (MACPF) domainPFAMPF01823MACPFcoord: 146..362
e-value: 9.2E-21
score: 74.9
IPR020864Membrane attack complex component/perforin (MACPF) domainPROSITEPS51412MACPF_2coord: 37..366
score: 15.424
NoneNo IPR availablePANTHERPTHR31463:SF4MACROPHAGE-EXPRESSED GENE 1 PROTEINcoord: 43..440
NoneNo IPR availablePANTHERPTHR31463:SF4MACROPHAGE-EXPRESSED GENE 1 PROTEINcoord: 454..593
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.858
NoneNo IPR availableTMHMMTMhelixcoord: 635..657
IPR039707Macrophage-expressed gene 1 proteinPANTHERPTHR31463FAMILY NOT NAMEDcoord: 43..440
coord: 454..593