Centrosomal protein 95

Overview
NameCentrosomal protein 95
Smed IDSMED30000126
Length (bp)2337
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosomal protein 95 (SMED30000126) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosomal protein 95 (SMED30000126) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosomal protein 95 (SMED30000126) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosomal protein 95 (SMED30000126) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000126

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000126SMESG000002923.1 SmedASXL_015215SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30000126SMESG000002923.1 dd_Smed_v4_8515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000126SMESG000002923.1 dd_Smed_v4_8515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000126SMESG000002923.1 dd_Smed_v4_8515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000126SMESG000002923.1 dd_Smed_v4_8515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30000126SMESG000002923.1 dd_Smed_v4_8515_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000126SMESG000002923.1 dd_Smed_v6_8515_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000126SMESG000002923.1 dd_Smed_v4_8515_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30000126SMESG000002923.1 dd_Smed_v4_8515_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosomal protein 95 vs. Ensembl Human
Match: CEP95 (centrosomal protein 95 [Source:HGNC Symbol;Acc:HGNC:25141])

HSP 1 Score: 155.221 bits (391), Expect = 1.714e-38
Identity = 89/242 (36.78%), Postives = 158/242 (65.29%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQ--SHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQV 2242
            +L+ FP L +S  T+  +W Q   Q   +++    ++   K L  + +IE+A RR  LLT L++KE  H  RLQ+ KD  + Q  T S  ++ RQQ  RA++Y +++   + A+MM  + REE +F+ +F+E L IQ+ R+ ++R YAK+ ++EQ   +Q +L+S+E YY+D+F++ A+ + +E QE+  ++KSQ   L K+K+E+RSK+E +I+ LQ+ + ++  +V+FREL+A++  S++
Sbjct:  504 MLEQFPFLYVSGPTLSKMWKQQIAQVEQLKKEACRENRSKKKL--QDEIEEALRRHDLLTTLVKKEYEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSMENYYKDQFSLLAEAISQEHQELKAREKSQAQTLHKVKRELRSKMEKEIQQLQDMITQNDDDVFFRELEAERFRSRL 743          

HSP 2 Score: 60.077 bits (144), Expect = 1.465e-8
Identity = 26/75 (34.67%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHIN 397
            +A N+L    + L++ ++++ ++ +F+  Y+ ILG ++ + I  P +++DD  N+ AVID L+   L+VSLSHI 
Sbjct:   11 IANNLLFKCHIHLRIHELQDCDANVFIALYQSILGEKVPDLIVIPRSQEDDAHNVQAVIDSLALDYLQVSLSHIT 85          
BLAST of Centrosomal protein 95 vs. Ensembl Human
Match: CEP95 (centrosomal protein 95 [Source:HGNC Symbol;Acc:HGNC:25141])

HSP 1 Score: 155.221 bits (391), Expect = 1.879e-38
Identity = 89/242 (36.78%), Postives = 158/242 (65.29%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQ--SHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQV 2242
            +L+ FP L +S  T+  +W Q   Q   +++    ++   K L  + +IE+A RR  LLT L++KE  H  RLQ+ KD  + Q  T S  ++ RQQ  RA++Y +++   + A+MM  + REE +F+ +F+E L IQ+ R+ ++R YAK+ ++EQ   +Q +L+S+E YY+D+F++ A+ + +E QE+  ++KSQ   L K+K+E+RSK+E +I+ LQ+ + ++  +V+FREL+A++  S++
Sbjct:  569 MLEQFPFLYVSGPTLSKMWKQQIAQVEQLKKEACRENRSKKKL--QDEIEEALRRHDLLTTLVKKEYEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSMENYYKDQFSLLAEAISQEHQELKAREKSQAQTLHKVKRELRSKMEKEIQQLQDMITQNDDDVFFRELEAERFRSRL 808          

HSP 2 Score: 82.4185 bits (202), Expect = 1.701e-15
Identity = 41/135 (30.37%), Postives = 80/135 (59.26%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQVENEKQKSRMIEGAENMR 577
            +A N+L    + L++ ++++ ++ +F+  Y+ ILG ++ + I  P +++DD  N+ AVID L+   L+VSLSHI   +++ G + ++ +LLEIF GL E + +   E +  ++  EQ   E  +   +E  E+ +
Sbjct:   11 IANNLLFKCHIHLRIHELQDCDANVFIALYQSILGEKVPDLIVIPRSQEDDAHNVQAVIDSLALDYLQVSLSHITGENIVKGDKESIKNLLEIFDGLLEYLTERISETSHEKSETEQYFKESDRGERLEEPESTK 145          
BLAST of Centrosomal protein 95 vs. Ensembl Human
Match: CEP95 (centrosomal protein 95 [Source:HGNC Symbol;Acc:HGNC:25141])

HSP 1 Score: 73.1738 bits (178), Expect = 1.619e-14
Identity = 36/114 (31.58%), Postives = 71/114 (62.28%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNT 514
            +A N+L    + L++ ++++ ++ +F+  Y+ ILG ++ + I  P +++DD  N+ AVID L+   L+VSLSHI   +++ G + ++ +LLEIF GL E + +   E +  ++ 
Sbjct:   11 IANNLLFKCHIHLRIHELQDCDANVFIALYQSILGEKVPDLIVIPRSQEDDAHNVQAVIDSLALDYLQVSLSHITGENIVKGDKESIKNLLEIFDGLLEYLTERISETSHEKSA 124          
BLAST of Centrosomal protein 95 vs. Ensembl Human
Match: CEP95 (centrosomal protein 95 [Source:HGNC Symbol;Acc:HGNC:25141])

HSP 1 Score: 72.4034 bits (176), Expect = 2.930e-14
Identity = 36/113 (31.86%), Postives = 71/113 (62.83%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRN 511
            +A N+L    + L++ ++++ ++ +F+  Y+ ILG ++ + I  P +++DD  N+ AVID L+   L+VSLSHI   +++ G + ++ +LLEIF GL E + +   E +  ++
Sbjct:   11 IANNLLFKCHIHLRIHELQDCDANVFIALYQSILGEKVPDLIVIPRSQEDDAHNVQAVIDSLALDYLQVSLSHITGENIVKGDKESIKNLLEIFDGLLEYLTERISETSHEKS 123          
BLAST of Centrosomal protein 95 vs. Ensembl Human
Match: CEP95 (centrosomal protein 95 [Source:HGNC Symbol;Acc:HGNC:25141])

HSP 1 Score: 68.9366 bits (167), Expect = 1.372e-13
Identity = 30/75 (40.00%), Postives = 55/75 (73.33%), Query Frame = 2
Query: 1889 VFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVL 2113
            +F+ +F+E L IQ+ R+ ++R YAK+ ++EQ   +Q +L+S+E YY+D+F++ A+ + +E QE+  ++KSQ  VL
Sbjct:    1 IFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSMENYYKDQFSLLAEAISQEHQELKAREKSQAQVL 75          
BLAST of Centrosomal protein 95 vs. Ensembl Xenopus
Match: lin7b (lin-7 homolog B [Source:Xenbase;Acc:XB-GENE-5827098])

HSP 1 Score: 99.7525 bits (247), Expect = 5.425e-21
Identity = 51/136 (37.50%), Postives = 101/136 (74.26%), Query Frame = 2
Query: 1823 YVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQV 2230
            Y E++   +RA++M  + REE++F+ +F+E L++Q++R+ E+R Y ++ + EQ   ++ +L+S+E YY+D+F+M AD + +ERQ+I  Q+++Q   L K+K+E+R K+E +IR LQE ++++  + +FR+L+A+++
Sbjct:  533 YYEDYHVQLRAKLMRARTREERLFKKLFEEGLELQKERLREIRSYTREQRLEQRKRHKDELDSMENYYKDQFSMLADAVTQERQQIQAQEQAQAKTLQKIKRELRGKMEKEIRDLQEMIIRTDEDAFFRDLEAERL 668          

HSP 2 Score: 67.3958 bits (163), Expect = 6.773e-11
Identity = 33/111 (29.73%), Postives = 66/111 (59.46%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSR 505
            +A ++L    + L++ ++   ++++F+  YE ILG ++ + I      + +  N+ +VID L+   L+VSLSHI   +++ G   ++ +LLEIF GL E + ++  E +S+
Sbjct:   10 VANSLLSKCHINLQVQEVSGCDARVFLALYEAILGEKVPDFIPDAQNPETNAHNVQSVIDSLALDYLQVSLSHITGENIVRGDTESIQNLLEIFDGLLEYLTEQISEASSQ 120          
BLAST of Centrosomal protein 95 vs. Ensembl Mouse
Match: Cep95 (centrosomal protein 95 [Source:MGI Symbol;Acc:MGI:2443502])

HSP 1 Score: 156.762 bits (395), Expect = 3.498e-39
Identity = 84/233 (36.05%), Postives = 151/233 (64.81%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDA 2221
            +L+ FP L +S+ T+  +W Q   Q   +++  Q         + +IE+A RR  LLT L++KE  H  RLQ+ +D  + Q  T S  ++ R QS RA++Y +++   +RA+MM  + REE +F+ +F+E L+IQ+ R+ ++R YAK+ +NE+   +Q +L+S+E +Y+D+F++ A+ + +ERQE+ ++ K Q   L K+K+E+R+K+E +I+ LQ  + ++  + +FREL+A
Sbjct:  527 MLEQFPFLYVSDPTLTKMWKQQMAQVEQLKREAQRENRSKKKLQDEIEEALRRHDLLTALVKKEYDHNKRLQDFRDRIQRQRLTQSKIKENRHQSVRARKYYDDYRVQLRAKMMKMRTREEMIFKKLFEEGLQIQKQRLRDLRNYAKEKRNEEKRQHQNELDSMENHYKDQFSLLAEAISQERQELKVRQKFQAQTLHKVKRELRAKMEKEIQQLQHMITQNDDDAFFRELEA 759          

HSP 2 Score: 76.2554 bits (186), Expect = 9.621e-14
Identity = 36/117 (30.77%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQ 523
            +A N+L    + L++ ++++ ++ +F+  Y+ ILG ++ + I  P  ++D+  N+ AVID L+   L+VSLSHI   +++ G   ++ +LLEIF GL + + +   E +  ++  EQ
Sbjct:   11 IANNLLFKCHIHLRIHELQDCDANVFIALYQSILGEKVPDLIVLPRNQEDEAHNVQAVIDSLALDYLQVSLSHITGENIVKGDNESIRNLLEIFDGLLDYLTEHISESSPNKSETEQ 127          
BLAST of Centrosomal protein 95 vs. Ensembl Mouse
Match: Cep95 (centrosomal protein 95 [Source:MGI Symbol;Acc:MGI:2443502])

HSP 1 Score: 156.762 bits (395), Expect = 4.043e-39
Identity = 84/233 (36.05%), Postives = 151/233 (64.81%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDA 2221
            +L+ FP L +S+ T+  +W Q   Q   +++  Q         + +IE+A RR  LLT L++KE  H  RLQ+ +D  + Q  T S  ++ R QS RA++Y +++   +RA+MM  + REE +F+ +F+E L+IQ+ R+ ++R YAK+ +NE+   +Q +L+S+E +Y+D+F++ A+ + +ERQE+ ++ K Q   L K+K+E+R+K+E +I+ LQ  + ++  + +FREL+A
Sbjct:  570 MLEQFPFLYVSDPTLTKMWKQQMAQVEQLKREAQRENRSKKKLQDEIEEALRRHDLLTALVKKEYDHNKRLQDFRDRIQRQRLTQSKIKENRHQSVRARKYYDDYRVQLRAKMMKMRTREEMIFKKLFEEGLQIQKQRLRDLRNYAKEKRNEEKRQHQNELDSMENHYKDQFSLLAEAISQERQELKVRQKFQAQTLHKVKRELRAKMEKEIQQLQHMITQNDDDAFFRELEA 802          

HSP 2 Score: 75.8702 bits (185), Expect = 1.191e-13
Identity = 36/117 (30.77%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQ 523
            +A N+L    + L++ ++++ ++ +F+  Y+ ILG ++ + I  P  ++D+  N+ AVID L+   L+VSLSHI   +++ G   ++ +LLEIF GL + + +   E +  ++  EQ
Sbjct:   11 IANNLLFKCHIHLRIHELQDCDANVFIALYQSILGEKVPDLIVLPRNQEDEAHNVQAVIDSLALDYLQVSLSHITGENIVKGDNESIRNLLEIFDGLLDYLTEHISESSPNKSETEQ 127          
BLAST of Centrosomal protein 95 vs. Ensembl Mouse
Match: Cep95 (centrosomal protein 95 [Source:MGI Symbol;Acc:MGI:2443502])

HSP 1 Score: 77.7962 bits (190), Expect = 1.080e-16
Identity = 36/96 (37.50%), Postives = 70/96 (72.92%), Query Frame = 2
Query: 1934 RINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDA 2221
            R+ ++R YAK+ +NE+   +Q +L+S+E +Y+D+F++ A+ + +ERQE+ ++ K Q   L K+K+E+R+K+E +I+ LQ  + ++  + +FREL+A
Sbjct:    1 RLRDLRNYAKEKRNEEKRQHQNELDSMENHYKDQFSLLAEAISQERQELKVRQKFQAQTLHKVKRELRAKMEKEIQQLQHMITQNDDDAFFRELEA 96          
BLAST of Centrosomal protein 95 vs. UniProt/SwissProt
Match: sp|Q5XI03|CEP95_RAT (Centrosomal protein of 95 kDa OS=Rattus norvegicus OX=10116 GN=Cep95 PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.221e-38
Identity = 86/233 (36.91%), Postives = 148/233 (63.52%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDA 2221
            +L+ FP L +S+ T+  +W Q   Q   +R+  Q         + +IE+A RR  LLT L++KE  H  RLQ+ KD    Q  T S  ++ R QS RA++Y +++   +RA+MM  + REE +F+ +F+E L+IQ+ R+ ++R YAK+ ++E+   +Q +L+S+E YY+D+F++ A+ + + RQE+  + +SQ   L K+K+E+R+K+E +I  LQ  + +S  + +FREL+A
Sbjct:  564 MLEQFPFLYVSDPTLTKMWKQQMAQVEQLRREAQRENRSKKKLQDEIEEALRRHDLLTALVKKEYDHNKRLQDFKDRIHKQRLTQSKIKENRHQSVRARKYYDDYRVQLRAKMMKMRTREEMIFKKLFEEGLQIQKQRLRDLRNYAKEKRSEEKRQHQNELDSMENYYKDQFSLLAEAISQGRQELKARQRSQAQTLHKVKRELRAKMEKEIEQLQHLITQSDDDAFFRELEA 796          

HSP 2 Score: 81.2629 bits (199), Expect = 2.253e-14
Identity = 38/118 (32.20%), Postives = 72/118 (61.02%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQV 526
            +A N+L    + L++  +++ ++ +F+  Y+ ILG ++ + I  P +++D+  N+ AVID L+   L+VSLSHI   +++ G + ++ +LLEIF GL E + +   E +  R+  EQ 
Sbjct:   11 IANNLLFKCHIHLRIHKLQDCDANVFIALYQSILGEKVPDLIVIPRSQEDNAHNVQAVIDSLALDYLQVSLSHITGENIVKGDKGSIKNLLEIFDGLLEYLTEHISESSHNRSASEQF 128          
BLAST of Centrosomal protein 95 vs. UniProt/SwissProt
Match: sp|Q8BVV7|CEP95_MOUSE (Centrosomal protein of 95 kDa OS=Mus musculus OX=10090 GN=Cep95 PE=1 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 2.828e-38
Identity = 84/233 (36.05%), Postives = 151/233 (64.81%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDA 2221
            +L+ FP L +S+ T+  +W Q   Q   +++  Q         + +IE+A RR  LLT L++KE  H  RLQ+ +D  + Q  T S  ++ R QS RA++Y +++   +RA+MM  + REE +F+ +F+E L+IQ+ R+ ++R YAK+ +NE+   +Q +L+S+E +Y+D+F++ A+ + +ERQE+ ++ K Q   L K+K+E+R+K+E +I+ LQ  + ++  + +FREL+A
Sbjct:  570 MLEQFPFLYVSDPTLTKMWKQQMAQVEQLKREAQRENRSKKKLQDEIEEALRRHDLLTALVKKEYDHNKRLQDFRDRIQRQRLTQSKIKENRHQSVRARKYYDDYRVQLRAKMMKMRTREEMIFKKLFEEGLQIQKQRLRDLRNYAKEKRNEEKRQHQNELDSMENHYKDQFSLLAEAISQERQELKVRQKFQAQTLHKVKRELRAKMEKEIQQLQHMITQNDDDAFFRELEA 802          

HSP 2 Score: 75.8702 bits (185), Expect = 8.334e-13
Identity = 36/117 (30.77%), Postives = 71/117 (60.68%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQ 523
            +A N+L    + L++ ++++ ++ +F+  Y+ ILG ++ + I  P  ++D+  N+ AVID L+   L+VSLSHI   +++ G   ++ +LLEIF GL + + +   E +  ++  EQ
Sbjct:   11 IANNLLFKCHIHLRIHELQDCDANVFIALYQSILGEKVPDLIVLPRNQEDEAHNVQAVIDSLALDYLQVSLSHITGENIVKGDNESIRNLLEIFDGLLDYLTEHISESSPNKSETEQ 127          
BLAST of Centrosomal protein 95 vs. UniProt/SwissProt
Match: sp|Q96GE4|CEP95_HUMAN (Centrosomal protein of 95 kDa OS=Homo sapiens OX=9606 GN=CEP95 PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 9.025e-38
Identity = 89/242 (36.78%), Postives = 158/242 (65.29%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQ--SHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQV 2242
            +L+ FP L +S  T+  +W Q   Q   +++    ++   K L  + +IE+A RR  LLT L++KE  H  RLQ+ KD  + Q  T S  ++ RQQ  RA++Y +++   + A+MM  + REE +F+ +F+E L IQ+ R+ ++R YAK+ ++EQ   +Q +L+S+E YY+D+F++ A+ + +E QE+  ++KSQ   L K+K+E+RSK+E +I+ LQ+ + ++  +V+FREL+A++  S++
Sbjct:  569 MLEQFPFLYVSGPTLSKMWKQQIAQVEQLKKEACRENRSKKKL--QDEIEEALRRHDLLTTLVKKEYEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSMENYYKDQFSLLAEAISQEHQELKAREKSQAQTLHKVKRELRSKMEKEIQQLQDMITQNDDDVFFRELEAERFRSRL 808          

HSP 2 Score: 82.4185 bits (202), Expect = 8.171e-15
Identity = 41/135 (30.37%), Postives = 80/135 (59.26%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQVENEKQKSRMIEGAENMR 577
            +A N+L    + L++ ++++ ++ +F+  Y+ ILG ++ + I  P +++DD  N+ AVID L+   L+VSLSHI   +++ G + ++ +LLEIF GL E + +   E +  ++  EQ   E  +   +E  E+ +
Sbjct:   11 IANNLLFKCHIHLRIHELQDCDANVFIALYQSILGEKVPDLIVIPRSQEDDAHNVQAVIDSLALDYLQVSLSHITGENIVKGDKESIKNLLEIFDGLLEYLTERISETSHEKSETEQYFKESDRGERLEEPESTK 145          
BLAST of Centrosomal protein 95 vs. TrEMBL
Match: K1PYC5 (Coiled-coil domain-containing protein 45 OS=Crassostrea gigas OX=29159 GN=CGI_10027483 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 2.701e-43
Identity = 88/244 (36.07%), Postives = 166/244 (68.03%), Query Frame = 2
Query: 1502 DRESVTQLLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVL 2233
            D + +  LL  FP L LS  T   LW +   Q   + +++Q    K    + ++E+A +R +++  +++KE  H  R++E K+  K  +   ++ +++R QSAR+++Y +++   MR++M+ ++ +EE +FR +FK+ L IQ+DR+ E+++YAK+ ++ Q ++ + ++ES+E YYRD+F M A+++ KER+EI +++K+Q+ VL ++KKE+R K+E++IRLLQ+ LV+   + YFR+LDA +V+
Sbjct:  645 DEDILPILLKEFPHLHLSLHTWHELWRKGIHQIEQVTRANQEVRRKKSKAKSELEEAEKRHEIMVNIMKKEIEHGQRMKEIKERHKQTVVAKNMIQEKRAQSARSRKYYDDYQVRMRSKMLKRRTKEEMIFRKLFKDGLDIQKDRVRELKKYAKEQRDTQASTQRNEIESMENYYRDQFEMLAESITKERKEILVREKAQQKVLGQMKKELRHKMESEIRLLQDQLVRDDDDAYFRQLDADRVI 888          

HSP 2 Score: 78.5666 bits (192), Expect = 4.435e-11
Identity = 44/131 (33.59%), Postives = 76/131 (58.02%), Query Frame = 2
Query:   89 NNLF*IHINQFNYISELKKIMLQEDI--FKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECM 475
            +  F +++  F      K+ + QEDI   + A  +L+ +     L  +E+IN+ ++V  +E + G +L   I+ P++ +D+ QNI  VID LS  +L  SL+HI   +V++G R ++ +LLEIF GL E +
Sbjct:   31 DEFFNMYMVPFKIKMGPKERLNQEDIKIVRQANLLLEQLNAGSSLGCVEDINAAVYVTLFEGLCGEKLHGVIQKPISREDEIQNIQLVIDILSRDILHTSLAHITGREVVDGNRESIWNLLEIFGGLLEYI 161          
BLAST of Centrosomal protein 95 vs. TrEMBL
Match: C3Y9B9 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_68040 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 4.361e-43
Identity = 94/240 (39.17%), Postives = 161/240 (67.08%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQV 2242
            L++ FP L +S  T+ ++W +   Q   I +  +  +SK    +++ EDA++RQ+ +  +L KE  HQ R++E +D  K Q       +++RQQSARA+RY +E+   MRA+M+ ++ REEQ+F+ +F+E L IQ+ RI ++R+YAK+ ++      Q +LES+E YYRD+F+M A+TL +ER E+ ++DK+Q  VL K+++E+R K+E +I+ LQE L + + + YFR+L+A ++  Q+
Sbjct:  325 LMEEFPFLHVSPHTMANMWRRQMKQIEQITKMSEP-VSKRTKTQKQFEDAKKRQETMLKILDKERQHQQRMKELRDRSKQQRQVHRAVQQKRQQSARARRYYDEYQVRMRAKMLKRKTREEQIFKKLFEEGLGIQKTRIRDLRQYAKEKRDHVAQRQQDELESMENYYRDQFSMLAETLTRERYELQIRDKAQAKVLEKMRRELRQKMEQEIKGLQEQLTRDEDDAYFRQLEADRLRRQL 563          
BLAST of Centrosomal protein 95 vs. TrEMBL
Match: A0A1S3H7K8 (uncharacterized protein LOC106152154 OS=Lingula unguis OX=7574 GN=LOC106152154 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.159e-42
Identity = 91/236 (38.56%), Postives = 159/236 (67.37%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQV 2230
            +L+ FP + LSE TI  +W ++  Q   + ++ Q    K    + + E+A+RRQ++L  +++KE  H  ++QE K+ R  + A  +   ++R QSARA+RY +++   MR+RM+ K+ +EE +F+ +FKE L+IQ++R+ ++R YAK+ +  +    Q ++ESLE +YRD+F M A+++ KER+E+ +++K+QE VL K+K E+R K+E +IR  QE L + + +VY+R+LDA +V
Sbjct: 1384 MLEEFPFIHLSEHTIHDVWKKSYRQVEQLSKAAQEVKRKKSAAQAQYEEAKRRQEVLMNIMKKELSHNQKMQEVKERRAHEQAMKAKIREKRMQSARARRYYDDYQVRMRSRMLKKRTKEEMIFKKLFKEGLEIQKERLRDLRSYAKEQREVKTRLQQNEIESLENFYRDQFAMLAESMAKERKELQVREKAQEKVLSKMKGELRKKMETEIREFQEQLYRDEDDVYYRQLDADRV 1619          

HSP 2 Score: 73.9442 bits (180), Expect = 1.229e-9
Identity = 32/100 (32.00%), Postives = 61/100 (61.00%), Query Frame = 2
Query:  170 KLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAE 469
            +L  N+L  + V +++  ++ IN+ +FV  YE ++G+ L + I  P++ +D+  N   V+D +S  +L  SLSHI    +++G   ++ +L+E+F GL E
Sbjct:    9 QLTNNMLAQLHVPIRVKTLKEINANVFVTLYEGMMGDRLPDIIRNPMSIEDEIHNCQCVVDSISLDILHTSLSHITGQSIVHGDPGSIMNLVEVFSGLLE 108          
BLAST of Centrosomal protein 95 vs. TrEMBL
Match: A0A3S0ZTY7 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_016999 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 8.627e-42
Identity = 89/236 (37.71%), Postives = 155/236 (65.68%), Query Frame = 2
Query: 1535 FPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQV 2242
            FP L LSE T   LW +  +Q  +I ++HQ    K    + ++EDA  R +LL  +++K+  H  RL++ KD+++ QI+T +   ++R QSARA+RY  E+    R++ + ++ +EE VFR +FKEAL IQ++RI ++R+YA D +  Q +  Q +++SLE +Y D+F M ++ L KE++E  +++ +Q+ ++ +LK+E+R K+E +I+  QE L +   +V+FR+ DA +VL Q+
Sbjct:   15 FPHLHLSEHTWHELWRKGLSQIEAITRAHQEGQRKKSRAQGQLEDAAHRHELLADIMKKQLDHTKRLRDVKDQKQQQISTRNKMHEKRIQSARARRYYNEYQVRARSKQLKRRTKEEMVFRDLFKEALSIQKERIKDVRQYASDHRKRQESRRQDEIDSLENFYHDQFEMLSERLTKEQKETEVREAAQQQIMQRLKRELRKKMETEIKQYQEELFRDDDDVHFRKCDADRVLKQL 250          
BLAST of Centrosomal protein 95 vs. TrEMBL
Match: R7UKT7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228536 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.910e-40
Identity = 92/237 (38.82%), Postives = 161/237 (67.93%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIAT-LSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQV 2230
            LL+ FP L LS ETI  LW +++ Q   + ++ +    K    + ++  A R+Q+LL  +++KE  H  R++E ++ RK Q +   SI+EK RQ SAR+++Y +EF   MR++M+ K+ REE +F+ +F+E L IQ+DRI E+R+YAKD + ++      DL SLE YY+D+F++ A+++ KER+E+++++ +Q  +L  +K+E+R K+E +IR  Q+ L + + ++YFR+LDA+++
Sbjct:  580 LLEEFPFLHLSSETIHDLWRKSSRQVEQMSKAEKDTKLKRNKQQDQLLQAERKQQLLLNIMKKEVAHNQRMKEVEERRKQQQSVKASIREK-RQASARSRKYYDEFQVRMRSKMLKKRNREEMLFKKLFEEGLDIQKDRIRELRKYAKDQREKRSEIQGNDLASLENYYKDQFSLLAESMAKERKELSIRENAQSKLLGSMKQELRKKMEREIRDFQDQLWRDEDDIYFRDLDAQRI 815          

HSP 2 Score: 75.485 bits (184), Expect = 3.796e-10
Identity = 40/104 (38.46%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  164 IFKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECM 475
            I +LA  IL  I V  ++  +E+I   +FVL +E + G  L +    P T +D   N   VID LS  VL  SLSHI    ++ G  +A+ +LL++F GL E M
Sbjct:   10 IVQLANEILSQIHVTTRVRCVEDITPSIFVLLFEGLCGEVLPDVKRHPRTREDAIHNSQVVIDTLSMDVLNTSLSHITGDAIVAGDHTAIANLLDVFSGLLEYM 113          
BLAST of Centrosomal protein 95 vs. Ensembl Cavefish
Match: CEP95 (centrosomal protein 95 [Source:NCBI gene;Acc:103047087])

HSP 1 Score: 136.732 bits (343), Expect = 9.518e-33
Identity = 85/241 (35.27%), Postives = 154/241 (63.90%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQ-SHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQV 2242
            LL+ +P L  S  T+  +W Q   Q   +    +Q   ++      ++E+A +R  LLT ++RKE  H  RL++ ++  + Q +T +   +QRQQ ARA++Y  ++   +RAR++  + REE++FR +F+E L++Q+ R+ E R YAK+ + E    ++ ++E++E YYRD+F+M A+ L  ERQEI ++ K+QE  L K+K+E+R+K+E +I  LQ+ +V++  + YFR+L+ +++  +V
Sbjct:  613 LLEDYPPLPFSSHTLSSMWKQQLRQIDQLNPVDNQRRNARSAKLTNQVEEAHKRHDLLTEIIRKEQEHNRRLKDFRERIQQQRSTQNKLREQRQQVARARKYHSDYHVQLRARLLRARTREERMFRQVFEEGLELQKARLREQRAYAKEQRQEHQRKHKDEIEAMENYYRDQFSMLAERLSLERQEIQVRKKAQEKALYKMKRELRNKMEREISELQQIIVQNDDDDYFRDLELERLRKRV 853          

HSP 2 Score: 77.7962 bits (190), Expect = 2.500e-14
Identity = 35/105 (33.33%), Postives = 65/105 (61.90%), Query Frame = 2
Query:  161 DIFKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECM 475
            D   +A ++L    + L+L  + + ++ +FV  YE +LG ++ + I  P +++DD  N+ +VID L+   L++SLSHI   +++ G + ++ +LLEIF GL E +
Sbjct:    8 DWVDVANDLLCKCHINLRLQRLTDCDANVFVALYEALLGEKVPDYIAIPKSQEDDIHNVQSVIDSLALDYLQISLSHITGENIVRGDKDSIRNLLEIFDGLLEYL 112          
BLAST of Centrosomal protein 95 vs. Ensembl Cavefish
Match: CEP95 (centrosomal protein 95 [Source:NCBI gene;Acc:103047087])

HSP 1 Score: 136.732 bits (343), Expect = 1.084e-32
Identity = 85/241 (35.27%), Postives = 154/241 (63.90%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIRQ-SHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQV 2242
            LL+ +P L  S  T+  +W Q   Q   +    +Q   ++      ++E+A +R  LLT ++RKE  H  RL++ ++  + Q +T +   +QRQQ ARA++Y  ++   +RAR++  + REE++FR +F+E L++Q+ R+ E R YAK+ + E    ++ ++E++E YYRD+F+M A+ L  ERQEI ++ K+QE  L K+K+E+R+K+E +I  LQ+ +V++  + YFR+L+ +++  +V
Sbjct:  612 LLEDYPPLPFSSHTLSSMWKQQLRQIDQLNPVDNQRRNARSAKLTNQVEEAHKRHDLLTEIIRKEQEHNRRLKDFRERIQQQRSTQNKLREQRQQVARARKYHSDYHVQLRARLLRARTREERMFRQVFEEGLELQKARLREQRAYAKEQRQEHQRKHKDEIEAMENYYRDQFSMLAERLSLERQEIQVRKKAQEKALYKMKRELRNKMEREISELQQIIVQNDDDDYFRDLELERLRKRV 852          

HSP 2 Score: 78.1814 bits (191), Expect = 2.313e-14
Identity = 35/105 (33.33%), Postives = 65/105 (61.90%), Query Frame = 2
Query:  161 DIFKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECM 475
            D   +A ++L    + L+L  + + ++ +FV  YE +LG ++ + I  P +++DD  N+ +VID L+   L++SLSHI   +++ G + ++ +LLEIF GL E +
Sbjct:    7 DWVDVANDLLCKCHINLRLQRLTDCDANVFVALYEALLGEKVPDYIAIPKSQEDDIHNVQSVIDSLALDYLQISLSHITGENIVRGDKDSIRNLLEIFDGLLEYL 111          
BLAST of Centrosomal protein 95 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005672.1 (pep scaffold:Pmarinus_7.0:GL477092:85378:98038:-1 gene:ENSPMAG00000005125.1 transcript:ENSPMAT00000005672.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 1.350e-29
Identity = 113/390 (28.97%), Postives = 197/390 (50.51%), Query Frame = 2
Query: 1112 IIHKGYEKEFLDMLLDEGDNLEAARKKTETNAELLRKFSEHEICSRPLSAFDELVKFEDEQNIEDCPRTSNRNRKPYQSFSERIQQRNSNLKSYVRPV-VKHLGGNYNRKCMEXXXXXXXXXXXXXXXXXXDRESVTQLLDSFPGLELSEETIRHLWNQAATQ-------ASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRS-----MFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQV 2242
            ++ + YE+E  D  + EG  LE  R          RK +E  I   P ++                    N ++ P   F+             V P+   H  G   R   E  + S +  +  +    ++ + +  LL  FP L +S  T+  +W+Q   Q       A+   +SH    S+L       E+A+R+  LL  +++KE  H  RL+E ++  + Q A+ S + +QR+Q ARA+ Y   +    RARM+ ++ REE+  +      +F+E L+IQ++R++E+R YA D  +EQ    + +L+S+E YY+D+F M ADT+ +ER+++ +++K+Q   + KL++E+R K+E DI+ LQE L +     +FRE++A +V  Q+
Sbjct:  139 VVKRAYEEELKDARVREGLRLETDR----------RKLTEMVIALPPAASS----------------YGGNISKDPRSPFT-------------VCPIYAPHRAGTGGRVQGERASASAAHPTGPARLRVKENDLLPVLLAEFPHLHISPHTLNRMWHQQCQQMDRLTRIAARPDRSHAKLQSEL-------EEAQRKHDLLVAIIKKEQEHNQRLREVRERVRQQKASESRRREQREQVARARHYYSRYHLQQRARMLRERTREERREKVRESCLLFEEGLEIQKERLSELRSYAHDKHDEQRQRQRDELQSVENYYKDQFAMLADTVSQERRDMQVREKAQGKAVHKLRRELRGKMERDIQELQELLARDDAVAHFREVEADRVRRQL 482          
BLAST of Centrosomal protein 95 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010237.1 (pep scaffold:Pmarinus_7.0:GL479778:2977:7538:-1 gene:ENSPMAG00000009271.1 transcript:ENSPMAT00000010237.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 1.959e-16
Identity = 37/120 (30.83%), Postives = 73/120 (60.83%), Query Frame = 2
Query:  167 FKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQV 526
             ++A  +L+   V L++  +   ++ +FV  YE  LG ++ + I  P +++DD  N+ ++ID L+   L++SLSHI   +V+NG + ++ +LLEIF GL + + ++  E +S+ +  + V
Sbjct:    4 VRVANELLRRCHVNLRVRRLAECDANVFVAIYEATLGEKVPDSIAVPKSKEDDAHNVQSIIDSLALDYLQISLSHITGENVVNGHKDSIRNLLEIFDGLVDYLSEQVDEDSSQHSGDDDV 123          
BLAST of Centrosomal protein 95 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010238.1 (pep scaffold:Pmarinus_7.0:GL479778:2977:7538:-1 gene:ENSPMAG00000009271.1 transcript:ENSPMAT00000010238.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 3.306e-16
Identity = 41/141 (29.08%), Postives = 80/141 (56.74%), Query Frame = 2
Query:  167 FKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQVENEKQKSRMIEGAENMRLKKR 589
             ++A  +L+   V L++  +   ++ +FV  YE  LG ++ + I  P +++DD  N+ ++ID L+   L++SLSHI   +V+NG + ++ +LLEIF GL + + ++  E +S+ +   +  N K+    +    + RL  R
Sbjct:    4 VRVANELLRRCHVNLRVRRLAECDANVFVAIYEATLGEKVPDSIAVPKSKEDDAHNVQSIIDSLALDYLQISLSHITGENVVNGHKDSIRNLLEIFDGLVDYLSEQVDEDSSQHS---ETYNPKKNQDNVRSYVSRRLLPR 141          
BLAST of Centrosomal protein 95 vs. Ensembl Nematostella
Match: EDO47908 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKG9])

HSP 1 Score: 129.413 bits (324), Expect = 6.931e-34
Identity = 67/187 (35.83%), Postives = 130/187 (69.52%), Query Frame = 2
Query: 1661 IEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDA 2221
            +E+A  RQ+ L  +L+KE  H  R++E++D  ++Q +  +   ++RQ +ARA+RY +++   MRA+M+ ++ REEQ+F+ +F+E L IQ+ R+ E+R+YA++ +       Q +++SLE YYRD+F+M A+ + +ER E+ ++ ++QE V+ ++++E+R K+E +++  Q +L + +   YFR+L+A
Sbjct:   28 VEEAEARQEKLLRILKKELDHNHRMREQRDREESQRSVKTKINEKRQVAARARRYYDDYQLRMRAKMLKRRTREEQIFKKLFEEGLDIQKHRVRELRQYAREKREALAQRQQNEIDSLENYYRDQFSMLAEEMSRERYEVKVRQQAQEKVVRQMRRELRQKMEKEVQDFQANLTRDEDSAYFRQLEA 214          
BLAST of Centrosomal protein 95 vs. Ensembl Nematostella
Match: EDO47907 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKG8])

HSP 1 Score: 75.485 bits (184), Expect = 5.159e-14
Identity = 40/113 (35.40%), Postives = 64/113 (56.64%), Query Frame = 2
Query:  137 LKKIMLQED--IFKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAE 469
            + K+  +ED     +A  +L   G+K K++ +    +  F+  YE ++G++L+  I+ PV   D   N   VID ++N VLRV LSHI+   ++ G R  + +LLEIF GL E
Sbjct:    1 MDKLEAEEDEGFVDMANELLSKSGIKAKVSSLSECGADYFIKIYEGLIGDDLQGLIKNPVLVSDQIDNCQHVIDAIANDVLRVDLSHISAKGIVKGARIDIRNLLEIFTGLLE 113          
BLAST of Centrosomal protein 95 vs. Ensembl Medaka
Match: ENSORLT00000017228.2 (centrosomal protein 95 [Source:NCBI gene;Acc:101159246])

HSP 1 Score: 135.576 bits (340), Expect = 2.440e-32
Identity = 80/255 (31.37%), Postives = 158/255 (61.96%), Query Frame = 2
Query: 1523 LLDSFPGLELSEETIRHLWNQAATQASSIR---QSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQVARK*ISHQMVFM 2278
            L D  P L +S   +  +W Q   QA  +R    S+ H  SK+    +++E+A+++  LL  L+RK+  H  RL + KD    Q +  +   +Q+QQ AR+K+Y  +F    RAR+M  + +EE++FR +F+E L++Q+ R+ + R +A++   E+   +Q  +ES+E YY+D+F++ A+ L +ER+++ ++ K+QE  LLK+K+E+RS++E +I  LQ+ ++++ ++ + ++L+ +++ ++V      H   ++
Sbjct:  632 LRDELPHLHVSPHALAGMWEQQMQQADRLRAASSSNSHRRSKV---SRQLEEAQKKHDLLLELVRKDQEHSKRLGDFKDRIMQQRSAQNRLREQKQQVARSKKYHNDFHVQHRARLMRARTKEERIFRQLFQEGLELQKARLRDQRVHAREQWAERQRRHQDQIESMENYYKDQFSLLAEKLAQEREDVQVRKKAQEKALLKMKRELRSRMEREIGELQKIIIQNDNDDWVQDLEVQRLRNRVHMASFQHNTSYL 883          

HSP 2 Score: 89.3521 bits (220), Expect = 7.401e-18
Identity = 40/104 (38.46%), Postives = 68/104 (65.38%), Query Frame = 2
Query:  173 LATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQE 484
            +A ++L+   + L+L D+ + N+ +FV  YE ILG ++ + I  P +++DD  N+ +VID LS   L++SLSHI   +++ G + ++ +LLEIF GL E + QE
Sbjct:   13 VANDLLRQCHLSLRLRDMTDCNADVFVSLYENILGEKVPDYIAVPCSQEDDVHNVQSVIDSLSLDYLQISLSHITGENIVRGDKESIRNLLEIFDGLLEYLHQE 116          
BLAST of Centrosomal protein 95 vs. Planmine SMEST
Match: SMESG000002923.1 (SMESG000002923.1)

HSP 1 Score: 1355.12 bits (3506), Expect = 0.000e+0
Identity = 692/701 (98.72%), Postives = 696/701 (99.29%), Query Frame = 2
Query:  149 MLQEDIFKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQVENEKQKSRMIEGAENMRLKKRIDATDKQVDNLTRATEQVMEMSSARQRFLHEQIGKLIDKGPGWISDCGDKKFHSDTLLEYVNDHKDRIRMTEAAIGQLSNRSANQPIWQSRSHRRNSSGGDGKELSRHGQEDELTFITANDAYVRRHRDDEVSCNSNETYILESTTXXXXXXXXXXXLNENLHMKDAWAQVNKDIIHKGYEKEFLDMLLDEGDNLEAARKKTETNAELLRKFSEHEICSRPLSAFDELVKFEDEQNIEDCPRTSNRNRKPYQSFSERIQQRNSNLKSYVRPVVKHLGGNYNRKCMEXXXXXXXXXXXXXXXXXXDRESVTQLLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQVARK 2251
            MLQEDIFKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQVENEKQKSRMIEGAENMRLKKRIDATDKQVDNLTRATEQVMEMSSARQRFLHEQIGKLIDKGPGWISDCGDKKFHSDTLLEYVNDHKDRIRMTEAAIGQLSNRSANQPI Q RSHRRNSSGGDGKELSRHGQEDELTFITANDAYVRRHRDDEVSC SNETYIL+STTSRSDRRPSDIDLNE+LHMKDAWAQVNKDIIHKGYEKEFLDMLLDEGDNLEAARKKTETNAELLRKFSEHEICSRPLSAFDELVKFEDEQN EDCPRTSNRNRKPYQSFSERIQQRNSNLKSYVRPVVKHLGGNYNRKCMETRTNSNSRRSNHSLTSSRDRESVTQLLDSFPGLELSE+TIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKER EINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLS+VARK
Sbjct:    1 MLQEDIFKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKIECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLEIFQGLAECMQQEKKEKNSRRNTREQVENEKQKSRMIEGAENMRLKKRIDATDKQVDNLTRATEQVMEMSSARQRFLHEQIGKLIDKGPGWISDCGDKKFHSDTLLEYVNDHKDRIRMTEAAIGQLSNRSANQPIGQPRSHRRNSSGGDGKELSRHGQEDELTFITANDAYVRRHRDDEVSCASNETYILQSTTSRSDRRPSDIDLNEDLHMKDAWAQVNKDIIHKGYEKEFLDMLLDEGDNLEAARKKTETNAELLRKFSEHEICSRPLSAFDELVKFEDEQNSEDCPRTSNRNRKPYQSFSERIQQRNSNLKSYVRPVVKHLGGNYNRKCMETRTNSNSRRSNHSLTSSRDRESVTQLLDSFPGLELSEQTIRHLWNQAATQASSIRQSHQHFISKLLPGEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQRQQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEMRRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERHEINLQDKSQELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSEVARK 701          
The following BLAST results are available for this feature:
BLAST of Centrosomal protein 95 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP951.714e-3836.78centrosomal protein 95 [Source:HGNC Symbol;Acc:HGN... [more]
CEP951.879e-3836.78centrosomal protein 95 [Source:HGNC Symbol;Acc:HGN... [more]
CEP951.619e-1431.58centrosomal protein 95 [Source:HGNC Symbol;Acc:HGN... [more]
CEP952.930e-1431.86centrosomal protein 95 [Source:HGNC Symbol;Acc:HGN... [more]
CEP951.372e-1340.00centrosomal protein 95 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lin7b5.425e-2137.50lin-7 homolog B [Source:Xenbase;Acc:XB-GENE-582709... [more]
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cep953.498e-3936.05centrosomal protein 95 [Source:MGI Symbol;Acc:MGI:... [more]
Cep954.043e-3936.05centrosomal protein 95 [Source:MGI Symbol;Acc:MGI:... [more]
Cep951.080e-1637.50centrosomal protein 95 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Centrosomal protein 95 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q5XI03|CEP95_RAT1.221e-3836.91Centrosomal protein of 95 kDa OS=Rattus norvegicus... [more]
sp|Q8BVV7|CEP95_MOUSE2.828e-3836.05Centrosomal protein of 95 kDa OS=Mus musculus OX=1... [more]
sp|Q96GE4|CEP95_HUMAN9.025e-3836.78Centrosomal protein of 95 kDa OS=Homo sapiens OX=9... [more]
back to top
BLAST of Centrosomal protein 95 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PYC52.701e-4336.07Coiled-coil domain-containing protein 45 OS=Crasso... [more]
C3Y9B94.361e-4339.17Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A1S3H7K81.159e-4238.56uncharacterized protein LOC106152154 OS=Lingula un... [more]
A0A3S0ZTY78.627e-4237.71Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
R7UKT71.910e-4038.82Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CEP959.518e-3335.27centrosomal protein 95 [Source:NCBI gene;Acc:10304... [more]
CEP951.084e-3235.27centrosomal protein 95 [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005672.11.350e-2928.97pep scaffold:Pmarinus_7.0:GL477092:85378:98038:-1 ... [more]
ENSPMAT00000010237.11.959e-1630.83pep scaffold:Pmarinus_7.0:GL479778:2977:7538:-1 ge... [more]
ENSPMAT00000010238.13.306e-1629.08pep scaffold:Pmarinus_7.0:GL479778:2977:7538:-1 ge... [more]
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO479086.931e-3435.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479075.159e-1435.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosomal protein 95 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000017228.22.440e-3231.37centrosomal protein 95 [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of Centrosomal protein 95 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002923.10.000e+098.72SMESG000002923.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000126 ID=SMED30000126|Name=Centrosomal protein 95|organism=Schmidtea mediterranea sexual|type=transcript|length=2337bp
TATAAGTGTAAATTTAAATATATTAAATGCATTAATTTTAAACAATTTCT
AAGCTTTTTATAAGAATATCAAACATTTTTGAGTTCATAATAATTTATTT
TAAATTCATATTAATCAGTTTAATTACATTTCAGAGTTAAAGAAAATAAT
GCTACAAGAGGACATTTTTAAGTTGGCAACAAATATTTTAAAACTTATCG
GTGTAAAGCTGAAATTAACAGACATTGAAAATATTAATTCTAAATTGTTT
GTACTATTTTATGAAAAAATTTTAGGCAACGAATTAGAAAATAAAATTGA
ATGCCCAGTTACAGAAAAAGATGACTATCAAAATATTGTAGCTGTTATTG
ATAAACTTTCTAACAAAGTATTACGAGTTTCATTGTCGCATATAAATCCA
ATTGATGTGCTTAACGGCAAACGAAGCGCAGTGACACATTTATTGGAGAT
ATTTCAAGGTCTAGCTGAATGTATGCAACAAGAGAAAAAAGAAAAGAATA
GTAGAAGAAACACGCGAGAGCAAGTAGAAAATGAGAAGCAGAAGTCTCGA
ATGATCGAGGGAGCTGAAAATATGAGATTGAAGAAGCGAATTGATGCGAC
TGATAAACAAGTTGACAACTTGACAAGGGCCACTGAACAAGTGATGGAGA
TGAGTTCAGCAAGACAAAGATTTCTCCATGAACAGATCGGGAAATTGATT
GATAAAGGTCCCGGGTGGATAAGTGACTGTGGAGACAAGAAATTCCATTC
AGATACATTGCTAGAATATGTGAATGATCACAAGGACAGGATTAGAATGA
CCGAGGCAGCGATTGGCCAGCTGTCCAATCGATCGGCTAATCAGCCAATC
TGGCAATCGAGGAGTCACAGACGCAATTCGAGTGGCGGAGATGGGAAAGA
ACTGAGCAGACATGGACAAGAGGATGAATTGACCTTCATAACAGCAAATG
ATGCTTACGTGCGCCGACATAGAGATGATGAAGTCTCGTGTAACAGCAAT
GAAACCTACATATTGGAGTCAACCACCAGCAGAAGTGACCGCAGACCATC
TGATATTGATTTAAATGAAAATTTGCACATGAAAGACGCGTGGGCTCAAG
TTAATAAAGATATAATCCACAAGGGTTATGAGAAGGAATTCCTTGATATG
TTGCTTGATGAGGGCGATAATCTTGAGGCGGCCCGGAAAAAAACCGAAAC
CAATGCGGAATTACTGCGAAAATTTTCAGAACATGAGATATGTTCACGGC
CGCTATCAGCGTTTGATGAGTTGGTGAAATTCGAGGATGAACAGAACATC
GAGGATTGTCCGAGAACAAGCAATCGCAACCGCAAACCATACCAATCATT
CTCAGAACGGATTCAGCAGCGAAACTCGAATCTAAAAAGCTATGTCAGGC
CAGTTGTGAAGCATTTAGGTGGCAATTACAACAGGAAATGTATGGAAACC
AGGACAAATAGCAACAGCAGAAGAAGCAACCATTCTCTGACATCATCTCG
GGATCGGGAATCAGTTACCCAGTTGCTTGATTCATTCCCAGGACTGGAAT
TAAGTGAGGAAACCATTCGACATTTATGGAACCAAGCAGCAACACAGGCC
TCATCCATTCGGCAGTCTCACCAGCATTTTATATCAAAGCTGCTTCCTGG
TGAACAGAAAATTGAAGATGCTCGTCGAAGACAAAAATTGCTCACATTTT
TGCTGCGCAAAGAGGCGCTTCATCAAATGCGTCTCCAGGAACGGAAAGAC
GAAAGAAAAGCTCAAATCGCTACGCTTTCAATCAAAGAAAAGCAAAGACA
ACAATCTGCAAGAGCCAAGCGGTATGTGGAAGAGTTCTCCAATGGAATGA
GGGCACGCATGATGACTAAACAAGCCAGAGAAGAACAAGTGTTCCGTTCC
ATGTTCAAGGAGGCCCTGAAAATCCAGAGAGACAGAATAAATGAGATGCG
CCGGTACGCAAAGGACATGAAAAACGAGCAGTTGAATTCCTATCAGCGTG
ATCTGGAATCATTGGAAACCTACTATCGAGACAGATTTACAATGTGCGCG
GACACGCTGCGCAAGGAGCGCCAGGAAATAAATCTCCAGGATAAGTCACA
GGAACTAGTACTTCTGAAATTAAAGAAGGAGATGCGATCGAAACTGGAAA
ATGATATTCGATTGCTGCAGGAATCCTTGGTAAAAAGTCAACATGAAGTA
TATTTCAGAGAACTAGACGCGAAACAAGTCTTATCTCAGGTAGCTCGGAA
ATGAATCTCGCATCAAATGGTATTCATGTGATTTGAATATTAATAAACTG
TTTTCGAGGGTTCAGTTTGACTCTTTCATTCTTTGAA
back to top

protein sequence of SMED30000126-orf-1

>SMED30000126-orf-1 ID=SMED30000126-orf-1|Name=SMED30000126-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=702bp
MLQEDIFKLATNILKLIGVKLKLTDIENINSKLFVLFYEKILGNELENKI
ECPVTEKDDYQNIVAVIDKLSNKVLRVSLSHINPIDVLNGKRSAVTHLLE
IFQGLAECMQQEKKEKNSRRNTREQVENEKQKSRMIEGAENMRLKKRIDA
TDKQVDNLTRATEQVMEMSSARQRFLHEQIGKLIDKGPGWISDCGDKKFH
SDTLLEYVNDHKDRIRMTEAAIGQLSNRSANQPIWQSRSHRRNSSGGDGK
ELSRHGQEDELTFITANDAYVRRHRDDEVSCNSNETYILESTTSRSDRRP
SDIDLNENLHMKDAWAQVNKDIIHKGYEKEFLDMLLDEGDNLEAARKKTE
TNAELLRKFSEHEICSRPLSAFDELVKFEDEQNIEDCPRTSNRNRKPYQS
FSERIQQRNSNLKSYVRPVVKHLGGNYNRKCMETRTNSNSRRSNHSLTSS
RDRESVTQLLDSFPGLELSEETIRHLWNQAATQASSIRQSHQHFISKLLP
GEQKIEDARRRQKLLTFLLRKEALHQMRLQERKDERKAQIATLSIKEKQR
QQSARAKRYVEEFSNGMRARMMTKQAREEQVFRSMFKEALKIQRDRINEM
RRYAKDMKNEQLNSYQRDLESLETYYRDRFTMCADTLRKERQEINLQDKS
QELVLLKLKKEMRSKLENDIRLLQESLVKSQHEVYFRELDAKQVLSQVAR
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026619CEP95
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005813centrosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 590..625
NoneNo IPR availableCOILSCoilCoilcoord: 109..132
NoneNo IPR availableCOILSCoilCoilcoord: 639..683
NoneNo IPR availableCOILSCoilCoilcoord: 332..352
NoneNo IPR availableCOILSCoilCoilcoord: 141..161
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 222..242
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 243..258
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 112..133
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 221..259
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 431..455
IPR026619Centrosomal protein of 95kDaPANTHERPTHR22545UNCHARACTERIZEDcoord: 4..170
coord: 381..693