60S ribosomal protein L4

Name60S ribosomal protein L4
Smed IDSMED30000134
Length (bp)1238
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of 60S ribosomal protein L4 (SMED30000134) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L4 (SMED30000134) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L4 (SMED30000134) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L4 (SMED30000134) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 17

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000134SMESG000009479.1 SmedASXL_009666SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000134SMESG000009479.1 dd_Smed_v4_211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000134SMESG000009479.1 Contig37113uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000134SMESG000009479.1 Contig37113newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
progenitor cellSMED30000134SMESG000009479.1 dd_Smed_v6_211_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000134SMESG000009479.1 dd_Smed_v6_211_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of 60S ribosomal protein L4 vs. Ensembl Human
Match: RPL4 (ribosomal protein L4 [Source:HGNC Symbol;Acc:HGNC:10353])

HSP 1 Score: 337.421 bits (864), Expect = 2.308e-112
Identity = 196/343 (57.14%), Postives = 249/343 (72.59%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Human
Match: RPL4 (ribosomal protein L4 [Source:HGNC Symbol;Acc:HGNC:10353])

HSP 1 Score: 218.394 bits (555), Expect = 2.745e-67
Identity = 133/240 (55.42%), Postives = 176/240 (73.33%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Human
Match: RPL4 (ribosomal protein L4 [Source:HGNC Symbol;Acc:HGNC:10353])

HSP 1 Score: 189.504 bits (480), Expect = 2.976e-58
Identity = 106/192 (55.21%), Postives = 129/192 (67.19%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Human
Match: RPL4 (ribosomal protein L4 [Source:HGNC Symbol;Acc:HGNC:10353])

HSP 1 Score: 162.925 bits (411), Expect = 5.807e-48
Identity = 91/157 (57.96%), Postives = 107/157 (68.15%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Celegans
Match: rpl-4 (60S ribosomal protein L4 [Source:UniProtKB/Swiss-Prot;Acc:O02056])

HSP 1 Score: 328.561 bits (841), Expect = 1.497e-110
Identity = 175/350 (50.00%), Postives = 240/350 (68.57%), Query Frame = 2
            +RPL+ VY        S+          ++ P+VF  P+R D++S + D +R+N RQ +AV+T AG  +SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGHMFAP KV+R+WH  V I Q+RYA+ +AIAA+G   L+ ARGH +++V E+PLV+S++ E  +KTK AV  L+   +W DIEKV +S++ RAG+GK+RNR++ QK GP+VIY  D    +AFRNIPGV ++NV+ LN+LKL+PGGH+GRL IWT+ A ++L+ IYG+    +SQ K  + +P P M N+D  RII SEE+   ++A                 +   ++ KLNPYA+  +K +K
BLAST of 60S ribosomal protein L4 vs. Ensembl Fly
Match: RpL4 (gene:FBgn0003279 transcript:FBtr0085248)

HSP 1 Score: 339.732 bits (870), Expect = 6.484e-114
Identity = 183/341 (53.67%), Postives = 243/341 (71.26%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Zebrafish
Match: rpl4 (ribosomal protein L4 [Source:ZFIN;Acc:ZDB-GENE-030131-9034])

HSP 1 Score: 368.622 bits (945), Expect = 1.330e-125
Identity = 196/343 (57.14%), Postives = 247/343 (72.01%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Xenopus
Match: rpl4 (ribosomal protein L4 [Source:NCBI gene;Acc:100327250])

HSP 1 Score: 340.117 bits (871), Expect = 6.067e-114
Identity = 193/345 (55.94%), Postives = 252/345 (73.04%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Mouse
Match: Rpl4 (ribosomal protein L4 [Source:MGI Symbol;Acc:MGI:1915141])

HSP 1 Score: 338.961 bits (868), Expect = 3.101e-113
Identity = 196/343 (57.14%), Postives = 250/343 (72.89%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. UniProt/SwissProt
Match: sp|P49165|RL4_URECA (60S ribosomal protein L4 OS=Urechis caupo OX=6431 GN=RPL4 PE=2 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 1.080e-124
Identity = 194/340 (57.06%), Postives = 249/340 (73.24%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. UniProt/SwissProt
Match: sp|Q9SF40|RL4A_ARATH (60S ribosomal protein L4-1 OS=Arabidopsis thaliana OX=3702 GN=RPL4A PE=1 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 6.620e-120
Identity = 197/353 (55.81%), Postives = 253/353 (71.67%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. UniProt/SwissProt
Match: sp|P49691|RL4B_ARATH (60S ribosomal protein L4-2 OS=Arabidopsis thaliana OX=3702 GN=RPL4D PE=1 SV=2)

HSP 1 Score: 355.525 bits (911), Expect = 3.978e-119
Identity = 196/355 (55.21%), Postives = 254/355 (71.55%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. UniProt/SwissProt
Match: sp|P35679|RL4A_SCHPO (60S ribosomal protein L4-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpl402 PE=1 SV=2)

HSP 1 Score: 353.599 bits (906), Expect = 6.910e-119
Identity = 183/347 (52.74%), Postives = 247/347 (71.18%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. UniProt/SwissProt
Match: sp|Q9P784|RL4B_SCHPO (60S ribosomal protein L4-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpl401 PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 8.496e-119
Identity = 185/357 (51.82%), Postives = 251/357 (70.31%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. TrEMBL
Match: A0A504YWQ0 (Ribosomal protein l4 OS=Fasciola gigantica OX=46835 GN=FGIG_09016 PE=4 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 1.454e-144
Identity = 226/347 (65.13%), Postives = 272/347 (78.39%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. TrEMBL
Match: A0A5J4P0I8 (Large subunit ribosomal protein L4e OS=Paragonimus westermani OX=34504 GN=DEA37_0014265 PE=4 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 1.722e-144
Identity = 229/358 (63.97%), Postives = 273/358 (76.26%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. TrEMBL
Match: A0A4E0RYD3 (Ribosomal protein l4 OS=Fasciola hepatica OX=6192 GN=D915_007907 PE=4 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 2.084e-144
Identity = 226/347 (65.13%), Postives = 272/347 (78.39%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. TrEMBL
Match: A0A1S8WLA0 (Ribosomal protein, L4/L1 family OS=Opisthorchis viverrini OX=6198 GN=X801_09014 PE=4 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 2.114e-142
Identity = 222/350 (63.43%), Postives = 273/350 (78.00%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. TrEMBL
Match: A0A4S2LI53 (Ribos_L4_asso_C domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008495 PE=4 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 2.147e-141
Identity = 221/349 (63.32%), Postives = 272/349 (77.94%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Cavefish
Match: rpl4 (ribosomal protein L4 [Source:NCBI gene;Acc:103028337])

HSP 1 Score: 352.829 bits (904), Expect = 2.220e-119
Identity = 192/343 (55.98%), Postives = 249/343 (72.59%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Sea Lamprey
Match: rpl4 (ribosomal protein L4 [Source:ZFIN;Acc:ZDB-GENE-030131-9034])

HSP 1 Score: 338.576 bits (867), Expect = 1.093e-113
Identity = 196/346 (56.65%), Postives = 255/346 (73.70%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Yeast
Match: RPL4B (Ribosomal 60S subunit protein L4B; homologous to mammalian ribosomal protein L4 and bacterial L4; RPL4B has a paralog, RPL4A, that arose from the whole genome duplication [Source:SGD;Acc:S000002419])

HSP 1 Score: 293.123 bits (749), Expect = 4.240e-97
Identity = 184/343 (53.64%), Postives = 241/343 (70.26%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Yeast
Match: RPL4A (Ribosomal 60S subunit protein L4A; N-terminally acetylated; homologous to mammalian ribosomal protein L4 and bacterial L4; RPL4A has a paralog, RPL4B, that arose from the whole genome duplication [Source:SGD;Acc:S000000235])

HSP 1 Score: 293.123 bits (749), Expect = 4.624e-97
Identity = 184/343 (53.64%), Postives = 241/343 (70.26%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Nematostella
Match: EDO31005 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ61])

HSP 1 Score: 362.844 bits (930), Expect = 5.498e-124
Identity = 197/346 (56.94%), Postives = 251/346 (72.54%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Ensembl Medaka
Match: rpl4 (ribosomal protein L4 [Source:NCBI gene;Acc:101162922])

HSP 1 Score: 362.844 bits (930), Expect = 1.630e-123
Identity = 192/343 (55.98%), Postives = 249/343 (72.59%), Query Frame = 2
BLAST of 60S ribosomal protein L4 vs. Planmine SMEST
Match: SMESG000009479.1 (SMESG000009479.1)

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 364/366 (99.45%), Postives = 365/366 (99.73%), Query Frame = 2
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RPL42.308e-11257.14ribosomal protein L4 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL42.745e-6755.42ribosomal protein L4 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL42.976e-5855.21ribosomal protein L4 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL45.807e-4857.96ribosomal protein L4 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl-41.497e-11050.0060S ribosomal protein L4 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RpL46.484e-11453.67gene:FBgn0003279 transcript:FBtr0085248[more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl41.330e-12557.14ribosomal protein L4 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl46.067e-11455.94ribosomal protein L4 [Source:NCBI gene;Acc:1003272... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rpl43.101e-11357.14ribosomal protein L4 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49165|RL4_URECA1.080e-12457.0660S ribosomal protein L4 OS=Urechis caupo OX=6431 ... [more]
sp|Q9SF40|RL4A_ARATH6.620e-12055.8160S ribosomal protein L4-1 OS=Arabidopsis thaliana... [more]
sp|P49691|RL4B_ARATH3.978e-11955.2160S ribosomal protein L4-2 OS=Arabidopsis thaliana... [more]
sp|P35679|RL4A_SCHPO6.910e-11952.7460S ribosomal protein L4-A OS=Schizosaccharomyces ... [more]
sp|Q9P784|RL4B_SCHPO8.496e-11951.8260S ribosomal protein L4-B OS=Schizosaccharomyces ... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YWQ01.454e-14465.13Ribosomal protein l4 OS=Fasciola gigantica OX=4683... [more]
A0A5J4P0I81.722e-14463.97Large subunit ribosomal protein L4e OS=Paragonimus... [more]
A0A4E0RYD32.084e-14465.13Ribosomal protein l4 OS=Fasciola hepatica OX=6192 ... [more]
A0A1S8WLA02.114e-14263.43Ribosomal protein, L4/L1 family OS=Opisthorchis vi... [more]
A0A4S2LI532.147e-14163.32Ribos_L4_asso_C domain-containing protein OS=Opist... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl42.220e-11955.98ribosomal protein L4 [Source:NCBI gene;Acc:1030283... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl41.093e-11356.65ribosomal protein L4 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL4B4.240e-9753.64Ribosomal 60S subunit protein L4B; homologous to m... [more]
RPL4A4.624e-9753.64Ribosomal 60S subunit protein L4A; N-terminally ac... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO310055.498e-12456.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl41.630e-12355.98ribosomal protein L4 [Source:NCBI gene;Acc:1011629... [more]
back to top
BLAST of 60S ribosomal protein L4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30000134 ID=SMED30000134|Name=60S ribosomal protein L4|organism=Schmidtea mediterranea sexual|type=transcript|length=1238bp
back to top

protein sequence of SMED30000134-orf-1

>SMED30000134-orf-1 ID=SMED30000134-orf-1|Name=SMED30000134-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=367bp
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
PLANA:0000120progenitor cell
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
Vocabulary: molecular function
GO:0003735structural constituent of ribosome
Vocabulary: biological process
Vocabulary: cellular component
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002136Ribosomal protein L4/L1ePFAMPF00573Ribosomal_L4coord: 33..270
e-value: 2.0E-37
score: 128.7
IPR023574Ribosomal protein L4 domain superfamilyGENE3DG3DSA:3.40.1370.10coord: 1..312
e-value: 1.1E-124
score: 417.3
IPR023574Ribosomal protein L4 domain superfamilySUPERFAMILYSSF52166Ribosomal protein L4coord: 28..270
IPR02575560S ribosomal protein L4, C-terminal domainPFAMPF14374Ribos_L4_asso_Ccoord: 284..350
e-value: 2.0E-24
score: 85.4
NoneNo IPR availablePANTHERPTHR1943160S RIBOSOMAL PROTEIN L4coord: 2..347