Mitochondrial proton/calcium exchanger protein

Overview
NameMitochondrial proton/calcium exchanger protein
Smed IDSMED30000130
Length (bp)2599
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitochondrial proton/calcium exchanger protein (SMED30000130) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitochondrial proton/calcium exchanger protein (SMED30000130) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitochondrial proton/calcium exchanger protein (SMED30000130) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitochondrial proton/calcium exchanger protein (SMED30000130) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000130

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30000130SMESG000055346.1 dd_Smed_v4_1716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000130SMESG000055346.1 dd_Smed_v4_1716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000130SMESG000055346.1 dd_Smed_v4_1716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000130SMESG000055346.1 dd_Smed_v4_1716_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Human
Match: LETM1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:HGNC Symbol;Acc:HGNC:6556])

HSP 1 Score: 338.961 bits (868), Expect = 1.187e-103
Identity = 212/575 (36.87%), Postives = 348/575 (60.52%), Query Frame = 2
Query:  485 VKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIAKEQ-----------ADEKESQRIV--------------------KETLIDTAAIV-----AVEKDKPLDVDSKR-SAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ--VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            V K ++ Q++ +E  HYYHGFRL +++  I   +L+R+ +G +LTRRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  S   E+ ++ L+ KLE+AKFLQDT+EE    NK +++ S T + F++F +++RE+G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +++  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+E+RLR QL QWL L + +++P SLL+LSR MYLPD LSP  QL   +  LPE+V+KEA ++    +  + DNK K E   +E+  I +E            A + E +R+V                     ETL DTA ++          + +D+ S   S + E+  S +   +    ++    + +    E+L E+K++ ++  ++  VE  K S RL K++  MI ++D L+ +L++ Q+        G  +    E V+++++L+NA+KQ+K     + K   +   LDE+KDG + +  + ++++++  E+V +S+  +  ++
Sbjct:  148 VVKKSLGQRVLDELKHYYHGFRLLWIDTKIAARMLWRILNGHSLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNMLPSTFETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNK-AAKGSAT-KDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRAMYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREKELQKRSEVAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETLKDTAPVLEGLKEEEITKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYS----EDLQEIKKELSKTGEEKYVEESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPT---GENVISVAELINAMKQVKHIP--ESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIV 711          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Human
Match: LETM2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:14648])

HSP 1 Score: 229.95 bits (585), Expect = 2.486e-66
Identity = 131/274 (47.81%), Postives = 191/274 (69.71%), Query Frame = 2
Query:  506 QKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYS-SEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPD 1324
            QKI +E  +YY+GF L +++  +   +++RL  G+ LTRRER++L+RT  D  RL PF+VF+ VPF+E LLP++++ FP M+PSTF+  SK  EK ++ +  KLE+AKFLQ+T+ E    N+    +AS  L S+   +KQV ++G   +T +I++FS+LFED++ LE LD  QL ALCKLLE+Q+ G    L F L +K+  +K DD +IA+EG+  L   ELQ  CR RGMR++G++EE+LR QL++W  L +++ VP SLLLLSRT YL D
Sbjct:   77 QKIMDELKYYYNGFYLLWIDAKVAARMVWRLLHGQVLTRRERRRLLRTCVDFFRLVPFMVFLIVPFMEFLLPVFLKLFPEMLPSTFESESKKEEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSY---VKQV-QTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLID 346          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Human
Match: LETM2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:14648])

HSP 1 Score: 229.18 bits (583), Expect = 1.742e-65
Identity = 131/274 (47.81%), Postives = 191/274 (69.71%), Query Frame = 2
Query:  506 QKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYS-SEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPD 1324
            QKI +E  +YY+GF L +++  +   +++RL  G+ LTRRER++L+RT  D  RL PF+VF+ VPF+E LLP++++ FP M+PSTF+  SK  EK ++ +  KLE+AKFLQ+T+ E    N+    +AS  L S+   +KQV ++G   +T +I++FS+LFED++ LE LD  QL ALCKLLE+Q+ G    L F L +K+  +K DD +IA+EG+  L   ELQ  CR RGMR++G++EE+LR QL++W  L +++ VP SLLLLSRT YL D
Sbjct:  124 QKIMDELKYYYNGFYLLWIDAKVAARMVWRLLHGQVLTRRERRRLLRTCVDFFRLVPFMVFLIVPFMEFLLPVFLKLFPEMLPSTFESESKKEEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSY---VKQV-QTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLID 393          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Human
Match: LETM2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:14648])

HSP 1 Score: 161.384 bits (407), Expect = 9.790e-44
Identity = 87/181 (48.07%), Postives = 124/181 (68.51%), Query Frame = 2
Query:  785 EKTRQLLKCKLEMAKFLQDTLEETRSINKYS-SEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPD 1324
            EK ++ +  KLE+AKFLQ+T+ E    N+    +AS  L S+   +KQV ++G   +T +I++FS+LFED++ LE LD  QL ALCKLLE+Q+ G    L F L +K+  +K DD +IA+EG+  L   ELQ  CR RGMR++G++EE+LR QL++W  L +++ VP SLLLLSRT YL D
Sbjct:    3 EKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSY---VKQV-QTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLID 179          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Human
Match: LETM2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:14648])

HSP 1 Score: 159.073 bits (401), Expect = 1.195e-41
Identity = 85/175 (48.57%), Postives = 120/175 (68.57%), Query Frame = 2
Query:  803 LKCKLEMAKFLQDTLEETRSINKYS-SEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPD 1324
            +  KLE+AKFLQ+T+ E    N+    +AS  L S+   +KQV ++G   +T +I++FS+LFED++ LE LD  QL ALCKLLE+Q+ G    L F L +K+  +K DD +IA+EG+  L   ELQ  CR RGMR++G++EE+LR QL++W  L +++ VP SLLLLSRT YL D
Sbjct:  128 MAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSY---VKQV-QTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLID 298          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Celegans
Match: letm-1 (LETM1 (Leucine zipper, EF-hand, TransMembrane mitochondrial protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9XVL7])

HSP 1 Score: 322.398 bits (825), Expect = 1.828e-97
Identity = 226/609 (37.11%), Postives = 348/609 (57.14%), Query Frame = 2
Query:  470 EEDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREG-IDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIA-------------------KEQADEKESQRIVKETLIDTAAIVAV--------------------------------EKDKPLDVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEE--ELDELKEQAAELHDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENI---IHDIKVGQTSETAEERVVAISDLMNALKQLKSASG----DDEKWQRI---LTVLDEDKDGHIELHHMTEILDMLGSE-EVKLSSKDMGRLIDAI 2098
            ++D A  K  +  +I +E  HYYHGFRL  LE  ++   L+ +  G TL+RRER+QLVRTV+DL RL PF  FI VPF+EL LP++I+ FP M+PSTFQ SSK+ EK R+ +K ++EMAKFLQDT+EE     K  ++ S     F LF+K+VR  G   + +++LKFS+LFEDE+TL++L   QL++LC+L+ I S+G    L F L +K+  LK DD+ IA EG +D L + +LQ  CR RGMRA+GVSEERL+ QL QWL+LS+  +VP +LLLLSRT+YLP+++S   +L   + +LP+ +++    +    +  + D+K + EL+   +  IA                   KE+A++ + Q   KE L+D AA   V                                EK + + VD K  +  EE I    + + ++ I  +       +E+  E++ L    AE        K + RL  KLN+MIE++DS++D+L+ ++ NI   + D  V  + +  +ER V I D++++L +LK + G    D E+ +RI   L  +DED DG ++   + E++++L    +V +S+  M  +I  +
Sbjct:   81 DKDVATVKPPLKDRIIHELKHYYHGFRLLALETRVSAKYLWTVLRGATLSRRERQQLVRTVSDLFRLVPFSFFIIVPFMELALPIFIKLFPGMLPSTFQESSKEEEKWRKQVKLRVEMAKFLQDTIEEIGLERKTRNKESTRSLEFALFIKKVRNEGGYVSNEELLKFSKLFEDEITLDNLSMGQLRSLCRLMSINSLGSPEILRFQLNMKIRELKADDKQIAAEGGVDALSSIDLQSACRARGMRAIGVSEERLKEQLVQWLELSLNDKVPPALLLLSRTLYLPEEVSFPDRLKAIVQNLPDGLAETTKQKLTEMEGGQIDHKARIELIRSIESAIANEKKDEEKKKKAAEEALKSKEEAEKAKVQE--KEKLVDVAAQAIVHELKKDIYDAVASTSSTTEAKEPAAKPSEAKEEKKEDITVDKKDLSHIEEIIVGGPIKEAKHDILGLREKVLEHKEDLMEINSLDGAFAET-------KIAKRLRHKLNSMIEDVDSMVDKLEDEKRNIREMLIDPTVENSVDLKKEREVRIQDVIDSLAKLKESKGEQADDGEQRERIEALLKTIDEDSDGIVDKQLVLEVIELLEKHTDVHVSAAQMASMIGTL 680          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Celegans
Match: letm-1 (LETM1 (Leucine zipper, EF-hand, TransMembrane mitochondrial protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9XVL7])

HSP 1 Score: 322.013 bits (824), Expect = 2.463e-97
Identity = 226/609 (37.11%), Postives = 348/609 (57.14%), Query Frame = 2
Query:  470 EEDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREG-IDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIA-------------------KEQADEKESQRIVKETLIDTAAIVAV--------------------------------EKDKPLDVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEE--ELDELKEQAAELHDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENI---IHDIKVGQTSETAEERVVAISDLMNALKQLKSASG----DDEKWQRI---LTVLDEDKDGHIELHHMTEILDMLGSE-EVKLSSKDMGRLIDAI 2098
            ++D A  K  +  +I +E  HYYHGFRL  LE  ++   L+ +  G TL+RRER+QLVRTV+DL RL PF  FI VPF+EL LP++I+ FP M+PSTFQ SSK+ EK R+ +K ++EMAKFLQDT+EE     K  ++ S     F LF+K+VR  G   + +++LKFS+LFEDE+TL++L   QL++LC+L+ I S+G    L F L +K+  LK DD+ IA EG +D L + +LQ  CR RGMRA+GVSEERL+ QL QWL+LS+  +VP +LLLLSRT+YLP+++S   +L   + +LP+ +++    +    +  + D+K + EL+   +  IA                   KE+A++ + Q   KE L+D AA   V                                EK + + VD K  +  EE I    + + ++ I  +       +E+  E++ L    AE        K + RL  KLN+MIE++DS++D+L+ ++ NI   + D  V  + +  +ER V I D++++L +LK + G    D E+ +RI   L  +DED DG ++   + E++++L    +V +S+  M  +I  +
Sbjct:   81 DKDVATVKPPLKDRIIHELKHYYHGFRLLALETRVSAKYLWTVLRGATLSRRERQQLVRTVSDLFRLVPFSFFIIVPFMELALPIFIKLFPGMLPSTFQESSKEEEKWRKQVKLRVEMAKFLQDTIEEIGLERKTRNKESTRSLEFALFIKKVRNEGGYVSNEELLKFSKLFEDEITLDNLSMGQLRSLCRLMSINSLGSPEILRFQLNMKIRELKADDKQIAAEGGVDALSSIDLQSACRARGMRAIGVSEERLKEQLVQWLELSLNDKVPPALLLLSRTLYLPEEVSFPDRLKAIVQNLPDGLAETTKQKLTEMEGGQIDHKARIELIRSIESAIANEKKDEEKKKKAAEEALKSKEEAEKAKVQE--KEKLVDVAAQAIVHELKKDIYDAVASTSSTTEAKEPAAKPSEAKEEKKEDITVDKKDLSHIEEIIVGGPIKEAKHDILGLREKVLEHKEDLMEINSLDGAFAET-------KIAKRLRHKLNSMIEDVDSMVDKLEDEKRNIREMLIDPTVENSVDLKKEREVRIQDVIDSLAKLKESKGEQADDGEQRERIEALLKTIDEDSDGIVDKQLVLEVIELLEKHTDVHVSAAQMASMIGTL 680          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Fly
Match: Letm1 (gene:FBgn0284252 transcript:FBtr0072349)

HSP 1 Score: 333.954 bits (855), Expect = 1.323e-99
Identity = 219/558 (39.25%), Postives = 340/558 (60.93%), Query Frame = 2
Query:  509 KIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINK-YSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDNKFDNKTKWELMSEEQKLIAKEQADEKES----QRIVKETLIDTAAIVAVEK---DKPLDVDSKRSAISE--ESISTSDLX-XXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQVE--------------TKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAE-------ERVVAISDLMNALKQLKSASGDDEKWQRI---LTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDM 2077
            +I +E VHYYHGFRL +++V I   +L+R+ +G+TLTRRE KQL RT +DL RL PF VFI VPF+ELLLPL+I+FFP M+PSTFQ S+   EK RQ L  +LE+AKFLQ TL++    +K +SSE +   + F  F  ++R   +  + D+I+KF++ F+DE+TL+SL   QL ALC++LE+ ++G    L F LR+K+  L  DDR+IAREG+D L   ELQQ C+ RGMRA G++EERLRFQL +W+ LS+ +QVP +LLLLSRTM + D      +L + I  LP+ V          ++ K DNKTK E++ EE++ I +E+ +E+E     +  +KE +   A  V  EK    + L    ++S++SE  + IS++D+    E      S+     ++E + ELKE+ A+  + VE                + +  L  ++N MI ++D++L+ L+ +Q    H IK  ++S+ A        +++V I +L+  ++++K AS D+E+++ +   L  LD DKDG I ++ +T+ +  +  E   +  K +
Sbjct:  184 RIWDELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRRENKQLQRTTSDLFRLIPFSVFIIVPFMELLLPLFIKFFPGMLPSTFQTSTDRQEKLRQSLSVRLEVAKFLQQTLDQMPVQHKEHSSEEA---KQFEAFFTKIRNPTEPVSNDEIIKFAKRFDDEITLDSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDLLELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKETIRVLPDAVGAHTRHAIGESEGKVDNKTKIEIIKEEERKIREEREEEREETIAKRSAIKEEI--PAPYVFAEKLSGSQDLLDHKEQSSVSETDKGISSTDVQLLSEALKTLSSDKQLVVEKETIKELKEELADYKEDVEELREVRQVVKEPVRESRAAKLLYNRVNKMISQLDNVLNDLEARQ----HQIKQAESSDYAASSPTVEPQQMVHIDELVATIRRMKEAS-DEERFKVVGDLLVKLDADKDGVISVNEITKAVQSIDREATNIDKKQL 731          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Fly
Match: Letm1 (gene:FBgn0284252 transcript:FBtr0072348)

HSP 1 Score: 333.954 bits (855), Expect = 1.323e-99
Identity = 219/558 (39.25%), Postives = 340/558 (60.93%), Query Frame = 2
Query:  509 KIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINK-YSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDNKFDNKTKWELMSEEQKLIAKEQADEKES----QRIVKETLIDTAAIVAVEK---DKPLDVDSKRSAISE--ESISTSDLX-XXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQVE--------------TKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAE-------ERVVAISDLMNALKQLKSASGDDEKWQRI---LTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDM 2077
            +I +E VHYYHGFRL +++V I   +L+R+ +G+TLTRRE KQL RT +DL RL PF VFI VPF+ELLLPL+I+FFP M+PSTFQ S+   EK RQ L  +LE+AKFLQ TL++    +K +SSE +   + F  F  ++R   +  + D+I+KF++ F+DE+TL+SL   QL ALC++LE+ ++G    L F LR+K+  L  DDR+IAREG+D L   ELQQ C+ RGMRA G++EERLRFQL +W+ LS+ +QVP +LLLLSRTM + D      +L + I  LP+ V          ++ K DNKTK E++ EE++ I +E+ +E+E     +  +KE +   A  V  EK    + L    ++S++SE  + IS++D+    E      S+     ++E + ELKE+ A+  + VE                + +  L  ++N MI ++D++L+ L+ +Q    H IK  ++S+ A        +++V I +L+  ++++K AS D+E+++ +   L  LD DKDG I ++ +T+ +  +  E   +  K +
Sbjct:  184 RIWDELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRRENKQLQRTTSDLFRLIPFSVFIIVPFMELLLPLFIKFFPGMLPSTFQTSTDRQEKLRQSLSVRLEVAKFLQQTLDQMPVQHKEHSSEEA---KQFEAFFTKIRNPTEPVSNDEIIKFAKRFDDEITLDSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDLLELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKETIRVLPDAVGAHTRHAIGESEGKVDNKTKIEIIKEEERKIREEREEEREETIAKRSAIKEEI--PAPYVFAEKLSGSQDLLDHKEQSSVSETDKGISSTDVQLLSEALKTLSSDKQLVVEKETIKELKEELADYKEDVEELREVRQVVKEPVRESRAAKLLYNRVNKMISQLDNVLNDLEARQ----HQIKQAESSDYAASSPTVEPQQMVHIDELVATIRRMKEAS-DEERFKVVGDLLVKLDADKDGVISVNEITKAVQSIDREATNIDKKQL 731          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Fly
Match: Letm1 (gene:FBgn0284252 transcript:FBtr0072347)

HSP 1 Score: 333.954 bits (855), Expect = 1.323e-99
Identity = 219/558 (39.25%), Postives = 340/558 (60.93%), Query Frame = 2
Query:  509 KIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINK-YSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDNKFDNKTKWELMSEEQKLIAKEQADEKES----QRIVKETLIDTAAIVAVEK---DKPLDVDSKRSAISE--ESISTSDLX-XXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQVE--------------TKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAE-------ERVVAISDLMNALKQLKSASGDDEKWQRI---LTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDM 2077
            +I +E VHYYHGFRL +++V I   +L+R+ +G+TLTRRE KQL RT +DL RL PF VFI VPF+ELLLPL+I+FFP M+PSTFQ S+   EK RQ L  +LE+AKFLQ TL++    +K +SSE +   + F  F  ++R   +  + D+I+KF++ F+DE+TL+SL   QL ALC++LE+ ++G    L F LR+K+  L  DDR+IAREG+D L   ELQQ C+ RGMRA G++EERLRFQL +W+ LS+ +QVP +LLLLSRTM + D      +L + I  LP+ V          ++ K DNKTK E++ EE++ I +E+ +E+E     +  +KE +   A  V  EK    + L    ++S++SE  + IS++D+    E      S+     ++E + ELKE+ A+  + VE                + +  L  ++N MI ++D++L+ L+ +Q    H IK  ++S+ A        +++V I +L+  ++++K AS D+E+++ +   L  LD DKDG I ++ +T+ +  +  E   +  K +
Sbjct:  184 RIWDELVHYYHGFRLLFIDVAICSKLLWRVLNGKTLTRRENKQLQRTTSDLFRLIPFSVFIIVPFMELLLPLFIKFFPGMLPSTFQTSTDRQEKLRQSLSVRLEVAKFLQQTLDQMPVQHKEHSSEEA---KQFEAFFTKIRNPTEPVSNDEIIKFAKRFDDEITLDSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIAREGVDSLDLLELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLSRTMLISDDSITTDKLKETIRVLPDAVGAHTRHAIGESEGKVDNKTKIEIIKEEERKIREEREEEREETIAKRSAIKEEI--PAPYVFAEKLSGSQDLLDHKEQSSVSETDKGISSTDVQLLSEALKTLSSDKQLVVEKETIKELKEELADYKEDVEELREVRQVVKEPVRESRAAKLLYNRVNKMISQLDNVLNDLEARQ----HQIKQAESSDYAASSPTVEPQQMVHIDELVATIRRMKEAS-DEERFKVVGDLLVKLDADKDGVISVNEITKAVQSIDREATNIDKKQL 731          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Zebrafish
Match: letm1 (leucine zipper-EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:570745])

HSP 1 Score: 377.096 bits (967), Expect = 5.127e-118
Identity = 220/576 (38.19%), Postives = 350/576 (60.76%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADEKESQRIV-------KETLIDTAAIVAVEKDKPLDVDSKRS----AISEESISTS-----------------DLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            TI Q++ +E  HYYHGFRL +++  I   +L+R+ +G  L+RRER+Q +RT AD+ RL PF+VFI VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLEMAKFLQDT+EE    NK +S+ +VT E F+ F +++R+SG+  + + I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  ++ DD++IA EG+D L A ELQ  CR RGMRA+GV+EERLR QL QWL+L + + +P SLLLLSR M+LPD LSP  QL   + +LPE+++KEA ++    D +K DNKTK E   +E+  I +E   E+E +R+        ++T    A ++ VE ++ +D +   S    AI  E++  +                 D+            N    ++EEL++LK+   E  +                 VE  K S RL+K++N MI  MD ++  L+ K + ++      +T+    E +++I++L+  +KQ+++    + K   I   LDE+KDG I++  + ++++++  E++ +S+  +  ++
Sbjct:  159 TIRQRVIDEVKHYYHGFRLLWIDTTIAVRMLWRVLNGHILSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNK-ASKGNVT-EEFSTFFQKIRDSGEIPSNEQIIRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLTANELQAACRVRGMRALGVTEERLREQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIMAKEAQVKVAELDFSKVDNKTKLETTLQEEAAIRQENR-ERELERLADAAEKAKEQTQSQEAEVLEVEGERRVDAEHALSSVDVAIHSETLRDTAPVLEGIKGEEITKEEIDMLSDACTKLKEQKNLLTKEKEELEDLKDDVQEYSEDLEEIKRELSKTGQEKAVEESKASQRLSKRVNRMIGRMDKIITELE-KDKMVLDGQMDSETTPPIGENLISINELITVMKQIQNIP--EHKLLSIADALDENKDGKIDIDDVIKVVELIDKEDIDISTNQVAEIM 728          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Zebrafish
Match: letm1 (leucine zipper-EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:570745])

HSP 1 Score: 373.629 bits (958), Expect = 9.289e-117
Identity = 224/586 (38.23%), Postives = 353/586 (60.24%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADEKESQRIV-------KETLIDTAAIVAVEKDKPLDVDSKRS----AISEESISTS-----------------DLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQT-SETA---------EERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            TI Q++ +E  HYYHGFRL +++  I   +L+R+ +G  L+RRER+Q +RT AD+ RL PF+VFI VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLEMAKFLQDT+EE    NK +S+ +VT E F+ F +++R+SG+  + + I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  ++ DD++IA EG+D L A ELQ  CR RGMRA+GV+EERLR QL QWL+L + + +P SLLLLSR M+LPD LSP  QL   + +LPE+++KEA ++    D +K DNKTK E   +E+  I +E   E+E +R+        ++T    A ++ VE ++ +D +   S    AI  E++  +                 D+            N    ++EEL++LK+   E  +                 VE  K S RL+K++N MI  MD ++  L  +++ ++ D   GQ  SET           E +++I++L+  +KQ+++    + K   I   LDE+KDG I++  + ++++++  E++ +S+  +  ++
Sbjct:  143 TIRQRVIDEVKHYYHGFRLLWIDTTIAVRMLWRVLNGHILSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNK-ASKGNVT-EEFSTFFQKIRDSGEIPSNEQIIRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLTANELQAACRVRGMRALGVTEERLREQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIMAKEAQVKVAELDFSKVDNKTKLETTLQEEAAIRQENR-ERELERLADAAEKAKEQTQSQEAEVLEVEGERRVDAEHALSSVDVAIHSETLRDTAPVLEGIKGEEITKEEIDMLSDACTKLKEQKNLLTKEKEELEDLKDDVQEYSEDLEEIKRELSKTGQEKAVEESKASQRLSKRVNRMIGRMDKIITEL--EKDKMVLD---GQMDSETTPPIGVFLSYRENLISINELITVMKQIQNIP--EHKLLSIADALDENKDGKIDIDDVIKVVELIDKEDIDISTNQVAEIM 718          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Zebrafish
Match: letm1 (leucine zipper-EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:570745])

HSP 1 Score: 372.089 bits (954), Expect = 5.842e-116
Identity = 220/588 (37.41%), Postives = 353/588 (60.03%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADEKESQRIV-------KETLIDTAAIVAVEKDKPLDVDSKRS----AISEESISTS-----------------DLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVG------------QTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            TI Q++ +E  HYYHGFRL +++  I   +L+R+ +G  L+RRER+Q +RT AD+ RL PF+VFI VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLEMAKFLQDT+EE    NK +S+ +VT E F+ F +++R+SG+  + + I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  ++ DD++IA EG+D L A ELQ  CR RGMRA+GV+EERLR QL QWL+L + + +P SLLLLSR M+LPD LSP  QL   + +LPE+++KEA ++    D +K DNKTK E   +E+  I +E   E+E +R+        ++T    A ++ VE ++ +D +   S    AI  E++  +                 D+            N    ++EEL++LK+   E  +                 VE  K S RL+K++N MI  MD ++  L  +++ ++ D ++             + S+   E +++I++L+  +KQ+++    + K   I   LDE+KDG I++  + ++++++  E++ +S+  +  ++
Sbjct:  159 TIRQRVIDEVKHYYHGFRLLWIDTTIAVRMLWRVLNGHILSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNK-ASKGNVT-EEFSTFFQKIRDSGEIPSNEQIIRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLTANELQAACRVRGMRALGVTEERLREQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIMAKEAQVKVAELDFSKVDNKTKLETTLQEEAAIRQENR-ERELERLADAAEKAKEQTQSQEAEVLEVEGERRVDAEHALSSVDVAIHSETLRDTAPVLEGIKGEEITKEEIDMLSDACTKLKEQKNLLTKEKEELEDLKDDVQEYSEDLEEIKRELSKTGQEKAVEESKASQRLSKRVNRMIGRMDKIITEL--EKDKMVLDGQMDSETTPPIGLFFEKRSDLPRENLISINELITVMKQIQNIP--EHKLLSIADALDENKDGKIDIDDVIKVVELIDKEDIDISTNQVAEIM 739          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Zebrafish
Match: letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-090521-4])

HSP 1 Score: 229.18 bits (583), Expect = 7.692e-66
Identity = 139/278 (50.00%), Postives = 198/278 (71.22%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLES--FNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPD 1324
            ++ QK+ +E  HYYHGFRL  ++  I G +++RL  G+ LTRRER++L+RT ADL RL PF++F+ VPF+E LLP++++ FP M+PSTF+  +K  EK ++ L  KLE+AKFLQ+T+ E    NK    A+V  E+  F+ +++QVR +G+  +T DI+KFS+LFEDE+TLE L+  QL ALCKLLE+Q +G    L F L +++  +K DD MIA EG+  +   ELQ  CR RGMR++G++ ++LR QL QWL L +++ VP SLLLLSR MYL D
Sbjct:  118 SLGQKVLDELKHYYHGFRLLGIDTKIAGRMVWRLLHGQQLTRRERRRLMRTCADLFRLVPFMLFVIVPFMEFLLPVFLKLFPEMLPSTFETETKKEEKQKKGLAAKLELAKFLQETIAEMARRNK----AAVGDETQKFSTYVQQVRHTGEQPSTKDIVKFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMQLRTIKADDEMIATEGVSVMTVAELQAACRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYLTD 391          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Zebrafish
Match: letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-090521-4])

HSP 1 Score: 150.214 bits (378), Expect = 1.782e-38
Identity = 90/181 (49.72%), Postives = 125/181 (69.06%), Query Frame = 2
Query:  788 KTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLES--FNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPD 1324
            K ++ L  KLE+AKFLQ+T+ E    NK    A+V  E+  F+ +++QVR +G+  +T DI+KFS+LFEDE+TLE L+  QL ALCKLLE+Q +G    L F L +++  +K DD MIA EG+  +   ELQ  CR RGMR++G++ ++LR QL QWL L +++ VP SLLLLSR MYL D
Sbjct:  167 KQKKGLAAKLELAKFLQETIAEMARRNK----AAVGDETQKFSTYVQQVRHTGEQPSTKDIVKFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMQLRTIKADDEMIATEGVSVMTVAELQAACRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYLTD 343          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 353.984 bits (907), Expect = 1.160e-109
Identity = 216/569 (37.96%), Postives = 349/569 (61.34%), Query Frame = 2
Query:  473 EDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADE---------KESQRIVKETLIDTAAIVAVEKDKPL-DVDSKRSAISEESISTS--DLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLID 2092
            E + VKK ++ QK+ +E  HYYHGFRL +++  I   +L ++ +G  ++RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++  VT E F  F +++R +G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+E+RL+ QL QWL+L +++++P SLLLLSR +YLPD LSP  QL   +  LPE V+KEA ++    +  K DNKTK E   +E++ I KE  ++         KESQ++  + +   A + A E+ + L D       I  E I+    D+                 ++EEL ELK+   E  +                 ++  K S  L K++N MI +MD ++  L+ +++ +   I+ G +S+   E +V+I++L++ ++ ++     ++K QRI   LDE+KDG I+L  + ++++++  E++ +S+  +  +++
Sbjct:  119 EVETVKK-SLGQKVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNK-AAKGDVTAE-FATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMERLADAAKESQQVAAKVMATVAQMSASEQAEILKDTAPVLEGIKGEEITKEEIDILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQETKASKILTKRVNRMIGQMDKIISELENEEKVLDEHIEKG-SSDCPLENLVSINELISIMRHIQKIP--EQKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIME 681          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 351.288 bits (900), Expect = 1.245e-108
Identity = 216/570 (37.89%), Postives = 349/570 (61.23%), Query Frame = 2
Query:  473 EDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADE---------KESQRI---VKETLIDTAAIVAVEKD-KPLDVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLID 2092
            E + VKK ++ QK+ +E  HYYHGFRL +++  I   +L ++ +G  ++RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++  VT E F  F +++R +G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+E+RL+ QL QWL+L +++++P SLLLLSR +YLPD LSP  QL   +  LPE V+KEA ++    +  K DNKTK E   +E++ I KE  ++         KESQ++   V  +L++   +  + KD  P+    K   I++E I   D+                 ++EEL ELK+   E  +                 ++  K S  L K++N MI +MD ++  L+ +++ +   I+ G       E +V+I++L++ ++ ++     ++K QRI   LDE+KDG I+L  + ++++++  E++ +S+  +  +++
Sbjct:  122 EVETVKK-SLGQKVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNK-AAKGDVTAE-FATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMERLADAAKESQQVAAKVMASLLNGVELSEILKDTAPVLEGIKGEEITKEEI---DILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQETKASKILTKRVNRMIGQMDKIISELENEEKVLDEHIEKGSVPPVG-ENLVSINELISIMRHIQKIP--EQKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIME 682          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 347.436 bits (890), Expect = 3.295e-107
Identity = 214/579 (36.96%), Postives = 348/579 (60.10%), Query Frame = 2
Query:  473 EDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADE---------KESQRIVKETL------IDTAAIVAVEKDKPLDVDS-------KRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLID 2092
            E + VKK ++ QK+ +E  HYYHGFRL +++  I   +L ++ +G  ++RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++  VT E F  F +++R +G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+E+RL+ QL QWL+L +++++P SLLLLSR +YLPD LSP  QL   +  LPE V+KEA ++    +  K DNKTK E   +E++ I KE  ++         KESQ++  + +      ++     A  +D  +  D+       K   I++E I   D+                 ++EEL ELK+   E  +                 ++  K S  L K++N MI +MD ++  L+ +++ +   I+ G       E +V+I++L++ ++ ++     ++K QRI   LDE+KDG I+L  + ++++++  E++ +S+  +  +++
Sbjct:  106 EVETVKK-SLGQKVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNK-AAKGDVTAE-FATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMERLADAAKESQQVAAKVMASLLNGVELCGTGATSQDSEILKDTAPVLEGIKGEEITKEEI---DILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQETKASKILTKRVNRMIGQMDKIISELENEEKVLDEHIEKGSVPPVG-ENLVSINELISIMRHIQKIP--EQKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIME 675          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 342.428 bits (877), Expect = 2.757e-105
Identity = 212/575 (36.87%), Postives = 346/575 (60.17%), Query Frame = 2
Query:  473 EDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADE---------KESQRIVKETL------IDTAAIVAVEKDKPL-DVDSKRSAISEESISTS--DLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLID 2092
            E + VKK ++ QK+ +E  HYYHGFRL +++  I   +L ++ +G  ++RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++  VT E F  F +++R +G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+E+RL+ QL QWL+L +++++P SLLLLSR +YLPD LSP  QL   +  LPE V+KEA ++    +  K DNKTK E   +E++ I KE  ++         KESQ++  + +      ++ + + A E+ + L D       I  E I+    D+                 ++EEL ELK+   E  +                 ++  K S  L K++N MI +MD ++  L+ +++ +    +         E +V+I++L++ ++ ++     ++K QRI   LDE+KDG I+L  + ++++++  E++ +S+  +  +++
Sbjct:  118 EVETVKK-SLGQKVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNK-AAKGDVTAE-FATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMERLADAAKESQQVAAKVMASLLNGVELSQMSASEQAEILKDTAPVLEGIKGEEITKEEIDILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQETKASKILTKRVNRMIGQMDKIISELENEEKVLYFAFR---------ENLVSINELISIMRHIQKIP--EQKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIME 678          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Xenopus
Match: anapc1 (anaphase promoting complex subunit 1 [Source:Xenbase;Acc:XB-GENE-5894738])

HSP 1 Score: 342.043 bits (876), Expect = 1.289e-104
Identity = 221/600 (36.83%), Postives = 350/600 (58.33%), Query Frame = 2
Query:  473 EDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADE---------KESQRI-----------------VKETLIDTAAIVAVE-----------KD-KPLDVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETA-----EERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLID 2092
            E + VKK ++ QK+ +E  HYYHGFRL +++  I   +L ++ +G  ++RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++  VT E F  F +++R +G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+E+RL+ QL QWL+L +++++P SLLLLSR +YLPD LSP  QL   +  LPE V+KEA ++    +  K DNKTK E   +E++ I KE  ++         KESQ++                 +K    DTAA  AV            KD  P+    K   I++E I   D+                 ++EEL ELK+   E  +                 ++  K S  L K++N MI +MD ++  L+ +++ +   I+ G            E +V+I++L++ ++ ++     ++K QRI   LDE+KDG I+L  + ++++++  E++ +S+  +  +++
Sbjct:  147 EVETVKK-SLGQKVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNK-AAKGDVTAE-FATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMERLADAAKESQQVAAKVDVQSAPEEAISGEMKTATADTAAEPAVAQMSASEQAEILKDTAPVLEGIKGEEITKEEI---DILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQETKASKILTKRVNRMIGQMDKIISELENEEKVLDEHIEKGSVPPVGLYFAFRENLVSINELISIMRHIQKIP--EQKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIME 738          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Mouse
Match: Letm1 (leucine zipper-EF-hand containing transmembrane protein 1 [Source:MGI Symbol;Acc:MGI:1932557])

HSP 1 Score: 342.813 bits (878), Expect = 3.045e-105
Identity = 213/575 (37.04%), Postives = 352/575 (61.22%), Query Frame = 2
Query:  479 KAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIAKEQADE-KESQRIVK------------------------------ETLIDTAAIVAVEKDKPL---DVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ--VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAE-ERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            + V + ++ QK+ +E  HYYHGFRL +++  I   +L+R+ +G TLTRRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  S   E+ ++ L+ KLE+AKFLQDT+EE    NK +++ + T + F+ F +++RE+G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +++  +K DD++I+ EG+D L   ELQ  CR RGMRA+GV+E+RL+ QL QWL L +  ++P SLL+LSR MYLPD LSP  QL   +  LPE+V+KEA ++    +  K DNK K E   +E+  I +E  +E K +   VK                              E L DTA ++   K + +   ++D    A S+       L + +  +E +  +   + E+ L E+K++ ++  ++  +E    S RL+K++  MI ++D L+ +L+  Q+    D K+G +  T   E V++I++L++A+KQ+K     + K   + + LD++KDG+I +  + +++D++  E+V++S+  +  ++
Sbjct:  145 QVVVRKSLGQKVLDELRHYYHGFRLLWIDTKIAARMLWRILNGHTLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVVVKLFPNMLPSTFETQSIKEERLKKELRVKLELAKFLQDTIEEMALKNK-AAKGNAT-KDFSAFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLISEEGVDSLTVKELQAACRARGMRALGVTEDRLKGQLKQWLDLHLHHEIPTSLLILSRAMYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEKVDNKAKLEATLQEEAAIQQEHLEELKRASEAVKDIQPEVAEATLPGRPGPEPQPPVDDVILPSEVLTDTAPVLEGLKGEEITKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYSED-LQEIKKELSKTGEEKYIEESAASKRLSKRVQQMIGQIDGLITQLETTQQ----DGKLGPSQSTPTGESVISITELISAMKQIKHIP--EHKLISLTSALDDNKDGNINIDDLVKVIDLVNKEDVQISTTQVAEIV 710          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Mouse
Match: Letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:2444979])

HSP 1 Score: 229.95 bits (585), Expect = 4.747e-66
Identity = 139/308 (45.13%), Postives = 202/308 (65.58%), Query Frame = 2
Query:  491 KLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYS-SEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYL------PDQLSPEQQLTKAILHLPEVVSKEA 1393
            K ++ QKI NE  +YY GF L +++  +   I++RL  G  LTRRER++L+RT AD+ RL PF+VFI VPF+E L+P++++ FP M+PSTF+  SK  EK ++ +  KLE+AKFLQ+T+ E    N+    +AS  L S   ++KQV ++G   +T +I++FS+LF+D++ LE LD  QL ALCKLLE+Q+ G    L F L + +  +K DD +IA+EG+  L   ELQ  CR RGMR++G++EE+L  QL+ WL L +++ VP SLLLLSRT YL      P +L P  +  K  L +P     E+
Sbjct:  117 KRSLRQKIVNELKYYYKGFSLLWIDTKVAARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFMVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKEEKQKKTMAAKLEIAKFLQETMTEMARRNRAKLGDASSQLSS---YVKQV-QTGHKPSTKEIVRFSKLFKDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMTLKSIKADDEIIAKEGVKALSVSELQSACRARGMRSLGLTEEQLCQQLTGWLDLHLKENVPPSLLLLSRTFYLIDVKPKPIELPPNIETPKPNLGIPTPPPPES 420          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Mouse
Match: Letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:2444979])

HSP 1 Score: 100.908 bits (250), Expect = 6.939e-23
Identity = 68/148 (45.95%), Postives = 101/148 (68.24%), Query Frame = 2
Query:  488 KKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYS-SEASVTLESFNLFMKQV 928
            +K ++ QKI NE  +YY GF L +++  +   I++RL  G  LTRRER++L+RT AD+ RL PF+VFI VPF+E L+P++++ FP M+PSTF+  SK  EK ++ +  KLE+AKFLQ+T+ E    N+    +AS  L S   ++KQV
Sbjct:  116 EKRSLRQKIVNELKYYYKGFSLLWIDTKVAARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFMVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKEEKQKKTMAAKLEIAKFLQETMTEMARRNRAKLGDASSQLSS---YVKQV 260          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Mouse
Match: Letm2 (leucine zipper-EF-hand containing transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:2444979])

HSP 1 Score: 84.3445 bits (207), Expect = 7.092e-18
Identity = 49/105 (46.67%), Postives = 73/105 (69.52%), Query Frame = 2
Query:  488 KKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQL 802
            +K ++ QKI NE  +YY GF L +++  +   I++RL  G  LTRRER++L+RT AD+ RL PF+VFI VPF+E L+P++++ FP M+PSTF+  SK      +L
Sbjct:  116 EKRSLRQKIVNELKYYYKGFSLLWIDTKVAARIVWRLLHGNALTRRERRRLLRTCADVFRLVPFMVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKVHGILKL 220          
BLAST of Mitochondrial proton/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|Q5ZK33|LETM1_CHICK (Mitochondrial proton/calcium exchanger protein OS=Gallus gallus OX=9031 GN=LETM1 PE=2 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 9.953e-122
Identity = 232/587 (39.52%), Postives = 358/587 (60.99%), Query Frame = 2
Query:  485 VKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIAKEQADEKESQRI------VKETL----------IDTAAIVAVEKDKPLDVDSKRS-----------------AISEESISTSDLXXXXXXXXXXXXXXTAW--------------QE--EELDELKE-QAAELHDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQT-SETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            V K +I Q+I +E  HYYHGFRL +++  I   +L+R+  G TL+RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++ +VT + F+ F +++RE+G+  + ++IL+FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +++  +K DD+MIA EG+D L   ELQ  CR RGMRA+GV+EERLR QL QWL L + +++P SLL+LSR MYLPD LSP  QL   +  LPE V+KEA ++    +  K DNK + E   +E+  I KE  +EKE +RI       KETL          +D    V   K+  + +DSK+                   I  E I+  +++ + +A   +     +               QE  E+L E+KE   A   + VE  K S RL K++N MI ++D +++ L+  Q+ +  D+K+ +  S  A E +++I++L+NA+KQ++     +EK  RI   LDE+KDG I++ ++ ++++++  E+V + +  +  ++
Sbjct:  145 VVKKSIGQRIVDELKHYYHGFRLLWIDTKIAARMLWRILHGNTLSRRERRQFLRICADLFRLVPFLVFLVVPFMEFLLPVALKLFPNMLPSTFETKSKKEERLKKQLRVKLELAKFLQDTIEEMALKNK-AAKGNVT-KDFSTFFQKIRETGERPSNEEILRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRTIKADDKMIAEEGVDSLTVKELQAACRARGMRALGVTEERLREQLKQWLDLHLNQEIPTSLLILSRAMYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAEVEGEKVDNKARLEATLQEEAAIRKEN-EEKEMERITEAAEKAKETLQVAAMKLESAVDLEPAVLQVKESQVAMDSKQELAKADMETLKDTAPVLEGIKGEEITKEEIDMLSDACNKLQEQKKSLTKEKEELEELKGDIQEYNEDLQEIKELSKAGQEEVVEESKASKRLTKRVNRMIGQIDKIINELETNQKTV--DVKLDRGDSPPAGENLISIAELINAMKQIQKIP--EEKLTRIAEALDENKDGKIDIDNVVKVVELIDKEDVDIGTSQVAEIM 724          
BLAST of Mitochondrial proton/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|Q1LY46|LETM1_DANRE (Mitochondrial proton/calcium exchanger protein OS=Danio rerio OX=7955 GN=letm1 PE=3 SV=2)

HSP 1 Score: 377.096 bits (967), Expect = 3.870e-117
Identity = 220/576 (38.19%), Postives = 350/576 (60.76%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADEKESQRIV-------KETLIDTAAIVAVEKDKPLDVDSKRS----AISEESISTS-----------------DLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            TI Q++ +E  HYYHGFRL +++  I   +L+R+ +G  L+RRER+Q +RT AD+ RL PF+VFI VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLEMAKFLQDT+EE    NK +S+ +VT E F+ F +++R+SG+  + + I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  ++ DD++IA EG+D L A ELQ  CR RGMRA+GV+EERLR QL QWL+L + + +P SLLLLSR M+LPD LSP  QL   + +LPE+++KEA ++    D +K DNKTK E   +E+  I +E   E+E +R+        ++T    A ++ VE ++ +D +   S    AI  E++  +                 D+            N    ++EEL++LK+   E  +                 VE  K S RL+K++N MI  MD ++  L+ K + ++      +T+    E +++I++L+  +KQ+++    + K   I   LDE+KDG I++  + ++++++  E++ +S+  +  ++
Sbjct:  159 TIRQRVIDEVKHYYHGFRLLWIDTTIAVRMLWRVLNGHILSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNK-ASKGNVT-EEFSTFFQKIRDSGEIPSNEQIIRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLTANELQAACRVRGMRALGVTEERLREQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIMAKEAQVKVAELDFSKVDNKTKLETTLQEEAAIRQENR-ERELERLADAAEKAKEQTQSQEAEVLEVEGERRVDAEHALSSVDVAIHSETLRDTAPVLEGIKGEEITKEEIDMLSDACTKLKEQKNLLTKEKEELEDLKDDVQEYSEDLEEIKRELSKTGQEKAVEESKASQRLSKRVNRMIGRMDKIITELE-KDKMVLDGQMDSETTPPIGENLISINELITVMKQIQNIP--EHKLLSIADALDENKDGKIDIDDVIKVVELIDKEDIDISTNQVAEIM 728          
BLAST of Mitochondrial proton/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|Q0VCA3|LETM1_BOVIN (Mitochondrial proton/calcium exchanger protein OS=Bos taurus OX=9913 GN=LETM1 PE=2 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 5.112e-111
Identity = 209/578 (36.16%), Postives = 349/578 (60.38%), Query Frame = 2
Query:  482 AVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIA----------KEQADEKESQRIVKETLIDTAA----IVAVEKDKPL---------DVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQ----------------EEELDELKEQAAELHDQ--VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            AV+K  + Q++ +E  HYYHGFRL +++  I   +L+R+  G +LTRRER+Q +R  ADL RL PF+ F+ VPF+E LLP+ ++ FP M+PSTF+  S   E+ ++ L+ KLE+AKFLQDT+EE    NK +++ S T + F++F +++RE+G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +++  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+E+RLR QL QWL+L + +++P SLL+LSR MYLP+ LSP  QL   +  LPE+V+KEA ++    +  + DNK K E   +E+  I           K QA   ++ + V+  ++   A    +  ++ ++P          D       + EE I+  +++ + NA   +     +                   ++L E+K++ ++  ++  VE  K S RL K++  MI +MDSLL +L+  Q+     +     +  A E V+++S+L+NA+KQ+K     + K   + + LD++KDG +++  + ++++++  E+V +S+  +  ++
Sbjct:  134 AVRK-PLGQRVLDELRHYYHGFRLLWIDTKIAARMLWRILHGHSLTRRERRQFLRICADLFRLVPFLFFVVVPFMEFLLPVAVKLFPNMLPSTFETQSSKEERLKKELRVKLELAKFLQDTIEEMALKNK-AAKGSAT-KDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLELHLHQEIPTSLLILSRAMYLPETLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEHREKELQRKSQAAVAQAAKEVEPEVVAEGAPGRPVAELQPEEPAVTLPSEVLKDSAPVLEGLKEEEITQEEIDVLSNACSKLKEQKKSLTKEKEELELLKGDVQDYSQDLQEIKKELSKTGEEMYVEESKASKRLTKRVQQMIGQMDSLLAQLEADQKA--GRLGPAAEAAPAGETVISVSELINAMKQIKHIP--ESKLLSLASALDDNKDGKVDIDDLVKVIELVDKEDVHISTSQVAEIV 704          
BLAST of Mitochondrial proton/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|Q0VA06|LETM1_XENTR (Mitochondrial proton/calcium exchanger protein OS=Xenopus tropicalis OX=8364 GN=letm1 PE=2 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 9.862e-105
Identity = 221/595 (37.14%), Postives = 350/595 (58.82%), Query Frame = 2
Query:  473 EDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADE---------KESQRI-----------------VKETLIDTAAIVAVE-----------KD-KPLDVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ----------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLID 2092
            E + VKK ++ QK+ +E  HYYHGFRL +++  I   +L ++ +G  ++RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++  VT E F  F +++R +G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +K+  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+E+RL+ QL QWL+L +++++P SLLLLSR +YLPD LSP  QL   +  LPE V+KEA ++    +  K DNKTK E   +E++ I KE  ++         KESQ++                 +K    DTAA  AV            KD  P+    K   I++E I   D+                 ++EEL ELK+   E  +                 ++  K S  L K++N MI +MD ++  L+ +++ +   I+ G       E +V+I++L++ ++ ++     ++K QRI   LDE+KDG I+L  + ++++++  E++ +S+  +  +++
Sbjct:  147 EVETVKK-SLGQKVIDEIKHYYHGFRLLWIDTKIAARMLRQILNGHAMSRRERRQFLRICADLFRLVPFLVFVIVPFMEFLLPVALKLFPNMLPSTFETFSKKEERLKKELRVKLELAKFLQDTIEEIALRNK-AAKGDVTAE-FATFFQKIRSTGERPSNEEIVRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMKLRSIKADDKLIADEGLDSLTVTELQAACRARGMRALGVTEDRLKEQLKQWLELHLDQEIPTSLLLLSRALYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAAVECEKVDNKTKLEATLQEEEAIRKENQEKEMERLADAAKESQQVAAKVDVQSAPEEAISGEMKTATADTAAEPAVAQMSASEQAEILKDTAPVLEGIKGEEITKEEI---DILSDACTKLKEQKKLLTKEKEELSELKDDVQEYSEDLQEIKKELSKTGQEKVLQETKASKILTKRVNRMIGQMDKIISELENEEKVLDEHIEKGSVPPVG-ENLVSINELISIMRHIQKIP--EQKLQRIAAALDENKDGKIDLDDVAKVVELIDKEDIDISTSQVAEIME 732          
BLAST of Mitochondrial proton/calcium exchanger protein vs. UniProt/SwissProt
Match: sp|Q5XIN6|LETM1_RAT (Mitochondrial proton/calcium exchanger protein OS=Rattus norvegicus OX=10116 GN=Letm1 PE=1 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.682e-104
Identity = 212/574 (36.93%), Postives = 349/574 (60.80%), Query Frame = 2
Query:  479 KAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIAKEQADE--------KESQRIVKETLI-----------------------DTAAIVAVEKDKPL---DVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ--VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            + V K ++ QKI +E  HYYHGFRL +++  I   +L+R+ +G TLTRRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  S   E+ ++ L+ KLE+AKFLQDT+EE    NK +++ + T + F+ F +++RE+G+  + ++I++FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +++  +K DD++I+ EG+D L   ELQ  CR RGMRA+GV+E+RL+ QL QWL L +  ++P SLL+LSR MYLPD LSP  QL   +  LPE+V+KEA +++   +  + DNK K E   +E+  I +E  +E        K+ Q  V E  +                       DTA ++   K + +   ++D    A S+       L + +  +E +  +   + E +L E+K++ ++  D+  +E    S RL+K++  MI ++D L+ +L+  Q+N    +     S    E V+++ +L++A+KQ+K     + K   + + LDE+KDG+I +  + +++D++  E+V++S+  +  ++
Sbjct:  145 QVVVKKSLGQKILDELKHYYHGFRLLWIDTKIAARMLWRILNGHTLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVVVKLFPNMLPSTFETQSIKEERLKKELRVKLELAKFLQDTIEEMALKNK-AAKGNAT-KDFSAFFQKIRETGERPSNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLISEEGVDSLTVKELQAACRARGMRALGVTEDRLKGQLKQWLDLHLYHEIPTSLLILSRAMYLPDTLSPADQLKSTLQTLPEIVAKEAQVKAAEVEGEQVDNKAKLEATLQEEAAIQQEHLEELKRAAETAKDIQPEVAEATVPGRPGAELQPKMVDVIPPSEILKDTAPVLEGLKGEEITKEEIDILSDACSKLKEQKKSLTKEKEELELLKEDVQDYSE-DLQEIKKELSKTGDEKYIEESTASKRLSKRVQQMIGQIDGLITQLETTQQN--GKLDPAAASSPTGESVISVDELISAMKQIKHIP--EHKLISLTSALDENKDGNINIDDLVKVIDLVNKEDVQISTTQVAEIV 711          
BLAST of Mitochondrial proton/calcium exchanger protein vs. TrEMBL
Match: A0A4E0RHR0 (Leucine zipper-EF-hand-containing transmembrane protein 1 mitochondrial OS=Fasciola hepatica OX=6192 GN=D915_001632 PE=4 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 8.825e-133
Identity = 250/643 (38.88%), Postives = 373/643 (58.01%), Query Frame = 2
Query:  488 KKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRT--DNKFDNKTKWELMSEE-----------------QKLIAKEQADEKES--QRIV--KETLIDTAAIV---------------------AVEKDKPLDVDSKRS-------AISEESISTSDLXXXXXXXXXXXXXXT------------------------AWQEEELDELKEQAAELHDQ-------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENII-----HDIKVGQTSETAE------------ERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLIDAID 2101
            KKL++ QK+K E  HYYHGFRL  LEV I  GI  RL  G +LTRRERKQLVRTVAD++RL PF VFI VPF+E LLP Y++FFPFM+PSTF++ S + EK RQ +K KLEM +FLQ+TL  T        E S + E F  F+K+V+ESGQ  + ++I +FS+LFED++TL+SL+  QLK LC+LL + ++GP   L F L+++V  LK +DR++A+EG++ +PA+ELQ +C++RGMR+VG++EERLR QL+QWL L +EK VP++LLL SR +++    + E  L +AI  LP   S+EA+ R + +    + D +TK EL+ +E                 QK  A  + D K +  Q++    E L+D A ++                       E+   L ++ K+S       A   ES S+ +L   E   + ++   T                        A  EE ++ LKE+ AE   +               T K + RL  ++  MI EMD+++D+L  +++ ++     H++ V  ++E  E            ERVV I+DL+ AL++L+    DD +WQ+IL VLDED DG IE+ H+  ++++LG+E VKLSSK++ R+++ +D
Sbjct:  135 KKLSMWQKVKKEVAHYYHGFRLLGLEVKIASGICIRLLCGNSLTRRERKQLVRTVADIIRLVPFAVFIIVPFMEFLLPFYLKFFPFMLPSTFKYKSTEAEKIRQRVKAKLEMTRFLQETLHHTTGAVS-EGEKSPSFEQFQGFLKKVQESGQFLSDEEITRFSKLFEDQITLDSLELNQLKMLCRLLSLPTMGPSNLLRFQLQMRVRQLKAEDRLLAKEGVNTIPAWELQTLCQDRGMRSVGLTEERLRNQLAQWLNLHLEKNVPVTLLLFSRALHVSKASTAELPLKEAIAQLPTAASEEATARVLESALPTELDPRTKIELLRKEQANIKAARIQRKQELAEQKKAAASELDAKSAREQKLAPAAEDLVDKAPVLKGLPKEELENVKEAPSVSVVSTTEEPLALTIEGKKSQTAVAAQATPTESTSSKELQLKEALKKVLAAKVTKEEEPEITVVDLAQIESAIAESSGALHEEAMEGLKEEVAETATKHTASLVSADRTVDKRTTKAAQRLASRVGRMIGEMDTMMDKLAEEKQQLLKNIELHEVHVKHSTEPTEKSEILDAIKADHERVVDINDLLLALRRLQKVP-DDTRWQKILDVLDEDHDGKIEMQHVLSVIELLGAENVKLSSKEIKRVLEMVD 775          
BLAST of Mitochondrial proton/calcium exchanger protein vs. TrEMBL
Match: A0A1S8WT47 (LETM1-like protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_06532 PE=4 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 3.085e-128
Identity = 238/595 (40.00%), Postives = 350/595 (58.82%), Query Frame = 2
Query:  488 KKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRT--DNKFDNKTKWELMSEEQKLI--AKEQAD------------EKESQRIVKETLIDTAA-------IVAVEKDKP----LDVDSKRSAISEESISTSDLXXXXXXXXXXXXXXT------------------------AWQEEELDELKEQAAELHDQVE----------------TKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIK-----VGQTSETAE------------ERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHM 2020
            KKLT+ Q+ K E VHYYHGFRL  LEV I  GI +RL  G  L+RRERKQLVRTVAD++RL PF +FI VPF+E LLP Y++FFPFM+PSTF+  + + E+ RQ LK KLEM +FLQ+TL  T       +  S T+  F  F+K+V+ESGQ A  ++I +FS+LFED+VTLESL+ +QLK LC+LL + ++GP   L F + ++V  LK +DR+IA+EG+DK+P +ELQ +C+ERGMR+VG++EERLR QL+QWL L +EK VP++LLL SR +++    S +  L +AI  LP   S++A+  ++ +    + D + K EL+ +EQ  I  A+ Q D            E +++  + E L+D A        I  +   +P       D K +A +   IS +      +   +   + T                        A QEE LD LKE+ AE   +++                T+K +NRL  ++  MI EMD+++++L  +++ ++ DI+     V   +E +E            +RVV I+DL+ AL++++    DD KW++IL VLDED+DG IEL H+
Sbjct:  132 KKLTLWQRAKKEIVHYYHGFRLLGLEVRIATGICFRLLRGHALSRRERKQLVRTVADIIRLVPFAIFIIVPFMEFLLPFYLKFFPFMLPSTFKDKTSEGERIRQRLKAKLEMTRFLQETLHHTTG-TALEASGSPTVNEFQDFLKKVQESGQPATAEEITRFSKLFEDQVTLESLEMKQLKMLCQLLSLPTIGPSNLLRFQIWLRVRQLKAEDRLIAKEGVDKIPVWELQSLCQERGMRSVGLTEERLRSQLAQWLALHLEKNVPVTLLLFSRALHVTQASSGDLPLKEAIAQLPPSASEQAAALALESTPHAELDPRAKMELLRKEQASIKAARVQRDQELAELKSTSQAEGKTEPTMDEKLVDKAPTNTDTNKISPISTSEPSVTITAPDEKPAAGTATQISEAPAPVAASGTTAAVVDKTKEEDTEISVDDLNQIETAISESSDALQEEALDGLKEEVAETTKRIKQQEAALVSVDRPVDKRTRKAANRLAARVGQMIGEMDTMIEKLNDERKQLLKDIELREIHVKHATEPSEQTEMLDAIQADHQRVVDINDLLLALRRIQKVP-DDTKWEKILKVLDEDQDGKIELQHV 724          
BLAST of Mitochondrial proton/calcium exchanger protein vs. TrEMBL
Match: A0A1I7Q423 (Mitochondrial proton/calcium exchanger protein OS=Gallus gallus OX=9031 GN=LETM1 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 4.245e-119
Identity = 232/587 (39.52%), Postives = 358/587 (60.99%), Query Frame = 2
Query:  485 VKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIAKEQADEKESQRI------VKETL----------IDTAAIVAVEKDKPLDVDSKRS-----------------AISEESISTSDLXXXXXXXXXXXXXXTAW--------------QE--EELDELKE-QAAELHDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQT-SETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            V K +I Q+I +E  HYYHGFRL +++  I   +L+R+  G TL+RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++ +VT + F+ F +++RE+G+  + ++IL+FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +++  +K DD+MIA EG+D L   ELQ  CR RGMRA+GV+EERLR QL QWL L + +++P SLL+LSR MYLPD LSP  QL   +  LPE V+KEA ++    +  K DNK + E   +E+  I KE  +EKE +RI       KETL          +D    V   K+  + +DSK+                   I  E I+  +++ + +A   +     +               QE  E+L E+KE   A   + VE  K S RL K++N MI ++D +++ L+  Q+ +  D+K+ +  S  A E +++I++L+NA+KQ++     +EK  RI   LDE+KDG I++ ++ ++++++  E+V + +  +  ++
Sbjct:  148 VVKKSIGQRIVDELKHYYHGFRLLWIDTKIAARMLWRILHGNTLSRRERRQFLRICADLFRLVPFLVFLVVPFMEFLLPVALKLFPNMLPSTFETKSKKEERLKKQLRVKLELAKFLQDTIEEMALKNK-AAKGNVT-KDFSTFFQKIRETGERPSNEEILRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRTIKADDKMIAEEGVDSLTVKELQAACRARGMRALGVTEERLREQLKQWLDLHLNQEIPTSLLILSRAMYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAEVEGEKVDNKARLEATLQEEAAIRKEN-EEKEMERITEAAEKAKETLQVAAMKLESAVDLEPAVLQVKESQVAMDSKQELAKADMETLKDTAPVLEGIKGEEITKEEIDMLSDACNKLQEQKKSLTKEKEELEELKGDIQEYNEDLQEIKELSKAGQEEVVEESKASKRLTKRVNRMIGQIDKIINELETNQKTV--DVKLDRGDSPPAGENLISIAELINAMKQIQKIP--EEKLTRIAEALDENKDGKIDIDNVVKVVELIDKEDVDIGTSQVAEIM 727          
BLAST of Mitochondrial proton/calcium exchanger protein vs. TrEMBL
Match: A0A091U241 (Uncharacterized protein (Fragment) OS=Phoenicopterus ruber ruber OX=9218 GN=N337_01206 PE=4 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 4.855e-119
Identity = 226/593 (38.11%), Postives = 361/593 (60.88%), Query Frame = 2
Query:  485 VKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIAKEQADEKESQRI------VKETLIDTAAIVAVEKDKPLDVDS---KRSAIS---EESISTSDLXXXXXXXXXXXXXXTAWQ-----EEELDELKEQAAELHDQ---------------------------------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKV-GQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            V K +I Q+I +E  HYYHGFRL +++  I   +L+R+  G TL+RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+ +SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++ +VT + F+ F +++RE+G+  + ++IL+FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +++  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+EERL+ QL QWL L + +++P SLL+LSR MYLPD LSP  QL   +  LPE V+KEA ++    +  K DNK + E   +E++ I KE  +EKE +R+       KETL   AA+  VE    L+  +   K+S ++   E+ ++ +D+      ++  +      +     +EE+D L +   +L +Q                                       VE  K S RL K++N MI ++D +++ L+  Q+ +  D+K+ G  S  A E +++I++L+NA+KQ++     +EK  RI   LDE+KDG I++ ++ ++++++  E++ + +  +  ++
Sbjct:  123 VVKKSIGQRIVDELKHYYHGFRLLWIDTKIAARMLWRILHGNTLSRRERRQFLRICADLFRLVPFLVFLVVPFMEFLLPVALKLFPNMLPSTFETTSKKEERLKKQLRVKLELAKFLQDTIEEMALKNK-AAKGNVT-KDFSTFFQKIRETGERPSNEEILRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLIAEEGVDSLTVKELQAACRARGMRALGVTEERLKEQLKQWLDLHLNQEIPTSLLILSRAMYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAEVEGEKVDNKARLEATLQEEEAIRKEN-EEKEMERMSEAAEKAKETL-QVAAMKEVESAVDLEAAALQVKKSQMAMDTEQELARADMAMHSETLKDTAPVLEGIKGEEITKEEIDMLSDACTKLQEQKKSLTKEKEELKELKGDIQEYNEDLQEIKELSKTGQEEVVEESKASKRLTKRVNRMIGQIDKIINELETTQKTV--DVKLDGGDSPPAGENLISIAELINAMKQIQKIP--EEKLTRIAEALDENKDGKIDIDNVVKVVELIDKEDIDIGTSQVAEIM 707          
BLAST of Mitochondrial proton/calcium exchanger protein vs. TrEMBL
Match: A0A091PWY7 (Uncharacterized protein (Fragment) OS=Leptosomus discolor OX=188344 GN=N330_01389 PE=4 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 1.282e-118
Identity = 225/593 (37.94%), Postives = 360/593 (60.71%), Query Frame = 2
Query:  485 VKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDN-KFDNKTKWELMSEEQKLIAKEQADEKESQRI------VKETLIDTAAIVAVEKDKPLDVDS---KRSAIS---EESISTSDLXXXXXXXXXXXXXXTAWQ-----EEELDELKEQAAELHDQ---------------------------------------VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKV-GQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            V K +I Q++ +E  HYYHGFRL +++  I   +L+R+  G TL+RRER+Q +R  ADL RL PF+VF+ VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLE+AKFLQDT+EE    NK +++ +VT + F+ F +++RE+G+  + ++IL+FS+LFEDE+TL++L   QL ALCKLLE+QS+G   FL F L +++  +K DD++IA EG+D L   ELQ  CR RGMRA+GV+EERL+ QL QWL L + +++P SLL+LSR MYLPD LSP  QL   +  LPE V+KEA ++    +  K DNK + E   +E++ I KE  +EKE +R+       KETL   AA+  VE    L+  +   K++ I+   E+ ++ +D+      ++  +      +     +EE+D L +   +L +Q                                       VE  K S RL K++N MI ++D +++ L+  Q+ +  D+K+ G  S  A E +++I++L+NA+KQ++     +EK  RI   LDE+KDG I++ ++ ++++++  E++ + +  +  ++
Sbjct:  123 VVKKSIGQRVVDELKHYYHGFRLLWIDTKIAARMLWRILHGTTLSRRERRQFLRICADLFRLVPFLVFLVVPFMEFLLPVALKLFPNMLPSTFETKSKKEERLKKELRVKLELAKFLQDTIEEMALKNK-AAKGNVT-KDFSTFFQKIRETGERPSNEEILRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLIAEEGVDSLTVKELQAACRARGMRALGVTEERLKEQLKQWLDLHLNQEIPTSLLILSRAMYLPDTLSPADQLKTTLQTLPESVAKEAQVKVAEVEGEKVDNKARLEATLQEEEAIRKEN-EEKEMERLSEAAEKAKETL-QVAAMKEVEPAVDLEAAALQVKKTQIAMETEQELARADMAMHSETLKDTAPVLEGIKGEEITKEEIDMLSDACTKLQEQKKSLTKEKEELEELKGDIQEYNEDLQEIKELSKTGQEEAVEESKASKRLTKRVNRMIGQIDKIINELETNQKTV--DVKLDGGDSPAAGENLISIAELINAMKQIQKIP--EEKLTRIAEALDENKDGKIDIDNVVKVVELIDKEDIDIGTSQVAEIM 707          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Cavefish
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:103046373])

HSP 1 Score: 374.785 bits (961), Expect = 2.780e-117
Identity = 214/561 (38.15%), Postives = 351/561 (62.57%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADEKESQRI------VKETLIDTAAI----VAVEKDKPLDVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQ----------------EEELDELKEQAAEL--HDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQ-TSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            ++ Q++ +E  HYYHGFRL +++  I G +L+R+ +G  L+RRER+Q +RT AD+ RL PF+VFI VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLEMAKFLQDT+EE    NK + + +VT E F+ F +++R+SG+  + + I++FS+LFEDE+TL++L   QL ALC+LLE+QS+G   FL F L +K+  ++ DD++IA EG+D L   ELQ  CR RGMRA+GV+EERL+ QL QWL+L + + +P SLLLLSR M+LPD LSP  QL   + +LPE+V+KEA ++    D +K DNKTK E M +E+  I +E   EKE +R+       KE     AA+    VA+  +   D       I  E I+  +++ + +A   +                         E+L+E+K++ ++     QVE  K S  L++++N MI  MD +++ L  +++ ++ D ++G  T+    E +++I++L+  ++ ++S    ++K   I   LDE+KDG I++  + ++++++  E++ +++  +  ++
Sbjct:  165 SLGQRVIDEIKHYYHGFRLLWIDTTIAGRMLWRVLNGNALSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTVEEIALRNK-ADKGTVT-EEFSTFFQKIRDSGERPSNEQIIRFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLNVNELQAACRVRGMRALGVTEERLKEQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIVAKEAQVKVAELDFSKVDNKTKLETMLQEEAAILQENR-EKEMERLADAAEKAKEQQEAEAALSSVDVAIHSETLRDTAPVLEGIKGEEITKEEIDMLSDACTKLKEQKKLLTKEKEELEELKDDVLEYSEDLEEIKKELSKTGQEKQVEESKASKHLSRRVNRMIGRMDKIINEL--EKDKLVLDGQMGSATTPPVGENLISINELITVMRHIQSIP--EQKLLSIAEALDENKDGKIDIDDVMKVVELIDKEDIDINTTQVAEIM 718          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Cavefish
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:103046373])

HSP 1 Score: 369.777 bits (948), Expect = 2.338e-115
Identity = 214/572 (37.41%), Postives = 351/572 (61.36%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADEKESQRI------VKETLIDTAAI----VAVEKDKPLDVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQ----------------EEELDELKEQAAEL--HDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQT------------SETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            ++ Q++ +E  HYYHGFRL +++  I G +L+R+ +G  L+RRER+Q +RT AD+ RL PF+VFI VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLEMAKFLQDT+EE    NK + + +VT E F+ F +++R+SG+  + + I++FS+LFEDE+TL++L   QL ALC+LLE+QS+G   FL F L +K+  ++ DD++IA EG+D L   ELQ  CR RGMRA+GV+EERL+ QL QWL+L + + +P SLLLLSR M+LPD LSP  QL   + +LPE+V+KEA ++    D +K DNKTK E M +E+  I +E   EKE +R+       KE     AA+    VA+  +   D       I  E I+  +++ + +A   +                         E+L+E+K++ ++     QVE  K S  L++++N MI  MD +++ L  +++ ++ D ++G              S+   E +++I++L+  ++ ++S    ++K   I   LDE+KDG I++  + ++++++  E++ +++  +  ++
Sbjct:  165 SLGQRVIDEIKHYYHGFRLLWIDTTIAGRMLWRVLNGNALSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTVEEIALRNK-ADKGTVT-EEFSTFFQKIRDSGERPSNEQIIRFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVDSLNVNELQAACRVRGMRALGVTEERLKEQLKQWLELHLNQHIPTSLLLLSRAMFLPDTLSPADQLKTTLQNLPEIVAKEAQVKVAELDFSKVDNKTKLETMLQEEAAILQENR-EKEMERLADAAEKAKEQQEAEAALSSVDVAIHSETLRDTAPVLEGIKGEEITKEEIDMLSDACTKLKEQKKLLTKEKEELEELKDDVLEYSEDLEEIKKELSKTGQEKQVEESKASKHLSRRVNRMIGRMDKIINEL--EKDKLVLDGQMGSATTPPVGLFFEKRSDLQRENLISINELITVMRHIQSIP--EQKLLSIAEALDENKDGKIDIDDVMKVVELIDKEDIDINTTQVAEIM 729          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Cavefish
Match: letm2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:NCBI gene;Acc:103024686])

HSP 1 Score: 230.335 bits (586), Expect = 2.050e-66
Identity = 142/286 (49.65%), Postives = 202/286 (70.63%), Query Frame = 2
Query:  473 EDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLES--FNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPD 1324
            + KAV + ++ Q++ +E  HYYHGFRL  ++  I G +++RL  G+ LTRRER++L+RT ADL RL PF+VFI VPF+E LLP++++ FP M+PSTF+  SK  EK ++ L  KLE+AKFLQ+T+ E    NK    A+V  E+  F+ +++QVR +G+   T DI+KFS+LFEDE+TLE L+  QL ALCKLLE+Q +G    L F L +++  +K DD MI++EG+  +   ELQ   R RGMR++G++ ++LR QL QWL L +++ VP SLLLLSR MYL D
Sbjct:  105 QSKAVARKSLGQRVLDELKHYYHGFRLLGIDTKIAGRMVWRLLHGQQLTRRERRRLMRTCADLFRLVPFMVFIIVPFMEFLLPVFLKLFPEMLPSTFETESKKEEKQKKGLAAKLELAKFLQETIAEMARRNK----AAVGDETQQFSTYVQQVRHTGEQPTTKDIVKFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMQLRTIKTDDEMISKEGVAAMTVAELQAASRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYLTD 386          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000480.1 (pep scaffold:Pmarinus_7.0:GL485460:9771:10305:1 gene:ENSPMAG00000000433.1 transcript:ENSPMAT00000000480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 1.284e-25
Identity = 46/90 (51.11%), Postives = 65/90 (72.22%), Query Frame = 2
Query:  509 KIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSK 778
            ++  E  HYYHGFRL  ++  +   I++++  G  L RRER+QL+RT ADL RL PF+VFI VPF+E LLP++++ FP M+PSTF+  SK
Sbjct:   22 RVVAELRHYYHGFRLLGIDTRVAARIVWQILHGSQLNRRERRQLLRTCADLFRLLPFLVFIIVPFMEFLLPVFLKLFPNMLPSTFETLSK 111          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Yeast
Match: MDM38 (Mitochondrial protein; forms a complex with Mba1p to facilitate recruitment of mRNA-specific translational activators to ribosomes; roles in protein export and K+/H+ exchange; human ortholog Letm1 implicated in Wolf-Hirschhorn syndrome [Source:SGD;Acc:S000005387])

HSP 1 Score: 174.096 bits (440), Expect = 1.621e-46
Identity = 97/302 (32.12%), Postives = 169/302 (55.96%), Query Frame = 2
Query:  482 AVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQ----TANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPE 1375
            A  K T++ K+K+   HY +G +L   E+ ++  +L + + G  L+RRER QL RT+ D+ RL PF  F+ +PF EL LP  ++ FP ++PST++       K  +L++ + + ++FL +TLEE+  I   + E +   + F  F +++  + +    T   D+I   +++F+++  L++L   QL A+ K + ++  G    L + +R K+  +  DD+ I  EG++ L   EL Q C  RGM+A GVS+E L   L  WL+L + +++P  L++LS T        P++  +KA   L E
Sbjct:   77 AKPKETLMVKVKHALKHYANGTKLLGYEIKVSTKLLIKFAQGYELSRRERNQLRRTMGDVFRLIPFSAFLIIPFAELFLPFALKLFPNLLPSTYESGKDKQAKRNKLIEIRKKTSEFLHETLEESNLITYNTIENAEKKQKFLNFFRKLYSAKEGKIMTFQHDEISAIAQMFKNDSVLDNLSRPQLAAMSKFMSLRPFGNDNMLRYQIRSKLKDIMNDDKTIDYEGVESLSQEELYQACVSRGMKAYGVSKEDLVDNLKVWLELRLRQKIPSVLMVLSSTFTFGGL--PKENYSKAFSPLAE 376          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Yeast
Match: YLH47 (Mitochondrial inner membrane protein; exposed to the mitochondrial matrix; associates with mitochondrial ribosomes; NOT required for respiratory growth; homolog of human Letm1, a protein implicated in Wolf-Hirschhorn syndrome [Source:SGD;Acc:S000006329])

HSP 1 Score: 160.999 bits (406), Expect = 5.964e-43
Identity = 109/375 (29.07%), Postives = 184/375 (49.07%), Query Frame = 2
Query:  305 PFSDIPPIDPNKMNQVLSESISNSQKLRDLNIEINETXXXXXXXXXXXXXXVIVLEEDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKA----ILHLPEVVSKEASLRSVRTD 1417
            P   I PI P  M   L    S + K    N  + E+S         N +    +   K  +K+    K++    HY+ G +L  LE+ I+  +L + ++G  LTRRE  QL RT  D+VRL PF  F+ +PF ELLLP  ++ FP ++PST++ S K   K   L   +  M++ +++     +  N    + ++    FN F   VR +G   +   +++ +RLF D+  L+++    L AL K + +Q  G    L + +R K+  LK DD  I  E  ++L   EL+  C  RG+R+V V    L   L  WL + ++ ++P +LL+++ T Y    +  ++ L  A    ++ +P+ +  E  +  V+ D
Sbjct:   16 PAPGITPISPRIMVSRLRVIPSFNLKFNRWNSSVPESSKKELKTTDGNQESASKVSPVKEKEKVPFKVKMQKALRHYWDGSKLLGLEIKISSKLLMKSAAGYPLTRRENLQLKRTTQDIVRLVPFAAFLIIPFAELLLPFALKLFPNLLPSTYESSKKRENKLENLRNTRKLMSEIIKNNKSHFKPNNISEEQKAL----FNRFYTHVRATGVPESRQQLIEVARLFTDDTVLDNVTRPYLIALAKYMNLQPFGTDVMLRYRIRYKMLELKKDDLSIYYEDAEQLSLSELKTACASRGIRSVDVEPSVLYSNLRLWLNMRLKDKIPSTLLIMA-TAYNYGNVQSKESLYDALCDVLIGIPDELYHEVKVNVVKED 385          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO43248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZB3])

HSP 1 Score: 294.278 bits (752), Expect = 1.145e-89
Identity = 149/337 (44.21%), Postives = 225/337 (66.77%), Query Frame = 2
Query:  485 VKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLS-----QWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDNKF-DNKTKWELMSEEQKLIA 1477
             +K ++ +K+K+E VHYY+GF+L Y E  I+  +L+++ +G++LTRRER+Q +RTVAD+ RL PF+VF+ +PF+E LLP+ ++ FP M+PSTF+  SK  E  R+ LK K+E+AKFLQDT+EE     K        + SF  F  ++R  G+  + +DILKFS+LFEDE+TL+++   QLKA+  LL + S G   +L F L++K+  L+ DD MI +EG+D L   ELQ  C+ RGMRA+GV E RLRF L+     QWL+L ++++VPISLLL+SR +YLP+ +S   +L + +  LP  +  E  ++      +  DNK + E++  E++ IA
Sbjct:    3 AEKKSLWEKVKHEAVHYYNGFKLLYFETRISLRLLWQVMNGKSLTRRERRQFLRTVADMFRLVPFLVFLVIPFMEFLLPVAVKLFPNMLPSTFEDKSKKEEARRKELKGKIELAKFLQDTVEEMAVTAKQKKNQGAVV-SFANFFDKIRTRGEQPSNEDILKFSKLFEDEITLDNMSRGQLKAINGLLLLPSYGTNNYLRFQLQMKLRQLRTDDLMIKKEGVDSLNVQELQSACQARGMRAIGVPEARLRFFLTLVFILQWLELHLDEEVPISLLLMSRALYLPETVSNVDKLKETLSKLPNNLVGETEVKLAELSGELVDNKLRLEILRLEEQKIA 338          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Nematostella
Match: EDO28252 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T702])

HSP 1 Score: 142.51 bits (358), Expect = 3.305e-39
Identity = 72/150 (48.00%), Postives = 104/150 (69.33%), Query Frame = 2
Query:  938 GQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLS-----QWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLP 1372
            G+  + +DILKFS+LFEDE+TL+++   QLKA+  LL + S G   +L F L++K+  L+ DD MI +EG+D L   ELQ  C+ RGMRA+GV E RLRF L+     QWL+L ++++VPISLLL+SR +YLP+ +S   +L + +  LP
Sbjct:    1 GEQPSNEDILKFSKLFEDEITLDNMSRGQLKAINGLLLLPSYGTNNYLRFQLQMKLRQLRTDDLMIKKEGVDSLNVQELQSACQARGMRAIGVPEARLRFFLTLVFILQWLELHLDEEVPISLLLMSRALYLPETVSNVDKLKETLSKLP 150          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Medaka
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:101165019])

HSP 1 Score: 365.54 bits (937), Expect = 1.567e-113
Identity = 221/592 (37.33%), Postives = 357/592 (60.30%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTD-NKFDNKTKWELMSEEQKLIAKEQADEKESQRIV-------------------------------------KETLIDTAAIVAVEKDKPL---DVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQ--VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKV--GQTSE----------------TAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            TI Q++ +E  HYYHGF+L +++  I G +L+R+ +G  L+RRER+Q +RT AD+ RL PF+VFI VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLEMAKFLQDT+EE    NK +++ +VT E F+ F +++R+SG+  + + I+KFS+LFEDE+TL++L   QL ALC+LLE+QS+G   FL F L +K+  ++ DD++IA EG+  L   E+Q  CR RGMRA+GV+EERLR QL QWL+L + +Q+P SLLLLSR MYLPD LSP  QL   +  LPE+V+KEA L+    + +K DNKTK E M +E+  I ++  D +E +R+                                       ETL DTA +V   KD+ +   ++D    A S+       L   +  +E + ++   + E+ L+E+K++ ++   +  +E  K S RL+K++  MI  +D ++  L+   + +I D +V  G T                  T  E +++I++L+N ++Q+++    +EK  RI   LD++KDG +++  + ++++++  E++ +S+  +  ++
Sbjct:  162 TIRQRVVDEIWHYYHGFKLLWIDTTIAGRMLWRILNGHPLSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNK-AAKGNVT-EEFSTFFQKIRDSGERPSNEQIIKFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVKSLNVNEVQAACRVRGMRALGVTEERLREQLGQWLELHLNQQIPTSLLLLSRAMYLPDTLSPADQLKTTLQTLPEMVTKEAQLKVAEMELSKVDNKTKLETMLQEEAAIRQDTKD-REMERLADAAEKAAKEEGELELAASRARYSEAETASLKANGASHSETLRDTAPVVDGLKDEEITKEEIDLLSDACSKLKEQKRLLTLEKEELEDLKDDVQEYNED-LEEIKKEFSKSGQEKAIEESKASKRLSKRVTRMIGRIDKIITELE--NDKVILDGQVDSGATPPVGLFLTKYSDATSLFYTFRENLISITELINVMRQIQNIP--EEKLLRIAEALDDNKDGKVDIDDVIKVVELIDKEDIDVSTSQVADIM 745          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Medaka
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:101165019])

HSP 1 Score: 338.576 bits (867), Expect = 1.993e-103
Identity = 215/587 (36.63%), Postives = 346/587 (58.94%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSP-----------------EQQLTKAILHLPEVVSK---------EASLRSVRTDNKFDN-----------KTKWELMSEEQKLIAKEQADEKESQRIVKETLIDTAAIVAVEKDKPL----DVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAW----QE--EELDELKEQAAELHDQ--VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKV--GQTSE-----TAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            TI Q++ +E  HYYHGF+L +++  I G +L+R+ +G  L+RRER+Q +RT AD+ RL PF+VFI VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLEMAKFLQDT+EE    NK +++ +VT E F+ F +++R+SG+  + + I+KFS+LFEDE+TL++L   QL ALC+LLE+QS+G   FL F L +K+  ++ DD++IA EG+  L   E+Q  CR RGMRA+GV+EERLR QL QWL+L + +Q+P SLLLLSR MYLPD LSP                 E QL  A + L +V +K         EA++R    D + +            + + EL +   +    E A  K +     ETL DTA +V   K +      D +  +  I   S + S L + +  +              QE  E+L+E+K++ ++   +  +E  K S RL+K++  MI  +D ++  L+   + +I D +V  G T       T  E +++I++L+N ++Q+++    +EK  RI   LD++KDG +++  + ++++++  E++ +S+  +  ++
Sbjct:  162 TIRQRVVDEIWHYYHGFKLLWIDTTIAGRMLWRILNGHPLSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNK-AAKGNVT-EEFSTFFQKIRDSGERPSNEQIIKFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVKSLNVNEVQAACRVRGMRALGVTEERLREQLGQWLELHLNQQIPTSLLLLSRAMYLPDTLSPADQLKTTLQTLPEMVTKEAQLKVAEMELSKVDNKTKLETMLQEEAAIRQDTKDREMERLADAAEKAAKEEGELELAASRARYSEAETASLKANGASHSETLRDTAPVVDGLKLQTYLRFQDEEITKEEIDLLSDACSKLKEQKRLLTLEKEELEDLKDDVQEYNEDLEEIKKEFSKSGQEKAIEESKASKRLSKRVTRMIGRIDKIITELE--NDKVILDGQVDSGATPPVGLFYTFRENLISITELINVMRQIQNIP--EEKLLRIAEALDDNKDGKVDIDDVIKVVELIDKEDIDVSTSQVADIM 742          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Medaka
Match: letm1 (leucine zipper and EF-hand containing transmembrane protein 1 [Source:NCBI gene;Acc:101165019])

HSP 1 Score: 334.724 bits (857), Expect = 6.500e-102
Identity = 215/598 (35.95%), Postives = 346/598 (57.86%), Query Frame = 2
Query:  497 TIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSP-----------------EQQLTKAILHLPEVVSK---------EASLRSVRTDNKFDN-----------KTKWELMSEEQKLIAKEQADEKESQRIVKETLIDTAAIVAVEKDKPL----DVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAW----QE--EELDELKEQAAELHDQ--VETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKV--GQTSE----------------TAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLI 2089
            TI Q++ +E  HYYHGF+L +++  I G +L+R+ +G  L+RRER+Q +RT AD+ RL PF+VFI VPF+E LLP+ ++ FP M+PSTF+  SK  E+ ++ L+ KLEMAKFLQDT+EE    NK +++ +VT E F+ F +++R+SG+  + + I+KFS+LFEDE+TL++L   QL ALC+LLE+QS+G   FL F L +K+  ++ DD++IA EG+  L   E+Q  CR RGMRA+GV+EERLR QL QWL+L + +Q+P SLLLLSR MYLPD LSP                 E QL  A + L +V +K         EA++R    D + +            + + EL +   +    E A  K +     ETL DTA +V   K +      D +  +  I   S + S L + +  +              QE  E+L+E+K++ ++   +  +E  K S RL+K++  MI  +D ++  L+   + +I D +V  G T                  T  E +++I++L+N ++Q+++    +EK  RI   LD++KDG +++  + ++++++  E++ +S+  +  ++
Sbjct:  162 TIRQRVVDEIWHYYHGFKLLWIDTTIAGRMLWRILNGHPLSRRERRQFLRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETQSKKEERLKKELRVKLEMAKFLQDTIEEIALRNK-AAKGNVT-EEFSTFFQKIRDSGERPSNEQIIKFSKLFEDELTLDNLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRAIRADDKLIAEEGVKSLNVNEVQAACRVRGMRALGVTEERLREQLGQWLELHLNQQIPTSLLLLSRAMYLPDTLSPADQLKTTLQTLPEMVTKEAQLKVAEMELSKVDNKTKLETMLQEEAAIRQDTKDREMERLADAAEKAAKEEGELELAASRARYSEAETASLKANGASHSETLRDTAPVVDGLKLQTYLRFQDEEITKEEIDLLSDACSKLKEQKRLLTLEKEELEDLKDDVQEYNEDLEEIKKEFSKSGQEKAIEESKASKRLSKRVTRMIGRIDKIITELE--NDKVILDGQVDSGATPPVGLFLTKYSDATSLFYTFRENLISITELINVMRQIQNIP--EEKLLRIAEALDDNKDGKVDIDDVIKVVELIDKEDIDVSTSQVADIM 753          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Medaka
Match: letm2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:NCBI gene;Acc:101174432])

HSP 1 Score: 234.958 bits (598), Expect = 8.413e-68
Identity = 148/325 (45.54%), Postives = 217/325 (66.77%), Query Frame = 2
Query:  473 EDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHL-----PEVVSKEASLRSVRTDNKFDN 1432
            ++KAV K ++ Q++ +E  HYY+GFRL  +++ I G +++RL  G+ LTRRER++L+RT ADL RL PF+VFI VPF+E LLP++++ FP M+PSTF+  SK  EK ++ L  KLE+AKFLQ+T+ E    N+  ++     + F+ ++++VR +G+   T DI++FS+LFEDE+TLE L+  QL ALCKLLE+Q +G    L F L +K+  ++ DD MI+ EG+  L   ELQ  CR RGMR++G++ ++LR QL QWL L +++ VP SLLLLSR MYL D L P+  +   +  L     P + + EAS  S   D   D 
Sbjct:  136 QEKAVVKKSLYQRVVDELKHYYNGFRLLGIDIKIAGRMVWRLLHGQLLTRRERRRLLRTCADLFRLVPFIVFIIVPFMEFLLPVFLKLFPEMLPSTFETESKKEEKQKKGLAAKLELAKFLQETISEMALRNRAKAQTEDETQRFSKYVQEVRGTGEQPTTKDIVRFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMKLRGIRSDDEMISAEGVAALSVSELQAACRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYLTD-LKPKAPVIPPVPKLEKAAAPALENTEASSASGGPDRLTDT 459          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Medaka
Match: letm2 (leucine zipper and EF-hand containing transmembrane protein 2 [Source:NCBI gene;Acc:101174432])

HSP 1 Score: 234.187 bits (596), Expect = 1.130e-67
Identity = 148/325 (45.54%), Postives = 217/325 (66.77%), Query Frame = 2
Query:  473 EDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHL-----PEVVSKEASLRSVRTDNKFDN 1432
            ++KAV K ++ Q++ +E  HYY+GFRL  +++ I G +++RL  G+ LTRRER++L+RT ADL RL PF+VFI VPF+E LLP++++ FP M+PSTF+  SK  EK ++ L  KLE+AKFLQ+T+ E    N+  ++     + F+ ++++VR +G+   T DI++FS+LFEDE+TLE L+  QL ALCKLLE+Q +G    L F L +K+  ++ DD MI+ EG+  L   ELQ  CR RGMR++G++ ++LR QL QWL L +++ VP SLLLLSR MYL D L P+  +   +  L     P + + EAS  S   D   D 
Sbjct:  136 QEKAVVKKSLYQRVVDELKHYYNGFRLLGIDIKIAGRMVWRLLHGQLLTRRERRRLLRTCADLFRLVPFIVFIIVPFMEFLLPVFLKLFPEMLPSTFETESKKEEKQKKGLAAKLELAKFLQETISEMALRNRAKAQTEDETQRFSKYVQEVRGTGEQPTTKDIVRFSKLFEDELTLEHLERPQLVALCKLLELQPIGTNNLLRFQLMMKLRGIRSDDEMISAEGVAALSVSELQAACRSRGMRSLGLTTDQLRQQLQQWLDLHLKENVPPSLLLLSRAMYLTD-LKPKAPVIPPVPKLEKAAAPALENTEASSASGGPDRLTDT 459          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000055346.1 (SMESG000055346.1)

HSP 1 Score: 1305.04 bits (3376), Expect = 0.000e+0
Identity = 692/698 (99.14%), Postives = 693/698 (99.28%), Query Frame = 2
Query:   65 MALRNVSLYLKKPVTSSYLTGFSNRTCSAKLFLNGNSLDLMTKPFQQNRMYHVSSKQYFKLSRYLLLNNPSEKPNIIRDKPFSDIPPIDPNKMNQVLSESISNSQKLRDLNIEINETXXXXXXXXXXXXXXVIVLEEDKAVKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDNKFDNKTKWELMSEEQKLIAKEQADEKESQRIVKETLIDTAAIVAVEKDKPLDVDSKRSAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLIDAIDXXXXXXXXXXXXXXSSTLK 2158
            MALRNVSLYLKKPVTSSYLTGFSNRTCSAKLFLNGNSLDLMTKPFQQNRMYHVSSKQYFKLSRYLLLNNPSEKPNIIRDK FSDIPPIDPNKMNQVLSESISNSQKLRDLNIEINETSDNNSLNKSNNLKD    EEDKA+KKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDNKFDNKTKWELMSEEQKLIAKEQADEKESQRIVKETLIDTAAIVAVEKDKPLDVDSKRSAISEESISTSDLNQIENAIESISNNNTAWQEEELDELKEQAAELHDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLIDAIDKEEEFEKEKIKIKESSTLK
Sbjct:    1 MALRNVSLYLKKPVTSSYLTGFSNRTCSAKLFLNGNSLDLMTKPFQQNRMYHVSSKQYFKLSRYLLLNNPSEKPNIIRDKSFSDIPPIDPNKMNQVLSESISNSQKLRDLNIEINETSDNNSLNKSNNLKD----EEDKAIKKLTIVQKIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDNKFDNKTKWELMSEEQKLIAKEQADEKESQRIVKETLIDTAAIVAVEKDKPLDVDSKRSAISEESISTSDLNQIENAIESISNNNTAWQEEELDELKEQAAELHDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQTSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLIDAIDKEEEFEKEKIKIKESSTLK 694          
BLAST of Mitochondrial proton/calcium exchanger protein vs. Planmine SMEST
Match: SMESG000064220.1 (SMESG000064220.1)

HSP 1 Score: 468.389 bits (1204), Expect = 1.046e-153
Identity = 269/589 (45.67%), Postives = 387/589 (65.70%), Query Frame = 2
Query:  509 KIKNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLVRLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCKLEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDILKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHMLKIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLSIEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRTDNKFDNKTKWELMSEEQKLIAKEQADEKESQ--------RIVKET-----LI--------DTAAI-----VAVEKDK----PLDVDSKR-SAISEESISTSDLXXXXXXXXXXXXXXTAWQEEELDELKEQAAELHDQVET-----------KKGSNRLNKKLNNMIEEMDSLLDRLKVK----------QENIIHDIKVGQTSETA------EERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELHHMTEILDMLGSEEVKLSSKDMGRLIDAID 2101
            ++K+E VHYYHGF+LF+ ++G+  GIL RL+ G TLTRRERKQLVRT AD+ R+ PF+VFI VPF+E LLP Y++FFPFM+PSTF+  SKD E   Q LK KLE+AKFLQ+ + E+ +  K      V L +F+ FMKQ RESG T +T DIL+FS LFEDEVTLESL+ + LKALCKLL+I ++GP A L F L +KV  LK+DD+MIA EGIDK+P +ELQQ+ RERGMR+ GV+E RLR+QLSQWL LS+EK+VP +LLLLSR MYLP+ L+PE+QL +AIL LP+ VS  A L++  T+ + D KTK E++ EEQK+I +E+   K S+         ++KE+     +I        DTA I     V  E DK      D + K    ++E+ I   DL QIE+AI ++    T + +EE+  LKE   E+   + T           +K    L+ KL+ MI+E++  ++ ++V+          ++ +I ++   ++ +++      +ER + ++D++ ++K L+  +GD EKW  IL++LDEDKDG IE+ H+ +++ +L S EVKL S ++ +L++ ID
Sbjct:  108 RVKDELVHYYHGFKLFFFDLGVACGILKRLTKGHTLTRRERKQLVRTSADMARMVPFLVFIIVPFMEFLLPFYLKFFPFMLPSTFKTESKDKEFILQKLKGKLEIAKFLQEAIAES-ATKKTIKGDGVDLTTFSDFMKQARESGLTVDTQDILRFSHLFEDEVTLESLNPKYLKALCKLLDINTIGPPALLRFQLEMKVRQLKVDDQMIANEGIDKIPVWELQQLSRERGMRSYGVNENRLRYQLSQWLSLSLEKKVPTTLLLLSRVMYLPETLTPEEQLKQAILVLPKTVSNTAKLKA-GTEERVDPKTKLEVIKEEQKVIHEEREASKASKEAEIVLADEVLKESEDKAPIIELKSVESPDTAPISEILTVVKESDKVEIQKQDKEPKPIPVVTEQVIGAQDLAQIESAIANLEEAKTLFHKEEIGVLKESRKEISKILSTSDETAPVKQPEEKSVKNLSSKLDEMIDEIEKTVEHIEVEAKKADPSEEDKKPVIEEVMAVKSIDSSPSPVIKKERYIKVNDVLESIKSLEK-TGDHEKWVTILSLLDEDKDGKIEMDHLVKMIKLLNSIEVKLPSSEIAKLLEVID 693          
The following BLAST results are available for this feature:
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LETM11.187e-10336.87leucine zipper and EF-hand containing transmembran... [more]
LETM22.486e-6647.81leucine zipper and EF-hand containing transmembran... [more]
LETM21.742e-6547.81leucine zipper and EF-hand containing transmembran... [more]
LETM29.790e-4448.07leucine zipper and EF-hand containing transmembran... [more]
LETM21.195e-4148.57leucine zipper and EF-hand containing transmembran... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
letm-11.828e-9737.11LETM1 (Leucine zipper, EF-hand, TransMembrane mito... [more]
letm-12.463e-9737.11LETM1 (Leucine zipper, EF-hand, TransMembrane mito... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Letm11.323e-9939.25gene:FBgn0284252 transcript:FBtr0072349[more]
Letm11.323e-9939.25gene:FBgn0284252 transcript:FBtr0072348[more]
Letm11.323e-9939.25gene:FBgn0284252 transcript:FBtr0072347[more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
letm15.127e-11838.19leucine zipper-EF-hand containing transmembrane pr... [more]
letm19.289e-11738.23leucine zipper-EF-hand containing transmembrane pr... [more]
letm15.842e-11637.41leucine zipper-EF-hand containing transmembrane pr... [more]
letm27.692e-6650.00leucine zipper-EF-hand containing transmembrane pr... [more]
letm21.782e-3849.72leucine zipper-EF-hand containing transmembrane pr... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anapc11.160e-10937.96anaphase promoting complex subunit 1 [Source:Xenba... [more]
anapc11.245e-10837.89anaphase promoting complex subunit 1 [Source:Xenba... [more]
anapc13.295e-10736.96anaphase promoting complex subunit 1 [Source:Xenba... [more]
anapc12.757e-10536.87anaphase promoting complex subunit 1 [Source:Xenba... [more]
anapc11.289e-10436.83anaphase promoting complex subunit 1 [Source:Xenba... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Letm13.045e-10537.04leucine zipper-EF-hand containing transmembrane pr... [more]
Letm24.747e-6645.13leucine zipper-EF-hand containing transmembrane pr... [more]
Letm26.939e-2345.95leucine zipper-EF-hand containing transmembrane pr... [more]
Letm27.092e-1846.67leucine zipper-EF-hand containing transmembrane pr... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZK33|LETM1_CHICK9.953e-12239.52Mitochondrial proton/calcium exchanger protein OS=... [more]
sp|Q1LY46|LETM1_DANRE3.870e-11738.19Mitochondrial proton/calcium exchanger protein OS=... [more]
sp|Q0VCA3|LETM1_BOVIN5.112e-11136.16Mitochondrial proton/calcium exchanger protein OS=... [more]
sp|Q0VA06|LETM1_XENTR9.862e-10537.14Mitochondrial proton/calcium exchanger protein OS=... [more]
sp|Q5XIN6|LETM1_RAT1.682e-10436.93Mitochondrial proton/calcium exchanger protein OS=... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RHR08.825e-13338.88Leucine zipper-EF-hand-containing transmembrane pr... [more]
A0A1S8WT473.085e-12840.00LETM1-like protein (Fragment) OS=Opisthorchis vive... [more]
A0A1I7Q4234.245e-11939.52Mitochondrial proton/calcium exchanger protein OS=... [more]
A0A091U2414.855e-11938.11Uncharacterized protein (Fragment) OS=Phoenicopter... [more]
A0A091PWY71.282e-11837.94Uncharacterized protein (Fragment) OS=Leptosomus d... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
letm12.780e-11738.15leucine zipper and EF-hand containing transmembran... [more]
letm12.338e-11537.41leucine zipper and EF-hand containing transmembran... [more]
letm22.050e-6649.65leucine zipper and EF-hand containing transmembran... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000480.11.284e-2551.11pep scaffold:Pmarinus_7.0:GL485460:9771:10305:1 ge... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MDM381.621e-4632.12Mitochondrial protein; forms a complex with Mba1p ... [more]
YLH475.964e-4329.07Mitochondrial inner membrane protein; exposed to t... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO432481.145e-8944.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282523.305e-3948.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
letm11.567e-11337.33leucine zipper and EF-hand containing transmembran... [more]
letm11.993e-10336.63leucine zipper and EF-hand containing transmembran... [more]
letm16.500e-10235.95leucine zipper and EF-hand containing transmembran... [more]
letm28.413e-6845.54leucine zipper and EF-hand containing transmembran... [more]
letm21.130e-6745.54leucine zipper and EF-hand containing transmembran... [more]
back to top
BLAST of Mitochondrial proton/calcium exchanger protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000055346.10.000e+099.14SMESG000055346.1[more]
SMESG000064220.11.046e-15345.67SMESG000064220.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000130 ID=SMED30000130|Name=Mitochondrial proton/calcium exchanger protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2599bp
AAATCTATATAAATCTTATATGCGCATACTGTGGAAGTAAGTTTTAGAAA
TTACTTTTTAAATCATGGCTCTCCGAAATGTATCATTATATTTGAAAAAA
CCTGTTACTTCATCCTACCTAACTGGTTTTTCAAATCGTACTTGTAGTGC
TAAATTATTTCTGAATGGAAATAGTTTGGATTTAATGACAAAACCATTTC
AACAAAACCGTATGTATCATGTTTCAAGCAAGCAATATTTTAAATTGTCA
AGATATTTATTATTGAACAATCCTTCTGAGAAACCTAATATTATCAGGGA
TAAGCCATTTTCTGACATACCTCCTATCGATCCAAATAAAATGAATCAGG
TTTTATCAGAATCTATTTCAAATTCTCAAAAATTAAGAGATTTAAATATT
GAAATAAATGAAACAAGTGACAATAATTCATTGAATAAATCAAACAATCT
CAAAGATGTAATTGTTTTGGAAGAAGATAAAGCTGTTAAAAAACTGACAA
TTGTTCAAAAAATCAAGAATGAATGCGTTCATTATTATCATGGATTTCGA
TTATTTTATTTAGAGGTAGGTATTACAGGCGGAATTCTTTATCGACTCAG
TTCAGGGCGTACATTAACAAGAAGAGAAAGAAAACAACTTGTTCGCACTG
TGGCTGATCTCGTTAGATTGGCTCCTTTTGTTGTCTTTATCGCGGTGCCG
TTTTTGGAACTTTTATTACCCCTTTATATTAGATTTTTCCCGTTTATGAT
GCCAAGCACATTCCAACACAGTTCAAAAGATACTGAGAAAACTCGACAAC
TATTGAAATGCAAATTAGAAATGGCAAAATTTCTACAAGATACACTGGAA
GAAACGAGAAGCATTAATAAATATAGTTCAGAAGCCAGTGTTACTCTTGA
GTCGTTCAATCTGTTCATGAAACAGGTCCGTGAAAGTGGCCAGACAGCGA
ATACGGATGATATCTTGAAATTCTCTAGGTTATTTGAAGACGAAGTCACA
TTAGAAAGTCTGGATCATAGGCAATTGAAAGCGCTGTGTAAGCTACTGGA
AATACAGTCTGTTGGACCGAAAGCCTTTCTCAGTTTTCATTTGAGAATTA
AAGTTCACATGTTGAAGATTGATGATCGGATGATTGCCAGAGAGGGAATT
GATAAACTTCCAGCATTTGAGCTTCAGCAAATATGCCGAGAAAGGGGTAT
GCGCGCGGTGGGAGTTAGTGAAGAAAGATTGCGTTTTCAATTATCACAAT
GGCTAAAATTATCTATTGAAAAGCAGGTGCCCATTTCCTTGTTGTTGTTA
TCCAGAACGATGTATTTACCTGATCAATTATCACCTGAACAACAGCTTAC
AAAAGCGATATTGCATTTGCCAGAAGTTGTTTCTAAAGAAGCCAGTTTGC
GATCAGTTCGTACCGATAACAAATTCGACAACAAAACAAAATGGGAACTT
ATGAGTGAAGAACAAAAGCTTATTGCTAAAGAACAAGCAGATGAAAAAGA
ATCGCAAAGAATCGTTAAAGAAACTTTAATAGATACTGCTGCTATTGTAG
CAGTTGAGAAAGATAAACCGCTTGATGTTGATTCCAAGCGTTCTGCGATT
AGTGAAGAGTCTATATCCACCTCAGATTTGAATCAGATTGAAAATGCAAT
TGAAAGTATTTCAAATAATAATACTGCTTGGCAAGAGGAAGAACTCGATG
AATTGAAGGAGCAAGCAGCTGAGTTACATGATCAAGTTGAGACGAAAAAA
GGTTCCAACAGACTAAACAAAAAATTGAACAATATGATCGAAGAAATGGA
TTCATTATTGGATCGATTAAAAGTTAAACAAGAAAATATAATACACGACA
TAAAAGTCGGTCAAACTTCTGAGACAGCCGAGGAAAGAGTTGTCGCAATT
TCTGATTTAATGAATGCATTGAAACAACTGAAATCAGCATCTGGAGATGA
TGAGAAATGGCAACGAATCTTGACAGTGTTGGATGAGGATAAGGATGGTC
ACATAGAATTACATCATATGACAGAGATATTGGATATGTTAGGCAGCGAA
GAAGTCAAATTGTCGAGTAAAGACATGGGACGTTTAATTGATGCAATTGA
CAAAGAAGAAGAATTTGAAAAAGAAAAAATAAAAATAAAAGAAAGTTCAA
CTTTAAAATGACTTGCCAATAGACAAACATAAAACTCGATGCATTTTCGA
ACAATATAATATTAATAGGAGAATTGTATTGACTCCTATTACTGATTTTC
TATTTTCATGTTTGATGGATTTATCTATGTAGAAATGCCCGTATATCAGT
GGTTTTGATTTATAATCAGCATTTTATCATATAATTCAGTTGTATATTAT
GGTAATATACTTTTTTAATTAGGCTTATTATTTATGTTAATATTTTACGA
CTATTATTTTTTTCAACCTACGGCTGCAGGTAAATTGAATGTTATAATTC
CAACTAATCCTACTCTCATTATGTTATACTAAACTTGTATAATCCAGTCT
CAACCAAATTTAGGTGGGTGCTGCAGTTGTTAGTGACAATTTGCATGAAA
TACTGGTAACTTAACTAATATGAATTTTATGTATAATAAAAAGTGTTAA
back to top

protein sequence of SMED30000130-orf-1

>SMED30000130-orf-1 ID=SMED30000130-orf-1|Name=SMED30000130-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=699bp
MALRNVSLYLKKPVTSSYLTGFSNRTCSAKLFLNGNSLDLMTKPFQQNRM
YHVSSKQYFKLSRYLLLNNPSEKPNIIRDKPFSDIPPIDPNKMNQVLSES
ISNSQKLRDLNIEINETSDNNSLNKSNNLKDVIVLEEDKAVKKLTIVQKI
KNECVHYYHGFRLFYLEVGITGGILYRLSSGRTLTRRERKQLVRTVADLV
RLAPFVVFIAVPFLELLLPLYIRFFPFMMPSTFQHSSKDTEKTRQLLKCK
LEMAKFLQDTLEETRSINKYSSEASVTLESFNLFMKQVRESGQTANTDDI
LKFSRLFEDEVTLESLDHRQLKALCKLLEIQSVGPKAFLSFHLRIKVHML
KIDDRMIAREGIDKLPAFELQQICRERGMRAVGVSEERLRFQLSQWLKLS
IEKQVPISLLLLSRTMYLPDQLSPEQQLTKAILHLPEVVSKEASLRSVRT
DNKFDNKTKWELMSEEQKLIAKEQADEKESQRIVKETLIDTAAIVAVEKD
KPLDVDSKRSAISEESISTSDLNQIENAIESISNNNTAWQEEELDELKEQ
AAELHDQVETKKGSNRLNKKLNNMIEEMDSLLDRLKVKQENIIHDIKVGQ
TSETAEERVVAISDLMNALKQLKSASGDDEKWQRILTVLDEDKDGHIELH
HMTEILDMLGSEEVKLSSKDMGRLIDAIDKEEEFEKEKIKIKESSTLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000026gut
PLANA:0000429neoblast
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0005737cytoplasm
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0006851mitochondrial calcium ion transmembrane transport
GO:0034214protein hexamerization
GO:0051260protein homooligomerization
GO:0051560mitochondrial calcium ion homeostasis
GO:0099093mitochondrial calcium release
GO:0006516glycoprotein catabolic process
Vocabulary: molecular function
TermDefinition
GO:0015297antiporter activity
GO:0015369calcium:proton antiporter activity
GO:0046872metal ion binding
GO:0005509calcium ion binding
GO:0043022ribosome binding
Vocabulary: INTERPRO
TermDefinition
IPR011685LETM1
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
IPR033122LETM1_RBD
IPR006588Peptide_N_glycanase_PAW_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 522..591
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 591..695
e-value: 9.1E-6
score: 27.6
NoneNo IPR availablePANTHERPTHR14009LEUCINE ZIPPER-EF-HAND CONTAINING TRANSMEMBRANE PROTEINcoord: 62..693
NoneNo IPR availablePANTHERPTHR14009:SF8MITOCHONDRIAL PROTON/CALCIUM EXCHANGER PROTEINcoord: 62..693
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 158..180
IPR011685LETM1-likePFAMPF07766LETM1coord: 147..413
e-value: 4.6E-91
score: 304.9
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 627..662
score: 10.664
IPR033122Letm1 ribosome-binding domainPROSITEPS51758LETM1_RBDcoord: 245..500
score: 25.192
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 610..680